Asparagine synthetase [glutamine-hydrolyzing]

Overview
NameAsparagine synthetase [glutamine-hydrolyzing]
Smed IDSMED30014191
Length (bp)1798
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Asparagine synthetase [glutamine-hydrolyzing] (SMED30014191) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Asparagine synthetase [glutamine-hydrolyzing] (SMED30014191) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014191

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30014191h1SMcG0011166 SmedASXL_009894SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30014191h1SMcG0011166 Contig49005uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014191h1SMcG0011166 Contig49005newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30014191h1SMcG0011166 dd_Smed_v4_9118_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014191h1SMcG0011166 dd_Smed_v4_9118_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30014191h1SMcG0011166 dd_Smed_v6_9118_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Human
Match: ASNS (asparagine synthetase (glutamine-hydrolyzing) [Source:HGNC Symbol;Acc:HGNC:753])

HSP 1 Score: 504.212 bits (1297), Expect = 5.159e-173
Identity = 279/579 (48.19%), Postives = 384/579 (66.32%), Query Frame = 2
Query:   17 MCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHEEG--IQINILKPGCVLEFDLYDNGTVNT--SFKEHSFAKIGNQPIFKSLVEPDPN---KNIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYWMPRFVEAKDPSARDLSHYKCS 1732
            MCGIWA+ G +            IA RGPD++R EN+N Y +CC GFHRL++V  + GMQPIR+K+ P+L L  NGEIYN+K +   F  +  T  D E ++HLY+K G       LDGVF+  +LDT  KKVFL RD +GVRP+   + E GFL +CSE KG                   +  + H     +++    PG     DL  NG V +    K H    +    ++ ++ +  P    + +  N+R L   AV KRL ++RRIGCLLSGGLDSSL+A  L+K +KEA++ Y LQTF+IGM +D  D+LAARKV+  +G+EH+EV F+ E+ I+ L ++I+ LET+DITT+RAS+GMYL++K+I+ NTD++VIFSGEGSDELT GYIYFHKAP+PE   EE  RLL +L  FD+ RADRT +  GLE RVPFLD +FSSYYLSL P++R PK+GIEK LLR++F   NLIP+EILWRPKEAFSDG++ + K  ++ +LQ+Y   ++ D   + +++ +P  TP TKE +YYRQ FE+++P + +   +YWMP+++ A DPSAR L+HYK +
Sbjct:    1 MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYLWLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKG-------------------LVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDVPLHALYDNVEKLFPGFEIETVKNNLRILFNNAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGM-EDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGIT-SVKNSWFKILQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPKWINATDPSARTLTHYKSA 558          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Human
Match: ASNS (asparagine synthetase (glutamine-hydrolyzing) [Source:HGNC Symbol;Acc:HGNC:753])

HSP 1 Score: 504.212 bits (1297), Expect = 5.159e-173
Identity = 279/579 (48.19%), Postives = 384/579 (66.32%), Query Frame = 2
Query:   17 MCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHEEG--IQINILKPGCVLEFDLYDNGTVNT--SFKEHSFAKIGNQPIFKSLVEPDPN---KNIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYWMPRFVEAKDPSARDLSHYKCS 1732
            MCGIWA+ G +            IA RGPD++R EN+N Y +CC GFHRL++V  + GMQPIR+K+ P+L L  NGEIYN+K +   F  +  T  D E ++HLY+K G       LDGVF+  +LDT  KKVFL RD +GVRP+   + E GFL +CSE KG                   +  + H     +++    PG     DL  NG V +    K H    +    ++ ++ +  P    + +  N+R L   AV KRL ++RRIGCLLSGGLDSSL+A  L+K +KEA++ Y LQTF+IGM +D  D+LAARKV+  +G+EH+EV F+ E+ I+ L ++I+ LET+DITT+RAS+GMYL++K+I+ NTD++VIFSGEGSDELT GYIYFHKAP+PE   EE  RLL +L  FD+ RADRT +  GLE RVPFLD +FSSYYLSL P++R PK+GIEK LLR++F   NLIP+EILWRPKEAFSDG++ + K  ++ +LQ+Y   ++ D   + +++ +P  TP TKE +YYRQ FE+++P + +   +YWMP+++ A DPSAR L+HYK +
Sbjct:    1 MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYLWLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKG-------------------LVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDVPLHALYDNVEKLFPGFEIETVKNNLRILFNNAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGM-EDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGIT-SVKNSWFKILQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPKWINATDPSARTLTHYKSA 558          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Human
Match: ASNS (asparagine synthetase (glutamine-hydrolyzing) [Source:HGNC Symbol;Acc:HGNC:753])

HSP 1 Score: 504.212 bits (1297), Expect = 5.159e-173
Identity = 279/579 (48.19%), Postives = 384/579 (66.32%), Query Frame = 2
Query:   17 MCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHEEG--IQINILKPGCVLEFDLYDNGTVNT--SFKEHSFAKIGNQPIFKSLVEPDPN---KNIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYWMPRFVEAKDPSARDLSHYKCS 1732
            MCGIWA+ G +            IA RGPD++R EN+N Y +CC GFHRL++V  + GMQPIR+K+ P+L L  NGEIYN+K +   F  +  T  D E ++HLY+K G       LDGVF+  +LDT  KKVFL RD +GVRP+   + E GFL +CSE KG                   +  + H     +++    PG     DL  NG V +    K H    +    ++ ++ +  P    + +  N+R L   AV KRL ++RRIGCLLSGGLDSSL+A  L+K +KEA++ Y LQTF+IGM +D  D+LAARKV+  +G+EH+EV F+ E+ I+ L ++I+ LET+DITT+RAS+GMYL++K+I+ NTD++VIFSGEGSDELT GYIYFHKAP+PE   EE  RLL +L  FD+ RADRT +  GLE RVPFLD +FSSYYLSL P++R PK+GIEK LLR++F   NLIP+EILWRPKEAFSDG++ + K  ++ +LQ+Y   ++ D   + +++ +P  TP TKE +YYRQ FE+++P + +   +YWMP+++ A DPSAR L+HYK +
Sbjct:    1 MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYLWLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKG-------------------LVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDVPLHALYDNVEKLFPGFEIETVKNNLRILFNNAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGM-EDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGIT-SVKNSWFKILQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPKWINATDPSARTLTHYKSA 558          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Human
Match: ASNS (asparagine synthetase (glutamine-hydrolyzing) [Source:HGNC Symbol;Acc:HGNC:753])

HSP 1 Score: 493.426 bits (1269), Expect = 4.915e-169
Identity = 272/556 (48.92%), Postives = 375/556 (67.45%), Query Frame = 2
Query:   86 IADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHEEG--IQINILKPGCVLEFDLYDNGTVNTS--FKEHSFAKIGNQPIFKSLVEPDPN---KNIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYWMPRFVEAKDPSARDLSHYKCS 1732
            IA RGPD++R EN+N Y +CC GFHRL++V  + GMQPIR+K+ P+L L  NGEIYN+K +   F  +  T  D E ++HLY+K G       LDGVF+  +LDT  KKVFL RD +GVRP+   + E GFL +CSE KG                   +  + H     +++    PG     DL  NG V +    K H    +    ++ ++ +  P    + +  N+R L   AV KRL ++RRIGCLLSGGLDSSL+A  L+K +KEA++ Y LQTF+IGM +D  D+LAARKV+  +G+EH+EV F+ E+ I+ L ++I+ LET+DITT+RAS+GMYL++K+I+ NTD++VIFSGEGSDELT GYIYFHKAP+PE   EE  RLL +L  FD+ RADRT +  GLE RVPFLD +FSSYYLSL P++R PK+GIEK LLR++F   NLIP+EILWRPKEAFSDG++ + K  ++ +LQ+Y   ++ D   + +++ +P  TP TKE +YYRQ FE+++P + +   +YWMP+++ A DPSAR L+HYK +
Sbjct:    3 IAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYLWLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKG-------------------LVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDVPLHALYDNVEKLFPGFEIETVKNNLRILFNNAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGM-EDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGIT-SVKNSWFKILQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPKWINATDPSARTLTHYKSA 537          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Human
Match: ASNS (asparagine synthetase (glutamine-hydrolyzing) [Source:HGNC Symbol;Acc:HGNC:753])

HSP 1 Score: 493.426 bits (1269), Expect = 4.915e-169
Identity = 272/556 (48.92%), Postives = 375/556 (67.45%), Query Frame = 2
Query:   86 IADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHEEG--IQINILKPGCVLEFDLYDNGTVNTS--FKEHSFAKIGNQPIFKSLVEPDPN---KNIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYWMPRFVEAKDPSARDLSHYKCS 1732
            IA RGPD++R EN+N Y +CC GFHRL++V  + GMQPIR+K+ P+L L  NGEIYN+K +   F  +  T  D E ++HLY+K G       LDGVF+  +LDT  KKVFL RD +GVRP+   + E GFL +CSE KG                   +  + H     +++    PG     DL  NG V +    K H    +    ++ ++ +  P    + +  N+R L   AV KRL ++RRIGCLLSGGLDSSL+A  L+K +KEA++ Y LQTF+IGM +D  D+LAARKV+  +G+EH+EV F+ E+ I+ L ++I+ LET+DITT+RAS+GMYL++K+I+ NTD++VIFSGEGSDELT GYIYFHKAP+PE   EE  RLL +L  FD+ RADRT +  GLE RVPFLD +FSSYYLSL P++R PK+GIEK LLR++F   NLIP+EILWRPKEAFSDG++ + K  ++ +LQ+Y   ++ D   + +++ +P  TP TKE +YYRQ FE+++P + +   +YWMP+++ A DPSAR L+HYK +
Sbjct:    3 IAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYLWLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKG-------------------LVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDVPLHALYDNVEKLFPGFEIETVKNNLRILFNNAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGM-EDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGIT-SVKNSWFKILQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPKWINATDPSARTLTHYKSA 537          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Celegans
Match: asns-1 (Asparagine synthetase [Source:UniProtKB/TrEMBL;Acc:O16924])

HSP 1 Score: 241.121 bits (614), Expect = 8.590e-72
Identity = 190/545 (34.86%), Postives = 276/545 (50.64%), Query Frame = 2
Query:   17 MCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIV--GDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTT-HSDIECMIHLYEKLGP--VGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHEEGIQINILKPGCVLEFDLYDNGTVNTSFKEHSFAKIGNQPIFKSLVEPDPNKNIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYF 1636
            MCGIWAIIG E  T      F  I  RGPD   +E +    +  LGFHRL+IV  GD    QPI       LS++CNGEIYN++SL  +    +    SD   +I  + K          +LDGVF+  + D   K V++ RD  GVRP+ Y     G L I SE+K                        + E   ++    PGC     L+         + +S   I ++  F S+   D  K +   +R +L  +V KRL   R  G +LSGGLDSSLIA +  + +K+  I      FS+G  +D  D+  A+KV+ +L   H  +  + +  I ++P++++ LETFD   IR  I  YLL + I  ++D  V+ SGEG+DEL G Y Y  +APN    H+E +R ++ L  +D+ R DR+ S  GLE RVPFLD +F      L P  +     +EK +LR +F G   +P+E+LWR KE F++ +    K     +L ++ ++ IS   Y + +E +P  TP T E ++YRQ FE  F
Sbjct:    1 MCGIWAIIG-EQVTPQQQDAFMKIVGRGPDLTVLEEVQ--PNVHLGFHRLAIVMPGDTPSAQPI---VGGGLSVVCNGEIYNHQSLKIDCPFTLKNGGSDCAAIITSFIKHNKDLKEACASLDGVFAFIMAD--DKNVYIGRDPIGVRPLFYGYNSNGSLLIGSEVK-----------------------CIEELCERVEYFPPGCCATISLFAPTRPVQPQQYYSVPTIADR--FLSI---DCTKTL---VRDVLVKSVEKRLMGNRNFGFMLSGGLDSSLIASIATRFLKQKPI-----AFSVGF-EDSPDLENAKKVADYLKIPHEVLVITPQQCIDIIPEVVFALETFDPLIIRCGIAHYLLCQHISKSSDVKVLLSGEGADELFGSYAYMQRAPNALHLHKEILRRMHHLHQYDVLRCDRSTSCHGLEIRVPFLDKRFIDLVSRLPPSYKLMPMKLEKHVLRSAFEG--WLPDEVLWRSKEGFAEALG---KTDLGDILAEHCDKLISKSLYERRAERFPDRTPETTEEYWYRQIFEDTF 495          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Celegans
Match: asns-2 (Asparagine synthetase [Source:UniProtKB/TrEMBL;Acc:Q65ZI9])

HSP 1 Score: 225.328 bits (573), Expect = 8.160e-66
Identity = 142/320 (44.38%), Postives = 207/320 (64.69%), Query Frame = 2
Query:  773 AAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPK---DG--IEKWLLRKSFSGLN--LIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPN-QVNLTPYYWMPRFVEAKDPSAR 1708
            A+V KRL S+  IG LLSGGLDSSL++ +  + MK   +   + +FSIG+  +  D++AARKV+KF+GT H E  FS+E+ IK L  LI+ LE++D+T+IRAS  MY L++ I+     +V+ SGEG+DE+ GGY+YFH AP+ E F +E +  +  L   D  RAD++     +E RVPFLD  F    +SLDP  ++P+   DG   EK++LR +F+      +P+EILWR KE FSDGV  +    +   L  Y   KI+D+E+S++S+L+P  TP +KEAFY R+ F + FP+ Q  LT   W+P++ + +DPS R
Sbjct:  220 ASVHKRLMSDAPIGVLLSGGLDSSLVSSIASREMKRRGM--AVHSFSIGVDHNSPDVVAARKVAKFIGTTHHEFYFSIEEGIKNLRKLIWHLESYDVTSIRASTPMYFLSEEIRKLGIKVVL-SGEGADEIFGGYLYFHNAPSDEDFQKETIDRVLHLYTSDCLRADKSSMAHSVEVRVPFLDKAFVEAAVSLDPAFKRPQKLEDGRNCEKFVLRSAFNTDQYPYLPDEILWRQKEQFSDGVGYS----WIDTLMKYCAAKITDKEFSQASKLFPHNTPHSKEAFYMRKIFHEQFPSEQAALTVRKWIPKWQKNQDPSGR 532          

HSP 2 Score: 49.6766 bits (117), Expect = 6.018e-6
Identity = 41/116 (35.34%), Postives = 63/116 (54.31%), Query Frame = 2
Query:  161 RLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLV-SEFS-LDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIK 502
            RL+I+ D+  +QP++    P+  +I NGEIYN++ L  +E    ++ TH D E +I LYEK     +   LDGVF+ F+L          RD  GV+ M Y + + G     +E+K
Sbjct:   54 RLAIM-DLGVVQPLQ-GTAPNRQVIHNGEIYNHQELRDTELKKYNLKTHCDSEVIIFLYEKYRDGHICNLLDGVFA-FVL-CCDGDFLAARDPLGVKQMYYGIDDDGRYFFSNEMK 165          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Celegans
Match: asns-2 (Asparagine synthetase [Source:UniProtKB/TrEMBL;Acc:Q65ZI9])

HSP 1 Score: 223.016 bits (567), Expect = 3.486e-65
Identity = 141/319 (44.20%), Postives = 206/319 (64.58%), Query Frame = 2
Query:  773 AAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPK---DG--IEKWLLRKSFSGLN--LIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPN-QVNLTPYYWMPRFVEAKDPSA 1705
            A+V KRL S+  IG LLSGGLDSSL++ +  + MK   +   + +FSIG+  +  D++AARKV+KF+GT H E  FS+E+ IK L  LI+ LE++D+T+IRAS  MY L++ I+     +V+ SGEG+DE+ GGY+YFH AP+ E F +E +  +  L   D  RAD++     +E RVPFLD  F    +SLDP  ++P+   DG   EK++LR +F+      +P+EILWR KE FSDGV  +    +   L  Y   KI+D+E+S++S+L+P  TP +KEAFY R+ F + FP+ Q  LT   W+P++ + +DPS 
Sbjct:  220 ASVHKRLMSDAPIGVLLSGGLDSSLVSSIASREMKRRGM--AVHSFSIGVDHNSPDVVAARKVAKFIGTTHHEFYFSIEEGIKNLRKLIWHLESYDVTSIRASTPMYFLSEEIRKLGIKVVL-SGEGADEIFGGYLYFHNAPSDEDFQKETIDRVLHLYTSDCLRADKSSMAHSVEVRVPFLDKAFVEAAVSLDPAFKRPQKLEDGRNCEKFVLRSAFNTDQYPYLPDEILWRQKEQFSDGVGYS----WIDTLMKYCAAKITDKEFSQASKLFPHNTPHSKEAFYMRKIFHEQFPSEQAALTVRKWIPKWQKNQDPSG 531          

HSP 2 Score: 49.6766 bits (117), Expect = 5.613e-6
Identity = 41/116 (35.34%), Postives = 63/116 (54.31%), Query Frame = 2
Query:  161 RLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLV-SEFS-LDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIK 502
            RL+I+ D+  +QP++    P+  +I NGEIYN++ L  +E    ++ TH D E +I LYEK     +   LDGVF+ F+L          RD  GV+ M Y + + G     +E+K
Sbjct:   54 RLAIM-DLGVVQPLQ-GTAPNRQVIHNGEIYNHQELRDTELKKYNLKTHCDSEVIIFLYEKYRDGHICNLLDGVFA-FVL-CCDGDFLAARDPLGVKQMYYGIDDDGRYFFSNEMK 165          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Celegans
Match: asns-2 (Asparagine synthetase [Source:UniProtKB/TrEMBL;Acc:Q65ZI9])

HSP 1 Score: 50.8322 bits (120), Expect = 1.897e-6
Identity = 40/81 (49.38%), Postives = 56/81 (69.14%), Query Frame = 2
Query:  773 AAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDS 1015
            A+V KRL S+  IG LLSGGLDSSL++ +  + MK   +   + +FSIG+  +  D++AARKV+KF+GT H E  FS+E S
Sbjct:  220 ASVHKRLMSDAPIGVLLSGGLDSSLVSSIASREMKRRGM--AVHSFSIGVDHNSPDVVAARKVAKFIGTTHHEFYFSIEVS 298          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Fly
Match: AsnS (gene:FBgn0270926 transcript:FBtr0089463)

HSP 1 Score: 262.692 bits (670), Expect = 9.762e-80
Identity = 200/609 (32.84%), Postives = 318/609 (52.22%), Query Frame = 2
Query:   17 MCGIWAIIGYEGNTMSLM------HYFQTIA--------DRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTH---SDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHEEGIQINILKPGCVLEFDLYDNGTVNTSFKEHSFAKIGN----QPIFKSLVEPDPNKNIYENI-RGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQP----------KDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQ-VNLTPYYWMPRFVEA--KDPSARDLSHYKCSKT 1738
            MCGI+AI   +G  +         H  + +A         RGPDS  +  +N  +   +   RL I+G   G QP  + E+ +L L+ NGEIYNY  L +E +    ++   SD   ++ LY+  G   + Q + G+F+  + D   K+V L RD  G+ PM       G L + SE+K                L+D           ++    PG                  E  F K+G+        +S ++  P +    ++ R  LE AV   LQ + ++G LLSGG+DSSLIA +  K M+E   +++L+TFS+G+  D  D  AAR V+K++ ++H E+ F +++++  + D+IY LET+D+TT+R S+ M LLA++I++ T   +I SGEG+DE+ GGY+YFHKAP+   FHEE ++ +  L   D  RA++     G+E RVPFLD  F ++ + + P+ + P          +  +EK++LR +F+  N +P+E+LWR KE FSDGV       +   ++      +SD+E+S ++  +P  TP+TKEAFYYR  F + FP +    T   W+PR      +DPS R  + ++ +K 
Sbjct:    1 MCGIFAIFSRDGEPIPTQILHGSKHSLRELAYRQSGKHRHRGPDSTGV-YVNSLEGVAMIHERLRIIGVEMGDQPF-VSEDGNLILVANGEIYNYLELSAEIAKKRGSYNPMSDCHVILELYQDYGK-DLLQYITGMFAFALYDRKTKEVLLARDPFGIIPMYVGEDASGNLWVASEMKC---------------LVDTCS--------KVETFTPG------------------EARFGKVGDFKTCWQFQQSWIKEVPTQTCELSLLRANLEFAVRSHLQCDVQMGALLSGGVDSSLIASIATKIMRERDPNFRLKTFSVGL-RDAPDFQAARSVAKYIDSDHKEIIFEIDEALDGIRDIIYHLETYDVTTVRCSLPMLLLARYIKS-TGIKMILSGEGADEIFGGYLYFHKAPSYNDFHEELVKRVRQLHLSDCLRANKVAMAKGVELRVPFLDTGFVNHVMQIRPEDKIPGPLNKFGEVQQKRLEKYVLRAAFAD-NYLPDEVLWRQKEQFSDGVGY----DWIDSIRRVATSHVSDQEFSAAALRFPFNTPTTKEAFYYRCIFAEQFPGESAARTVVRWVPRLDWGCPEDPSGRAQAVHQVNKN 558          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Zebrafish
Match: asns (asparagine synthetase [Source:ZFIN;Acc:ZDB-GENE-040426-1091])

HSP 1 Score: 500.36 bits (1287), Expect = 9.404e-172
Identity = 284/587 (48.38%), Postives = 380/587 (64.74%), Query Frame = 2
Query:   17 MCGIWAIIGYE-------GNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHE-EGIQINILKPGCVLEFDLYDNGTVNTSFKEHSFAKIGNQPI------FKSLVEPDPNKNIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYWMPRFVEAKDPSARDLSHYKCSK 1735
            MCGIWA+ G +        N M + H       RGPD++R EN+N + +CC GFHRL+IV  + GMQP+R+K+ P+L L  NGEIYN+  L + F  D  T  D E ++HLY++ G   M   LDGVF+  +LDT  +KV L RD +GVRP+  +L + GFL +CSE KG                   +  I H     +I    PG    FDL  NG V  S +   F    ++P        + L      + +  NIR L E AV KRL + RRIGCLLSGGLDSSL+A LLVK  KE K+ Y +QTFSIG  +D  D+ AARKV+ ++G+EH  VNF+ E+ I  L D+I  LE++DITT+RASIGMYL++K+I+  TD++VIFSGEGSDELT GYIYFHKAP+P+A  E+ +RLL +L  FD+ RADRT +  GLE RVPFLD +F++YYLSL  ++R PK+G+EK LLR +F G+NLIP+EILWR KEAFSDG++ + KK +Y  LQ++   +++D +   +++LY    P+TKE  + RQ FEK++P Q   TP+YWMPR+++A DPSAR LS YK  K
Sbjct:    1 MCGIWALFGSDECLSVQCTNAMKIFH-------RGPDAFRFENVNGFTNCCFGFHRLAIVDQLYGMQPLRVKKFPYLWLCYNGEIYNHIKLKNHFEFDYQTKVDGEILLHLYDRFGIEKMCSLLDGVFAFILLDTANRKVHLGRDTYGVRPLFRMLTDDGFLAVCSEGKG-------------------LTQIKHSMPTAKITAFPPGHFEVFDLKLNGKVE-SVQMDRFHCCTDKPKHADFNKLEGLGTDFELETVKSNIRILFEDAVRKRLMAHRRIGCLLSGGLDSSLVAALLVKLAKEEKLPYPIQTFSIG-AEDSPDVAAARKVADYIGSEHHVVNFTPEEGISALEDVIVHLESYDITTVRASIGMYLVSKYIREKTDSVVIFSGEGSDELTQGYIYFHKAPSPKAGAEDSVRLLEELYLFDVLRADRTTAAHGLELRVPFLDHRFTAYYLSLPEEMRVPKNGVEKHLLRDAFDGMNLIPDEILWRRKEAFSDGLT-SVKKSWYTSLQEHIESELNDSQLENANKLYHINPPTTKEGLFIRQIFEKHYPGQGEWTPHYWMPRWIKATDPSARTLSIYKPDK 558          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Xenopus
Match: asns (asparagine synthetase (glutamine-hydrolyzing) [Source:NCBI gene;Acc:448254])

HSP 1 Score: 500.745 bits (1288), Expect = 1.091e-171
Identity = 276/582 (47.42%), Postives = 386/582 (66.32%), Query Frame = 2
Query:   17 MCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHEEGIQINILKPGCVLEFDLYDNGTVNTSFKEHSFAKIGNQPIFKSL-----VEPDPNK-NIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYWMPRFVEAKDPSARDLSHYKCSKTNE 1744
            MCGIWA+ G +            IA RGPD++R EN+N + +CC GFHRL+IV  + GMQP+R+K+ P+L L  NGEIYN+K L   F  +  T  D E ++HLY + G    A  LDGVF+  +LDT  +KV+L RD +GVRP+  +L + GFL +CSE KG               LID+  ++      +++   PG    FDL  +G V TS +   F    ++P+  +      ++P  ++  +  NI  L E AV KRL + RRIGCLLSGGLDSSL+A  L+K +KE  + Y LQTF++G  +D  D+LAARKV+  +G+EH E+ F  E+ I+ + ++I+ LET+DITT+RAS+GMYL++K+I+  TD++VIFSGEGSDELT GYIYFHKAP+ E   E+  RLL +L  FD+ RADRT +  GLE RVPFLD + ++YYLSL P+LR PK+GIEK+LLR+SF   NL+P+++LWRPKEAFSDG++ + KK ++ +LQ++  +++ +    K++E +P   P TKE ++YRQ FEKY+P +     +YWMPR++ A DPSAR L HYK S TNE
Sbjct:    1 MCGIWALFGSDECLSVQCLSAMKIAHRGPDAFRFENVNGFTNCCFGFHRLAIVDQLYGMQPLRVKKFPYLWLCYNGEIYNFKQLEKNFGFEYQTLVDGEVILHLYSEHGIEKTAALLDGVFAFILLDTANRKVYLGRDSYGVRPLFRLLTDDGFLAVCSEAKG---------------LIDLKHSM--TSCPKVDPFPPGHYEVFDLKPSGKV-TSVEVIKFHNFRDEPLHAAYDTLDKLQPGTDRETVKRNICCLFENAVRKRLMAHRRIGCLLSGGLDSSLVAATLIKLIKERNMHYPLQTFAVGT-EDSPDLLAARKVALHIGSEHHEIMFDPEEGIQAVDEVIFSLETYDITTVRASVGMYLISKYIRKKTDSVVIFSGEGSDELTQGYIYFHKAPSAEEAAEDSERLLRELYLFDVLRADRTTAAHGLELRVPFLDHRLTAYYLSLPPELRIPKNGIEKYLLRESFEDSNLLPKDVLWRPKEAFSDGLT-SVKKSWFSMLQEHIEQQVDNIVLEKAAENFPFNPPKTKEGYFYRQIFEKYYPGRAGWLTHYWMPRWISATDPSARTLKHYK-SDTNE 561          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Xenopus
Match: asns (asparagine synthetase (glutamine-hydrolyzing) [Source:NCBI gene;Acc:448254])

HSP 1 Score: 396.356 bits (1017), Expect = 3.387e-132
Identity = 227/481 (47.19%), Postives = 315/481 (65.49%), Query Frame = 2
Query:   17 MCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHEEGIQINILKPGCVLEFDLYDNGTVNTSFKEHSFAKIGNQPIFKSL-----VEPDPNK-NIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEI 1441
            MCGIWA+ G +            IA RGPD++R EN+N + +CC GFHRL+IV  + GMQP+R+K+ P+L L  NGEIYN+K L   F  +  T  D E ++HLY + G    A  LDGVF+  +LDT  +KV+L RD +GVRP+  +L + GFL +CSE KG               LID+  ++      +++   PG    FDL  +G V TS +   F    ++P+  +      ++P  ++  +  NI  L E AV KRL + RRIGCLLSGGLDSSL+A  L+K +KE  + Y LQTF++G  +D  D+LAARKV+  +G+EH E+ F  E+ I+ + ++I+ LET+DITT+RAS+GMYL++K+I+  TD++VIFSGEGSDELT GYIYFHKAP+ E   E+  RLL +L  FD+ RADRT +  GLE RVPFLD + ++YYLSL P+LR PK+GIEK+LLR+SF   NL+P+++
Sbjct:    1 MCGIWALFGSDECLSVQCLSAMKIAHRGPDAFRFENVNGFTNCCFGFHRLAIVDQLYGMQPLRVKKFPYLWLCYNGEIYNFKQLEKNFGFEYQTLVDGEVILHLYSEHGIEKTAALLDGVFAFILLDTANRKVYLGRDSYGVRPLFRLLTDDGFLAVCSEAKG---------------LIDLKHSM--TSCPKVDPFPPGHYEVFDLKPSGKV-TSVEVIKFHNFRDEPLHAAYDTLDKLQPGTDRETVKRNICCLFENAVRKRLMAHRRIGCLLSGGLDSSLVAATLIKLIKERNMHYPLQTFAVGT-EDSPDLLAARKVALHIGSEHHEIMFDPEEGIQAVDEVIFSLETYDITTVRASVGMYLISKYIRKKTDSVVIFSGEGSDELTQGYIYFHKAPSAEEAAEDSERLLRELYLFDVLRADRTTAAHGLELRVPFLDHRLTAYYLSLPPELRIPKNGIEKYLLRESFEDSNLLPKDV 462          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Xenopus
Match: asns (asparagine synthetase (glutamine-hydrolyzing) [Source:NCBI gene;Acc:448254])

HSP 1 Score: 365.155 bits (936), Expect = 9.487e-121
Identity = 208/439 (47.38%), Postives = 295/439 (67.20%), Query Frame = 2
Query:  446 PMKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHEEGIQINILKPGCVLEFDLYDNGTVNTSFKEHSFAKIGNQPIFKSL-----VEPDPNK-NIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYWMPRFVEAKDPSARDLSHYKCSKTNE 1744
            P+  +L + GFL +CSE KG               LID+  ++      +++   PG    FDL  +G V TS +   F    ++P+  +      ++P  ++  +  NI  L E AV KRL + RRIGCLLSGGLDSSL+A  L+K +KE  + Y LQTF++G  +D  D+LAARKV+  +G+EH E+ F  E+ I+ + ++I+ LET+DITT+RAS+GMYL++K+I+  TD++VIFSGEGSDELT GYIYFHKAP+ E   E+  RLL +L  FD+ RADRT +  GLE RVPFLD + ++YYLSL P+LR PK+GIEK+LLR+SF   NL+P+++LWRPKEAFSDG++ + KK ++ +LQ++  +++ +    K++E +P   P TKE ++YRQ FEKY+P +     +YWMPR++ A DPSAR L HYK S TNE
Sbjct:    5 PLFRLLTDDGFLAVCSEAKG---------------LIDLKHSMT--SCPKVDPFPPGHYEVFDLKPSGKV-TSVEVIKFHNFRDEPLHAAYDTLDKLQPGTDRETVKRNICCLFENAVRKRLMAHRRIGCLLSGGLDSSLVAATLIKLIKERNMHYPLQTFAVGT-EDSPDLLAARKVALHIGSEHHEIMFDPEEGIQAVDEVIFSLETYDITTVRASVGMYLISKYIRKKTDSVVIFSGEGSDELTQGYIYFHKAPSAEEAAEDSERLLRELYLFDVLRADRTTAAHGLELRVPFLDHRLTAYYLSLPPELRIPKNGIEKYLLRESFEDSNLLPKDVLWRPKEAFSDGLT-SVKKSWFSMLQEHIEQQVDNIVLEKAAENFPFNPPKTKEGYFYRQIFEKYYPGRAGWLTHYWMPRWISATDPSARTLKHYK-SDTNE 422          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Mouse
Match: Asns (asparagine synthetase [Source:MGI Symbol;Acc:MGI:1350929])

HSP 1 Score: 522.702 bits (1345), Expect = 1.644e-180
Identity = 282/579 (48.70%), Postives = 387/579 (66.84%), Query Frame = 2
Query:   17 MCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHEEG--IQINILKPGCVLEFDLYDNGTVNT--SFKEHSFAKIGNQPIFKSLVEPDPN---KNIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYWMPRFVEAKDPSARDLSHYKCS 1732
            MCGIWA+ G +            IA RGPD++R EN+N Y +CC GFHRL++V  + GMQPIR+++ P+L L  NGEIYN+K+L   F  +  T+ D E ++HLY+K G       LDGVF+  +LDT  KKVFL RD +GVRP+   + E GFL +CSE KG                   + ++ H     +++    PG     DL  NG V +    K H         I+ S+ +  P    + +  N+R L + A+ KRL ++RRIGCLLSGGLDSSL+A  L+K +KEA++ Y LQTF+IGM +D  D+LAARKV+ ++G+EH EV F+ E+ I+ L ++I+ LET+DITT+RAS+GMYL++K+I+ NTD++VIFSGEGSDELT GYIYFHKAP+PE   EE  RLL +L  FD+ RADRT +  GLE RVPFLD +FSSYYLSL P +R PK+GIEK LLR++F   NL+P+EILWRPKEAFSDG++ + K  ++ +LQDY   ++ DE  S +S+ +P  TP TKE ++YRQ FE+++P + +   +YWMP+++ A DPSAR L+HYK +
Sbjct:    1 MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVRKYPYLWLCYNGEIYNHKALQQRFEFEYQTNVDGEIILHLYDKGGIEKTICMLDGVFAFILLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKG-------------------LVSLKHSTTPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCTDEPLHAIYDSVEKLFPGFDLETVKNNLRILFDNAIKKRLMTDRRIGCLLSGGLDSSLVAASLLKQLKEAQVQYPLQTFAIGM-EDSPDLLAARKVANYIGSEHHEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLKELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPDMRIPKNGIEKHLLRETFEDCNLLPKEILWRPKEAFSDGIT-SVKNSWFKILQDYVEHQVDDEMMSAASQKFPFNTPKTKEGYFYRQIFERHYPGRADWLTHYWMPKWINATDPSARTLTHYKSA 558          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Mouse
Match: Asns (asparagine synthetase [Source:MGI Symbol;Acc:MGI:1350929])

HSP 1 Score: 522.702 bits (1345), Expect = 1.644e-180
Identity = 282/579 (48.70%), Postives = 387/579 (66.84%), Query Frame = 2
Query:   17 MCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHEEG--IQINILKPGCVLEFDLYDNGTVNT--SFKEHSFAKIGNQPIFKSLVEPDPN---KNIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYWMPRFVEAKDPSARDLSHYKCS 1732
            MCGIWA+ G +            IA RGPD++R EN+N Y +CC GFHRL++V  + GMQPIR+++ P+L L  NGEIYN+K+L   F  +  T+ D E ++HLY+K G       LDGVF+  +LDT  KKVFL RD +GVRP+   + E GFL +CSE KG                   + ++ H     +++    PG     DL  NG V +    K H         I+ S+ +  P    + +  N+R L + A+ KRL ++RRIGCLLSGGLDSSL+A  L+K +KEA++ Y LQTF+IGM +D  D+LAARKV+ ++G+EH EV F+ E+ I+ L ++I+ LET+DITT+RAS+GMYL++K+I+ NTD++VIFSGEGSDELT GYIYFHKAP+PE   EE  RLL +L  FD+ RADRT +  GLE RVPFLD +FSSYYLSL P +R PK+GIEK LLR++F   NL+P+EILWRPKEAFSDG++ + K  ++ +LQDY   ++ DE  S +S+ +P  TP TKE ++YRQ FE+++P + +   +YWMP+++ A DPSAR L+HYK +
Sbjct:    1 MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVRKYPYLWLCYNGEIYNHKALQQRFEFEYQTNVDGEIILHLYDKGGIEKTICMLDGVFAFILLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKG-------------------LVSLKHSTTPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCTDEPLHAIYDSVEKLFPGFDLETVKNNLRILFDNAIKKRLMTDRRIGCLLSGGLDSSLVAASLLKQLKEAQVQYPLQTFAIGM-EDSPDLLAARKVANYIGSEHHEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLKELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPDMRIPKNGIEKHLLRETFEDCNLLPKEILWRPKEAFSDGIT-SVKNSWFKILQDYVEHQVDDEMMSAASQKFPFNTPKTKEGYFYRQIFERHYPGRADWLTHYWMPKWINATDPSARTLTHYKSA 558          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Mouse
Match: Asns (asparagine synthetase [Source:MGI Symbol;Acc:MGI:1350929])

HSP 1 Score: 163.31 bits (412), Expect = 3.986e-46
Identity = 80/163 (49.08%), Postives = 106/163 (65.03%), Query Frame = 2
Query:   17 MCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG 505
            MCGIWA+ G +            IA RGPD++R EN+N Y +CC GFHRL++V  + GMQPIR+++ P+L L  NGEIYN+K+L   F  +  T+ D E ++HLY+K G       LDGVF+  +LDT  KKVFL RD +GVRP+   + E GFL +CSE KG
Sbjct:    1 MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVRKYPYLWLCYNGEIYNHKALQQRFEFEYQTNVDGEIILHLYDKGGIEKTICMLDGVFAFILLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKG 163          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Mouse
Match: Asns (asparagine synthetase [Source:MGI Symbol;Acc:MGI:1350929])

HSP 1 Score: 155.992 bits (393), Expect = 3.104e-44
Identity = 76/158 (48.10%), Postives = 102/158 (64.56%), Query Frame = 2
Query:   17 MCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGIC 490
            MCGIWA+ G +            IA RGPD++R EN+N Y +CC GFHRL++V  + GMQPIR+++ P+L L  NGEIYN+K+L   F  +  T+ D E ++HLY+K G       LDGVF+  +LDT  KKVFL RD +GVRP+   + E GFL +C
Sbjct:    1 MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVRKYPYLWLCYNGEIYNHKALQQRFEFEYQTNVDGEIILHLYDKGGIEKTICMLDGVFAFILLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVC 158          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Mouse
Match: Asns (asparagine synthetase [Source:MGI Symbol;Acc:MGI:1350929])

HSP 1 Score: 120.939 bits (302), Expect = 5.917e-32
Identity = 59/127 (46.46%), Postives = 81/127 (63.78%), Query Frame = 2
Query:   17 MCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILD 397
            MCGIWA+ G +            IA RGPD++R EN+N Y +CC GFHRL++V  + GMQPIR+++ P+L L  NGEIYN+K+L   F  +  T+ D E ++HLY+K G       LDGVF+  +LD
Sbjct:    1 MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVRKYPYLWLCYNGEIYNHKALQQRFEFEYQTNVDGEIILHLYDKGGIEKTICMLDGVFAFILLD 127          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. UniProt/SwissProt
Match: sp|P19891|ASNS_CRIGR (Asparagine synthetase [glutamine-hydrolyzing] OS=Cricetulus griseus OX=10029 GN=ASNS PE=2 SV=2)

HSP 1 Score: 523.472 bits (1347), Expect = 6.054e-180
Identity = 281/580 (48.45%), Postives = 390/580 (67.24%), Query Frame = 2
Query:   17 MCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHEEG--IQINILKPGCVLEFDLYDNGTVNTSFKEHSFAKIGNQPI------FKSLVEPDPNKNIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYWMPRFVEAKDPSARDLSHYKCS 1732
            MCGIWA+ G +            IA RGPD++R EN+N Y +CC GFHRL++V  + GMQPIR+K+ P+L L  NGEIYN+K+L   F  +  T+ D E ++HLY+K G       LDGVF+  +LDT  KKVFL RD +GVRP+   + E GFL +CSE KG                   + ++ H     +++    PG     DL  NG V  S +   +    ++P+       + L +    + +  N+R L ++AV KRL ++RRIGCLLSGGLDSSL+A  L+K +KEA++ Y LQTF+IGM +D  D+LAARKV+ ++G+EH EV F+ E+ I+ L ++I+ LET+DITT+RAS+GMYL++K+I+ NTD++VIFSGEGSDELT GYIYFHKAP+PE   EE  RLL +L  FD+ RADRT +  GLE RVPFLD +FSSYYLSL P++R PK+GIEK LLR++F   NL+P+EILWRPKEAFSDG++ + K  ++ +LQDY   ++ DE  + +++ +P  TP TKE +YYRQ FE+++P + +   +YWMP+++ A DPSAR L+HYK +
Sbjct:    1 MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYLWLCYNGEIYNHKALQQRFEFEYQTNVDGEIILHLYDKGGIEQTICMLDGVFAFILLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKG-------------------LVSLKHSTTPFLKVEPFLPGHYEVLDLKPNGKV-ASVEMVKYHHCRDEPLHALYDSVEKLFQGFELETVKSNLRILFDSAVRKRLMTDRRIGCLLSGGLDSSLVAASLLKQLKEAQVQYPLQTFAIGM-EDSPDLLAARKVANYIGSEHHEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLKELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLLPKEILWRPKEAFSDGIT-SVKNSWFKILQDYVEHQVDDEMMATAAQKFPFNTPKTKEGYYYRQIFERHYPGRADWLTHYWMPKWINATDPSARTLTHYKSA 558          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. UniProt/SwissProt
Match: sp|Q61024|ASNS_MOUSE (Asparagine synthetase [glutamine-hydrolyzing] OS=Mus musculus OX=10090 GN=Asns PE=1 SV=3)

HSP 1 Score: 522.702 bits (1345), Expect = 1.150e-179
Identity = 282/579 (48.70%), Postives = 387/579 (66.84%), Query Frame = 2
Query:   17 MCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHEEG--IQINILKPGCVLEFDLYDNGTVNT--SFKEHSFAKIGNQPIFKSLVEPDPN---KNIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYWMPRFVEAKDPSARDLSHYKCS 1732
            MCGIWA+ G +            IA RGPD++R EN+N Y +CC GFHRL++V  + GMQPIR+++ P+L L  NGEIYN+K+L   F  +  T+ D E ++HLY+K G       LDGVF+  +LDT  KKVFL RD +GVRP+   + E GFL +CSE KG                   + ++ H     +++    PG     DL  NG V +    K H         I+ S+ +  P    + +  N+R L + A+ KRL ++RRIGCLLSGGLDSSL+A  L+K +KEA++ Y LQTF+IGM +D  D+LAARKV+ ++G+EH EV F+ E+ I+ L ++I+ LET+DITT+RAS+GMYL++K+I+ NTD++VIFSGEGSDELT GYIYFHKAP+PE   EE  RLL +L  FD+ RADRT +  GLE RVPFLD +FSSYYLSL P +R PK+GIEK LLR++F   NL+P+EILWRPKEAFSDG++ + K  ++ +LQDY   ++ DE  S +S+ +P  TP TKE ++YRQ FE+++P + +   +YWMP+++ A DPSAR L+HYK +
Sbjct:    1 MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVRKYPYLWLCYNGEIYNHKALQQRFEFEYQTNVDGEIILHLYDKGGIEKTICMLDGVFAFILLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKG-------------------LVSLKHSTTPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCTDEPLHAIYDSVEKLFPGFDLETVKNNLRILFDNAIKKRLMTDRRIGCLLSGGLDSSLVAASLLKQLKEAQVQYPLQTFAIGM-EDSPDLLAARKVANYIGSEHHEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLKELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPDMRIPKNGIEKHLLRETFEDCNLLPKEILWRPKEAFSDGIT-SVKNSWFKILQDYVEHQVDDEMMSAASQKFPFNTPKTKEGYFYRQIFERHYPGRADWLTHYWMPKWINATDPSARTLTHYKSA 558          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. UniProt/SwissProt
Match: sp|P49088|ASNS_RAT (Asparagine synthetase [glutamine-hydrolyzing] OS=Rattus norvegicus OX=10116 GN=Asns PE=2 SV=3)

HSP 1 Score: 521.546 bits (1342), Expect = 4.192e-179
Identity = 283/579 (48.88%), Postives = 386/579 (66.67%), Query Frame = 2
Query:   17 MCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHEEG--IQINILKPGCVLEFDLYDNGTVNT--SFKEHSFAKIGNQPIFKSLVEPDPN---KNIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYWMPRFVEAKDPSARDLSHYKCS 1732
            MCGIWA+ G +            IA RGPD++R EN+N Y +CC GFHRL++V  + GMQPIR+++ P+L L  NGEIYN+K+L   F  +  T+ D E ++HLY+K G       LDGVF+  +LDT  KKVFL RD +GVRP+   L E GFL +CSE KG                   + ++ H     +++    PG     DL  NG V +    K H         I+ S+ +  P    + +  N+R L   A+ KRL ++RRIGCLLSGGLDSSL+A  L+K +KEA++ Y LQTF+IGM +D  D+LAARKV+ ++G+EH EV F+ E+ I+ L ++I+ LET+DITT+RAS+GMYL++K+I+ NTD++VIFSGEGSDELT GYIYFHKAP+PE   EE  RLL +L  FD+ RADRT +  GLE RVPFLD +FSSYYLSL P++R PKDGIEK LLR++F   NL+P+EILWRPKEAFSDG++ + K  ++ +LQD+   ++ D   S++S+ +P  TP TKE +YYRQ FE ++P + +   +YWMP+++ A DPSAR L+HYK +
Sbjct:    1 MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVRKYPYLWLCYNGEIYNHKALQQRFEFEYQTNVDGEIILHLYDKGGIEKTICMLDGVFAFILLDTANKKVFLGRDTYGVRPLFKALTEDGFLAVCSEAKG-------------------LVSLKHSTTPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCTDEPLHAIYDSVEKLFPGFEIETVKNNLRILFNNAIKKRLMTDRRIGCLLSGGLDSSLVAASLLKQLKEAQVPYALQTFAIGM-EDSPDLLAARKVANYIGSEHHEVLFNSEEGIQSLDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLKELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPEMRIPKDGIEKHLLRETFEDSNLLPKEILWRPKEAFSDGIT-SVKNSWFKILQDFVEHQVDDAMMSEASQKFPFNTPQTKEGYYYRQIFEHHYPGRADWLTHYWMPKWINATDPSARTLTHYKST 558          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. UniProt/SwissProt
Match: sp|P17714|ASNS_MESAU (Asparagine synthetase [glutamine-hydrolyzing] OS=Mesocricetus auratus OX=10036 GN=ASNS PE=1 SV=3)

HSP 1 Score: 514.612 bits (1324), Expect = 1.946e-176
Identity = 279/579 (48.19%), Postives = 385/579 (66.49%), Query Frame = 2
Query:   17 MCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHEEG--IQINILKPGCVLEFDLYDNGTVNTS--FKEHSFAKIGNQPIFKSLVEPDPN---KNIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYWMPRFVEAKDPSARDLSHYKCS 1732
            MCGIWA+ G +            IA RGPD++R EN+N Y +CC GFHRL++V  + GMQPIR+K+ P+L L  NGEIYN+K+L   F  +  T+ D E ++HLY+K G       LDGVF+  +LDT  KKVFL RD +GVRP+   + E GFL +CSE KG                   + ++ H     +++    PG     DL  NG V +    K H         ++ S+ +  P    + +  N+R L + AV KRL ++RRI CLLSGGLDSSL+A  L+K +KEA++ Y LQTF+IGM +D  D+LAARKV+ ++G+EH EV F+ E+ I+ L ++I+ LET+DITT+RAS+GMYL++K+I+ NTD++VIFSGEGSDELT GYIYFHKAP+PE   EE  RLL +L  FD+ RADRT +  GLE RVPFLD +FSSYYLSL P++R PK+GIEK LLR++F   NL+P+EILWRPKEAFSDG++ + K  ++ +LQDY   ++ D   + +++ +P  TP TKE ++YRQ FE ++P + +   +YWMP+++ A DPSAR L+HYK +
Sbjct:    1 MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYLWLCYNGEIYNHKALQQRFEFEYQTNVDGEIILHLYDKGGIEQTICMLDGVFAFILLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKG-------------------LVSLKHSTTPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDEPLHALYDSVEKLFPGFELETVKSNLRILFDNAVRKRLMTDRRIVCLLSGGLDSSLVASSLLKQLKEAQVQYPLQTFAIGM-EDSPDLLAARKVANYIGSEHHEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLKELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPEMRVPKNGIEKHLLRETFEDSNLLPKEILWRPKEAFSDGIT-SVKNSWFKILQDYVEHQVDDAMMATAAQKFPFNTPKTKEGYFYRQIFEHHYPGRADWLTHYWMPKWINATDPSARTLTHYKSA 558          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. UniProt/SwissProt
Match: sp|Q5ZJU3|ASNS_CHICK (Asparagine synthetase [glutamine-hydrolyzing] OS=Gallus gallus OX=9031 GN=ASNS PE=2 SV=3)

HSP 1 Score: 512.301 bits (1318), Expect = 1.825e-175
Identity = 292/585 (49.91%), Postives = 389/585 (66.50%), Query Frame = 2
Query:   17 MCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHEEGI--QINILKPGCVLEFDLYDNGTVNTS--FKEHSFA---------KIGNQPIFKSLVEPDPNKNIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYWMPRFVEAKDPSARDLSHYKCS 1732
            MCGIWA+ G +            IA RGPD++R EN+N + +CC GFHRL++V  + GMQPIR+K+ P+L L  NGEIYN+K L  +F  +  T  D E ++HLY + G    A  LDGVF+  +LDT  +KVFL RD +GVRP+  +L + GFLG+CSE KG                   + N+ H   +  ++    PG     DL  +G V +    K HS+           +GN P    L      + +  NIR L E AV KRL + RRIGCLLSGGLDSSL+A +L+K MKE  I Y LQTF+IGM ++  D+LAARKV+  +G+EH EV F+ E+ I+ + ++I+ LET+DITT+RASIGMYL++K+I+  TD++VIFSGEGSDELT GYIYFHKAP+PE   EE  RLL +L  FD+ RADRT +  GLE RVPFLD +F+SYYLSL  +LR PK+GIEK+LLR+SF   NL+P+EILWRPKEAFSDG++ + KK ++ +LQDY ++++ D    K++E YP   P TKE++YYRQ FEK++P + +  P+YWMPR+VEA DPSAR L HYK +
Sbjct:    1 MCGIWALFGSDECLSVQCLSAMKIAHRGPDAFRFENVNGFTNCCFGFHRLAVVDQLYGMQPIRVKKFPYLWLCYNGEIYNFKQLQEQFGFEYQTLVDGEVILHLYNRGGIEQTASMLDGVFAFILLDTANRKVFLARDTYGVRPLFKVLTDDGFLGVCSEAKG-------------------LINLKHSTSLFPKVEPFLPGHYEVLDLKPSGKVVSVEVVKFHSYKDEPLHAACDTVGNLPSGFDL------ETVKSNIRVLFENAVRKRLMAHRRIGCLLSGGLDSSLVAAVLLKLMKEMNIKYPLQTFAIGM-ENSPDLLAARKVAAHIGSEHHEVIFNSEEGIQAVEEVIFSLETYDITTVRASIGMYLVSKYIRKKTDSVVIFSGEGSDELTQGYIYFHKAPSPEEAAEESERLLKELYLFDVLRADRTTAAHGLELRVPFLDHRFTSYYLSLPAELRIPKNGIEKYLLRQSFEDSNLLPKEILWRPKEAFSDGIA-SVKKSWFSILQDYIDQQVDDLLLEKAAEKYPFNPPRTKESYYYRQIFEKHYPGRSSWLPHYWMPRWVEATDPSARTLKHYKSA 558          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. TrEMBL
Match: A0A3S0ZWP2 (Glutamine amidotransferase type-2 domain-containing protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_003699 PE=4 SV=1)

HSP 1 Score: 543.888 bits (1400), Expect = 0.000e+0
Identity = 289/576 (50.17%), Postives = 387/576 (67.19%), Query Frame = 2
Query:    2 FETYNMCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHEEGIQINILKPGCVLEFDLYDNGTVNTSFKEHSFAKIGNQPIFKSLVEPDPNKN-IYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYWMPRFVEAKDPSARDLSHYK 1726
            + T  MCGIWA+ G + N  +  +    I  RGPD++RIENI+H+++CCLGFHRLSIV D+ GMQP+R+   PH  LI NGEIYN+KSL  EF++ ++T  D E +IHLY+  G V MA+ LDGVF+  ILDT  +KV L RD  GVRP+     ++GFL +CSE KG           LF      + +   ++ ++I    PG V  ++L   G    S +   F K G  P ++  V  +   N I  N+  L+E AV KRL S+RR+GCLLSGGLDSSL+A L+VK  K+  I Y +QTF+IGM +   D+ AA+KV+  LGTEH EV  + E+ +K + D I  LE++DITT+RAS+GMYLL+K+IQ  TD +V+ SGEG+DE+  GYIYFHKAP+ +A HEE +RL++DL  +D+ R DR  +  GLE RVPFLD +F+S+YLSLD ++RQPKDG+EK L+R SF G  L+P EILWRPKEAFSDG+  + KK ++ ++QD   EKIS EE   +S LYP   P TKEA Y+R+ FEKY+P +    PYYWMP++++  DPSAR L HYK
Sbjct:   45 YTTVTMCGIWAVFGSDDNVSAQCNAVHKITHRGPDAFRIENIHHFQNCCLGFHRLSIVDDLRGMQPLRLYTYPHTYLIYNGEIYNHKSLAKEFAMMLSTEVDGEPIIHLYQTQGAVRMAEQLDGVFALCILDTANRKVILARDTFGVRPLFRFCTKEGFLAVCSEAKG-----------LFG-----LSHSQRDQDLRIEAFPPGHVEVYNLDSEGRATLS-QSVCFNKTGQIPKYQLAVPAESYSNDIKRNVAMLIEKAVEKRLMSDRRVGCLLSGGLDSSLVAALVVKLSKKLGITYPIQTFAIGM-EGSPDLEAAKKVANHLGTEHHEVLMTPEEGLKAIEDTIRHLESYDITTVRASVGMYLLSKYIQKKTDTVVVMSGEGADEVAQGYIYFHKAPSAQAAHEESIRLMDDLYMYDVLRGDRATAAWGLEIRVPFLDHQFTSFYLSLDAEVRQPKDGVEKHLIRSSFDGSGLLPNEILWRPKEAFSDGMC-SVKKSWFEIIQDDCKEKISQEELESASTLYPHNPPHTKEALYFRKLFEKYYPGKSYWIPYYWMPKWLKTDDPSARTLKHYK 601          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. TrEMBL
Match: V4ASQ3 (Glutamine amidotransferase type-2 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_201958 PE=4 SV=1)

HSP 1 Score: 543.117 bits (1398), Expect = 0.000e+0
Identity = 295/571 (51.66%), Postives = 386/571 (67.60%), Query Frame = 2
Query:   17 MCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEK-GFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHEEGIQINILKPGCVLEFDLYDNGTVNTSFKEHSFAKIGNQPIFKSLVEPDPNKNIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYWMPRFVEAKDPSARDLSHYK 1726
            MCGIWA+ G E +  S  +    I  RGPD++RIENINH+++CCLGFHRL+IV DI GMQP+R+   PHL LI NGEIYN++ L  +F L+ +T  D E +IHLY KLG    A  LDGVF+  ILDT  +KV L RD  GVRPM  +  E  GFL +CSE KG           LF      + + L++    I  L PG V  +DL  +G      +   F KIG+ P +++L  P  ++ +  NIR L EAAV KRL SERRIGCLLSGGLDSSL+  LLVK  KE K+ Y +QTF+IGM +   D+ AA+ V+ +LGT+H EV F+ E+ ++ + D+IY LE++DITTIRAS+GMYL++++I   TD +VI SGEGSDEL  GYIYFHKAP+ E    E  RLL DL  +D+ R DRT S  GLE RVPFLD  F+SYYLS+ P+ R+P  GIEK+LLR +FS   L+P +ILWRPKEAFSDGVS  TK  ++ ++QD+ +++++++E  +++ LYP  TP TKEA+YYR+ FE  FPN+    PY+WMP++ E  DPSAR L HYK
Sbjct:    1 MCGIWALFGSEDDVSSQCNAVHKITHRGPDAFRIENINHFRNCCLGFHRLAIVDDIKGMQPMRLYTYPHLYLIYNGEIYNHELLEKDFDLNTSTTCDGEPIIHLYAKLGAEMAASQLDGVFAFCILDTANRKVILGRDTFGVRPMFKLYDEATGFLAVCSEAKG-----------LFG-----LSHSLNDAKASIEPLLPGHVEVYDLDQDGKARF-MERKRFHKIGDLPKYRTLAPPVGDE-VLANIRNLFEAAVKKRLMSERRIGCLLSGGLDSSLVTALLVKDAKEQKLPYPIQTFAIGM-EGSPDLQAAKTVANYLGTDHHEVVFTPEEGVRAIEDVIYHLESYDITTIRASVGMYLISQYISKKTDTVVILSGEGSDELAQGYIYFHKAPSSEEGDRESRRLLEDLYMYDVLRGDRTTSAAGLEIRVPFLDHLFTSYYLSIAPEQRKPIKGIEKYLLRSAFSDTGLLPNDILWRPKEAFSDGVSSKTKS-WFSVIQDHCDQQVNEDELEQAATLYPFNTPKTKEAYYYRKIFESRFPNKSKWIPYFWMPKWCETSDPSARTLKHYK 551          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. TrEMBL
Match: A0A1S3INM5 (asparagine synthetase [glutamine-hydrolyzing] OS=Lingula unguis OX=7574 GN=LOC106165722 PE=4 SV=1)

HSP 1 Score: 540.806 bits (1392), Expect = 0.000e+0
Identity = 297/571 (52.01%), Postives = 385/571 (67.43%), Query Frame = 2
Query:   17 MCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHEEGIQINILKPGCVLEFDLYDNGTVNTSFKE-HSFAKIGNQPIFKSLVEPDPNKNIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYWMPRFVEAKDPSARDLSHYK 1726
            MCGIWAI G + +          IA RGPD++RIEN+NH+K+CCL FHRL+IV DI GMQP+R+   PHL +I NGEIYN K +  +F  D  T+ D E ++HLY   G    AQ+LDGVF+  +LDT ++KV+L RD +GVRP  + + E GFL +CSE KG              GL     +  HE  + I    PG V  + L   G     F+E   F KIG+ P +++L  P    ++  NIR LL AAV KRL + RRIGCLLSGGLDSSL+A L+VK  KE  + YK+QTF+ GM     DILAARKV+ FLGTEH EV F+ E+ I+ L D+I  LE++DITT+RAS GMYL++K+I  NTD++VIFSGEG+DEL  GYIYFH AP  E    E  RLL+DL  +D+ R DRT +G GLE RVPFLD +F+SYYLS+DPKLRQPKDG+EK+LLR +F   NLIP +ILWRPKEAFSDGVS + K+ ++ ++Q+Y   +I++E+   + + YP   P TKEA+Y+RQ FE+Y+P +    PYYWMP++ +  DPSAR L HYK
Sbjct:    1 MCGIWAIFGSDDDVSRQCSSCLKIAHRGPDAFRIENVNHFKNCCLAFHRLAIVDDIYGMQPMRVHALPHLWMIYNGEIYNCKLVQKQFDFDYETNCDGEAILHLYNHGGAEFAAQHLDGVFAFVLLDTSERKVYLGRDTYGVRPA-FRMVEDGFLAVCSEAKG------------LLGLAHTSTD--HE--VDIQPFPPGHVETYSLDKKG--KAKFQEIKRFHKIGDMPKYETLA-PALVDDVTTNIRNLLNAAVKKRLMANRRIGCLLSGGLDSSLVAALVVKNAKELGVPYKVQTFATGM-PGSTDILAARKVADFLGTEHHEVFFTEEEGIQALGDVIRHLESYDITTVRASTGMYLVSKYISENTDSVVIFSGEGADELCQGYIYFHNAPTAEEADVESRRLLDDLYLYDVLRGDRTTAGWGLELRVPFLDHQFTSYYLSIDPKLRQPKDGVEKYLLRSAFDQENLIPNDILWRPKEAFSDGVS-SEKRSWHHVIQEYVASRINNEDMENAPKKYPFNPPRTKEAYYFRQLFEQYYPGKAPWIPYYWMPKWSKTDDPSARTLKHYK 549          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. TrEMBL
Match: A0A3B4CTN0 (Asparagine synthetase [glutamine-hydrolyzing] OS=Pygocentrus nattereri OX=42514 PE=4 SV=1)

HSP 1 Score: 540.421 bits (1391), Expect = 0.000e+0
Identity = 295/581 (50.77%), Postives = 389/581 (66.95%), Query Frame = 2
Query:   17 MCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHE--EGIQINILKPGCVLEFDLYDNGTVNTSFKEHSFAKIGNQPIF------KSLVEPDPNKNIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYWMPRFVEAKDPSARDLSHYKCSK 1735
            MCGIWA+ G +            IA RGPD++R EN+N +  CC GFHRL+IV  + GMQP+R+K+ P+L L  NGEIYN+K L   F  D  TH D E ++HLY++ G   MA  LDGVF+  +LD   +KVFL RD +GVRPM  +L + GFL +CSE KG                   +  I H   E ++I    PG    FDL  NG V  S K   F    ++P        ++L +    + +  NIR L E AV KRL + RRIGCLLSGGLDSSL+A  LVK  KE ++ Y +QTFSIG  D   D +AARKV+  + +EH EVNF+ E+ IK L ++I  LE++DITT+RAS+GMYL++KFI+ NTD++VIFSGEGSDELT GYIYFHKAP+P+A  E+ +RL+ +L  FD+ RADRT +  GLE RVPFLD +FS+Y+LSL P++R PKDG+EK LLR+SF GLNLIP+EILWR KEAFSDG++ A KK +Y +LQD+   +++D +  K+++LYP  TP+TKE +YYRQ FEK++P + +   +YWMPR+++A DPSAR LS YK  K
Sbjct:    1 MCGIWALFGSDECLSVQCTSAMKIAHRGPDAFRFENVNGFTSCCFGFHRLAIVDQLYGMQPLRVKKFPYLFLCYNGEIYNHKRLRDHFEFDYQTHMDGEILLHLYDRFGVEKMATLLDGVFAFILLDVANRKVFLGRDTYGVRPMFKLLTDDGFLAVCSEAKG-------------------LTQITHSMSEPVKITPFPPGHFEIFDLQPNGKVK-SVKMDRFHCCTDEPKHAVYDSAEALGKGFALETVKANIRILFENAVRKRLMAHRRIGCLLSGGLDSSLVAATLVKLAKEQELQYPIQTFSIGACD-SPDAIAARKVAAHIDSEHHEVNFTPEEGIKALEEVIVHLESYDITTVRASVGMYLVSKFIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPKAAAEDSVRLMKELYMFDVLRADRTTAAHGLELRVPFLDHRFSAYFLSLPPEMRVPKDGVEKHLLRESFKGLNLIPDEILWRRKEAFSDGMTSA-KKSWYAILQDHIESEVNDSQLEKAAKLYPHNTPTTKEGYYYRQVFEKHYPGRSDWISHYWMPRWIKATDPSARTLSIYKPDK 559          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. TrEMBL
Match: A0A3P8V7M7 (Asparagine synthetase [glutamine-hydrolyzing] OS=Cynoglossus semilaevis OX=244447 PE=4 SV=1)

HSP 1 Score: 540.421 bits (1391), Expect = 0.000e+0
Identity = 289/579 (49.91%), Postives = 389/579 (67.18%), Query Frame = 2
Query:   17 MCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHEEGIQINILKPGCVLEFDLYDNGTVNTSFKEHSFAKIGNQP------IFKSLVEPDPNKNIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYWMPRFVEAKDPSARDLSHYKCSK 1735
            MCGIWA+ G +            IA RGPD++R EN++ Y +CC GFHRL+I+  + GMQP+RIK+ P L L  NGEIYN+ +L  +F  D  T  D E ++HLY++ G   MA  LDGVF+  +LDT  +KV+L RD +GVRP+  +L + GFL +CSE KG    S+       +  + I+P +            PG    FDL  NG V  S +   F +   +P        ++L      + +  NIR L E AV KRL ++RRIGCLLSGGLDSSL+A  LVK  KE K+ Y +QTFSIG  DD  D+LAARKV+  +G+EH EVNF++E+ ++ + D+I+ LET+DITTIRAS+GMYL++K+++  +D++VIFSGEGSDELT GYIYFHKAPNP+A  E+ +RL+ +L  FD+ RADRT S  GLE RVPFLD +F++YYLSL   +R P+ G+EK+LLR SF GL+LIPEEILWR KEAFSDG+  + KK +Y  LQ++    ++D++  K+ + +P L PSTKEA+YYRQ FEK+FPN+     +YWMPR+++A DPSAR LS YK  K
Sbjct:    1 MCGIWALFGSDECLSVQWSSAMKIAHRGPDAFRFENVDGYTNCCFGFHRLAILDQLYGMQPLRIKKFPFLWLCYNGEIYNHHTLRKQFDFDHQTEVDGEILLHLYDRFGIQKMASLLDGVFAFILLDTSNRKVYLGRDTYGVRPLFKLLTDDGFLAVCSEAKGLTNLSY-----AMETPVKIVPFL------------PGHFEAFDLKQNGKVR-SVQMERFHRCTQEPAHAICDTLETLPTSFDEETVKSNIRALFENAVKKRLMAQRRIGCLLSGGLDSSLVAATLVKLAKEEKLPYPIQTFSIG-SDDSPDLLAARKVAAHIGSEHHEVNFTVEEGVQAVEDVIFHLETYDITTIRASVGMYLVSKYVKEKSDSVVIFSGEGSDELTQGYIYFHKAPNPKAAAEDSLRLMEELYLFDVLRADRTTSAHGLELRVPFLDHRFTAYYLSLPEDMRIPRHGVEKYLLRDSFKGLDLIPEEILWRRKEAFSDGM-MSLKKSWYCFLQEHLESMVNDDQMEKAHKTFPHLPPSTKEAYYYRQVFEKFFPNRAEWLSHYWMPRWIKATDPSARTLSIYKQDK 559          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Cavefish
Match: asns (asparagine synthetase [glutamine-hydrolyzing]-like [Source:NCBI gene;Acc:111195517])

HSP 1 Score: 520.005 bits (1338), Expect = 1.997e-179
Identity = 285/583 (48.89%), Postives = 385/583 (66.04%), Query Frame = 2
Query:   17 MCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHE--EGIQINILKPGCVLEFDLYDNGTVNTSFKEHSFAKIGNQPIFKSLVEPD------PNKNIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYWMPRFVEAKDPSARDLSHYKCSKTN 1741
            MCGIWA+ G +            IA RGPD++R EN+N + +CC GFHRL+IV  + GMQP+R+K+ P+L L  NGEIYN++ L  +F  D  T  D E ++HLY++ G   M+  LDGVF+  +LDT  +K+FL RD +GVRPM  +L + GFL +CSE KG                   +  I H   E ++I    PG   EF+L  NG V  S +   F     +P      + +        + +  NIR L E AV KRL + RRIGCLLSGGLDSSL+A  LVK  KE ++ Y +QTF+IG  +D  DI AARKV+  +G+EH EVNF+ E++IK + ++I  LE++DITT+RAS+GMYL++K+I+  TD++VIFSGEGSDELT GYIYFHKAP+P+A  E+ +RLL +L  FD+ RADRT +  GLE RVPFLD +F++YYLSL  ++R PKDG+EK LLR++FSGL+LIP+EILWR KEAFSDG++ +TKK +Y  LQ+    KI+D +  K+ +L+P   P+TKE  + RQ FEK++P     T +YWMPR+++A DPSAR LS YK  K  
Sbjct:    1 MCGIWALFGSDECLAIQCTNAMKIAHRGPDAFRFENVNGFTNCCFGFHRLAIVDQLHGMQPLRVKKFPYLWLCYNGEIYNHELLKEQFEFDYQTRMDGEILLHLYDRFGIEKMSSLLDGVFAFILLDTANRKIFLGRDTYGVRPMFKLLTDDGFLAVCSEAKG-------------------LTQITHSMSEPVKIMPFPPGHFEEFNLKLNGKVE-SVQLERFHCCTEEPKHAEYDDAEQLGKGFALETVKSNIRILFENAVRKRLMAHRRIGCLLSGGLDSSLVAATLVKLSKEQELQYPIQTFAIG-AEDSPDIAAARKVAAHIGSEHHEVNFTPEEAIKAVEEVIVHLESYDITTVRASVGMYLISKYIREKTDSVVIFSGEGSDELTQGYIYFHKAPSPKAGAEDSVRLLKELYMFDVLRADRTTAAHGLELRVPFLDHRFTAYYLSLPEEMRAPKDGVEKHLLREAFSGLDLIPDEILWRRKEAFSDGMT-STKKSWYSFLQENIESKINDSQLQKAKKLFPYNPPTTKEGLFMRQLFEKHYPGCCEWTTHYWMPRWIKATDPSARTLSIYKPEKNQ 561          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Cavefish
Match: asns (asparagine synthetase [glutamine-hydrolyzing]-like [Source:NCBI gene;Acc:111195517])

HSP 1 Score: 517.694 bits (1332), Expect = 1.525e-178
Identity = 283/581 (48.71%), Postives = 384/581 (66.09%), Query Frame = 2
Query:   17 MCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHE--EGIQINILKPGCVLEFDLYDNGTVNTSFKEHSFAKIGNQPIFKSLVEPD------PNKNIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYWMPRFVEAKDPSARDLSHYKCSK 1735
            MCGIWA+ G +            IA RGPD++R EN+N + +CC GFHRL+IV  + GMQP+R+K+ P+L L  NGEIYN++ L  +F  D  T  D E ++HLY++ G   M+  LDGVF+  +LDT  +K+FL RD +GVRPM  +L + GFL +CSE KG                   +  I H   E ++I    PG   EF+L  NG V  S +   F     +P      + +        + +  NIR L E AV KRL + RRIGCLLSGG+DSSL+A  LVK  KE ++ Y +QTF+IG  +D  DI AARKV+  +G+EH EVNF+ E++IK + ++I  LE++DITT+RAS+GMYL++K+I+  TD++VIFSGEGSDELT GYIYFHKAP+P+A  E+ +RLL +L  FD+ RADRT +  GLE RVPFLD +F++YYLSL  ++R PKDG+EK LLR++FSGL+LIP+EILWR KEAFSDG++ +TKK +Y  LQ+    KI+D +  K+ +L+P   P+TKE  + RQ FEK++P       +YWMPR+++A DPSAR LS YK  K
Sbjct:    1 MCGIWALFGSDECLAIQCTNAMKIAHRGPDAFRFENVNGFTNCCFGFHRLAIVDQLHGMQPLRVKKFPYLWLCYNGEIYNHELLKEQFEFDYQTRMDGEILLHLYDRFGIEKMSSLLDGVFAFILLDTANRKIFLGRDTYGVRPMFKLLTDDGFLAVCSEAKG-------------------LTQITHSMSEPVKIMHFPPGHFEEFNLKLNGKVE-SVQLERFHCCTEEPKHAEYDDAEQLGKGFALETVKSNIRILFENAVRKRLMAHRRIGCLLSGGVDSSLVAATLVKLSKEQELQYPIQTFAIG-AEDSPDIAAARKVAAHIGSEHHEVNFTPEEAIKAVEEVIVHLESYDITTVRASVGMYLVSKYIREKTDSVVIFSGEGSDELTQGYIYFHKAPSPKAGAEDSVRLLKELYMFDVLRADRTTAAHGLELRVPFLDHRFTAYYLSLPEEMRAPKDGVEKHLLREAFSGLDLIPDEILWRRKEAFSDGMT-STKKSWYSFLQENIESKINDSQLQKAKKLFPYNPPTTKEGLFMRQLFEKHYPGCYEWITHYWMPRWIKATDPSARTLSIYKPEK 559          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Cavefish
Match: asns (asparagine synthetase [glutamine-hydrolyzing]-like [Source:NCBI gene;Acc:111195517])

HSP 1 Score: 516.924 bits (1330), Expect = 2.459e-178
Identity = 283/581 (48.71%), Postives = 384/581 (66.09%), Query Frame = 2
Query:   17 MCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHE--EGIQINILKPGCVLEFDLYDNGTVNTSFKEHSFAKIGNQPIFKSLVEPD------PNKNIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYWMPRFVEAKDPSARDLSHYKCSK 1735
            MCGIWA+ G +            IA RGPD++R EN+N + +CC GFHRL+IV  + GMQP+R+K+ P+L L  NGEIYN++ L  +F  D  T  D E ++HLY++ G   M+  LDGVF+  +LDT  +K+FL RD +GVRPM  +L + GFL +CSE KG                   +  I H   E ++I    PG   EF+L  NG V  S +   F     +P      + +        + +  NIR L E AV KRL + RRIGCLLSGG+DSSL+A  LVK  KE ++ Y +QTF+IG  +D  DI AARKV+  +G+EH EVNF+ E++IK + ++I  LE++DITT+RAS+GMYL++K+I+  TD++VIFSGEGSDELT GYIYFHKAP+P+A  E+ +RLL +L  FD+ RADRT +  GLE RVPFLD +F++YYLSL  ++R PKDG+EK LLR++FSGL+LIP+EILWR KEAFSDG++ +TKK +Y  LQ+    KI+D +  K+ +L+P   P+TKE  + RQ FEK++P       +YWMPR+++A DPSAR LS YK  K
Sbjct:    1 MCGIWALFGSDECLAIQCTNAMKIAHRGPDAFRFENVNGFTNCCFGFHRLAIVDQLHGMQPLRVKKFPYLWLCYNGEIYNHELLKEQFEFDYQTRMDGEILLHLYDRFGIEKMSSLLDGVFAFILLDTANRKIFLGRDTYGVRPMFKLLTDDGFLAVCSEAKG-------------------LTQITHSMSEPVKIMPFPPGHFEEFNLKLNGKVE-SVQLERFHCCTEEPKHAEYDDAEQLGKGFALETVKSNIRILFENAVRKRLMAHRRIGCLLSGGVDSSLVAATLVKLSKEQELQYPIQTFAIG-AEDSPDIAAARKVAAHIGSEHHEVNFTPEEAIKAVEEVIVHLESYDITTVRASVGMYLVSKYIREKTDSVVIFSGEGSDELTQGYIYFHKAPSPKAGAEDSVRLLKELYMFDVLRADRTTAAHGLELRVPFLDHRFTAYYLSLPEEMRAPKDGVEKHLLREAFSGLDLIPDEILWRRKEAFSDGMT-STKKSWYSFLQENIESKINDSQLQKAKKLFPYNPPTTKEGLFMRQLFEKHYPGCYEWITHYWMPRWIKATDPSARTLSIYKPEK 559          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Cavefish
Match: asns (asparagine synthetase [glutamine-hydrolyzing]-like [Source:NCBI gene;Acc:111195517])

HSP 1 Score: 517.694 bits (1332), Expect = 3.366e-178
Identity = 283/582 (48.63%), Postives = 384/582 (65.98%), Query Frame = 2
Query:   14 NMCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHE--EGIQINILKPGCVLEFDLYDNGTVNTSFKEHSFAKIGNQPIFKSLVEPD------PNKNIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYWMPRFVEAKDPSARDLSHYKCSK 1735
             MCGIWA+ G +            IA RGPD++R EN+N + +CC GFHRL+IV  + GMQP+R+K+ P+L L  NGEIYN++ L  +F  D  T  D E ++HLY++ G   M+  LDGVF+  +LDT  +K+FL RD +GVRPM  +L + GFL +CSE KG                   +  I H   E ++I    PG   EF+L  NG V  S +   F     +P      + +        + +  NIR L E AV KRL + RRIGCLLSGG+DSSL+A  LVK  KE ++ Y +QTF+IG  +D  DI AARKV+  +G+EH EVNF+ E++IK + ++I  LE++DITT+RAS+GMYL++K+I+  TD++VIFSGEGSDELT GYIYFHKAP+P+A  E+ +RLL +L  FD+ RADRT +  GLE RVPFLD +F++YYLSL  ++R PKDG+EK LLR++FSGL+LIP+EILWR KEAFSDG++ +TKK +Y  LQ+    KI+D +  K+ +L+P   P+TKE  + RQ FEK++P       +YWMPR+++A DPSAR LS YK  K
Sbjct:   29 KMCGIWALFGSDECLAIQCTNAMKIAHRGPDAFRFENVNGFTNCCFGFHRLAIVDQLHGMQPLRVKKFPYLWLCYNGEIYNHELLKEQFEFDYQTRMDGEILLHLYDRFGIEKMSSLLDGVFAFILLDTANRKIFLGRDTYGVRPMFKLLTDDGFLAVCSEAKG-------------------LTQITHSMSEPVKIMPFPPGHFEEFNLKLNGKVE-SVQLERFHCCTEEPKHAEYDDAEQLGKGFALETVKSNIRILFENAVRKRLMAHRRIGCLLSGGVDSSLVAATLVKLSKEQELQYPIQTFAIG-AEDSPDIAAARKVAAHIGSEHHEVNFTPEEAIKAVEEVIVHLESYDITTVRASVGMYLVSKYIREKTDSVVIFSGEGSDELTQGYIYFHKAPSPKAGAEDSVRLLKELYMFDVLRADRTTAAHGLELRVPFLDHRFTAYYLSLPEEMRAPKDGVEKHLLREAFSGLDLIPDEILWRRKEAFSDGMT-STKKSWYSFLQENIESKINDSQLQKAKKLFPYNPPTTKEGLFMRQLFEKHYPGCYEWITHYWMPRWIKATDPSARTLSIYKPEK 588          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Cavefish
Match: asns (asparagine synthetase [glutamine-hydrolyzing]-like [Source:NCBI gene;Acc:111195517])

HSP 1 Score: 516.538 bits (1329), Expect = 3.717e-178
Identity = 284/581 (48.88%), Postives = 384/581 (66.09%), Query Frame = 2
Query:   17 MCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHE--EGIQINILKPGCVLEFDLYDNGTVNTSFKEHSFAKIGNQPIFKSLVEPD------PNKNIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYWMPRFVEAKDPSARDLSHYKCSK 1735
            MCGIWA+ G +            IA RGPD++R EN+N + +CC GFHRL+IV  + GMQP+R+K+ P+L L  NGEIYN++ L  +F  D  T  D E ++HLY++ G   M+  LDGVF+  +LDT  +K+FL RD +GVRPM  +L + GFL +CSE KG                   +  I H   E ++I    PG   EF+L  NG V  S +   F     +P      + +        + +  NIR L E AV KRL + RRIGCLLSGGLDSSL+A  LVK  KE ++ Y +QTF+IG  +D  DI AARKV+  +G+EH EVNF+ E++IK + ++I  LE++DITT+RAS+GMYL++K+I+  TD++VIFSGEGSDELT GYIYFHKAP+P+A  E+ +RLL +L  FD+ RADRT +  GLE RVPFLD +F++YYLSL  ++R PKDG+EK LLR++FSGL+LIP+EILWR KEAFSDG++ +TKK +Y  LQ+    KI+D +  K+ +L+P   P+TKE  + RQ FEK++P       +YWMPR+++A DPSAR LS YK  K
Sbjct:    1 MCGIWALFGSDECLAIQCTNAMKIAHRGPDAFRFENVNGFTNCCFGFHRLAIVDQLHGMQPLRVKKFPYLWLCYNGEIYNHELLKEQFEFDYQTRMDGEILLHLYDRFGIEKMSSLLDGVFAFILLDTANRKIFLGRDTYGVRPMFKLLTDDGFLAVCSEAKG-------------------LTQITHSMSEPVKIMPFPPGHFEEFNLKLNGKVE-SVQLERFHCCTEEPKHAEYDDAEQLGKGFALETVKSNIRILFENAVRKRLMAHRRIGCLLSGGLDSSLVAATLVKLSKEQELQYPIQTFAIG-AEDSPDIAAARKVAAHIGSEHHEVNFTPEEAIKAVEEVIVHLESYDITTVRASVGMYLVSKYIREKTDSVVIFSGEGSDELTQGYIYFHKAPSPKAGAEDSVRLLKELYMFDVLRADRTTAAHGLELRVPFLDHRFTAYYLSLPEEMRAPKDGVEKHLLREAFSGLDLIPDEILWRRKEAFSDGMT-STKKSWYSFLQENIESKINDSQLQKAKKLFPYNPPTTKEGLFMRQLFEKHYPGCYEWITHYWMPRWIKATDPSARTLSIYKPEK 559          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Yeast
Match: ASN1 (Asparagine synthetase; catalyzes the synthesis of L-asparagine from L-aspartate in the asparagine biosynthetic pathway; ASN1 has a paralog, ASN2, that arose from the whole genome duplication [Source:SGD;Acc:S000006349])

HSP 1 Score: 233.032 bits (593), Expect = 2.481e-69
Identity = 211/613 (34.42%), Postives = 304/613 (49.59%), Query Frame = 2
Query:   17 MCGIWAIIGYEGNTM---SLMHYFQTIADRGPDSYRIENINHYKDCCLGFH-RLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFS-LDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRP--MKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHEEGIQINILKPGCVLEFDLYDNGT--VNTSFKEHSF--AKIGNQPIFKSLVEPDPNKNIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFS------IGMGDDGV--------------------DILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDP--KLRQPKDG-IEKWLLRKSFSGLN------LIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQ-VNLTPYYWMPR--FVEAKDPSAR 1708
            MCGI+A   +E         +   + I  RGPD     + N  K+  +  H RL+IVG   G QPI   +  ++ L  NGEIYN+  L  E +  +  T SD E +I +Y K   +   + LDG+F+  + D  + ++   RD  G+    M    A    +   SE+K                        L ++   I    PG V     YD+ T  +   F        +I + PI             Y  IR  LE AV KRL +E   G LLSGGLDSSLIA +  +   +A  D +  T+        G+ DDG                     D+ AARKV+KF+G+ H E  F+L++ +  L D+IY LET+D+TTIRAS  M+LL++ I+     +V+ SGEGSDE+ GGY+YF +AP+   FH E ++ + +L   D  RA+++    GLE RVPFLD +F    +++DP  K+ +PK+G IEK++LRK+F           +PEEILWR KE FSDGV  +    +   L+D     ISDE ++     +    P+TKEAF+YR  F+  FP + V  T   W+P+  +  A+DPS R
Sbjct:    1 MCGIFAAFRHEDVHRYKPKALQLSKRIRHRGPDW----SGNAIKNSTIFVHERLAIVGVESGAQPITSSDGEYM-LCVNGEIYNHIQLREECADYEFGTLSDCEPIIPMYLK-HDIDAPKYLDGMFAWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELK-----------------------CLTDDCDTITAFPPGHV-----YDSKTDKITRYFTPDWLDEKRIPSTPI------------DYMAIRHSLEKAVRKRLMAEVPYGVLLSGGLDSSLIASIAARETAKATNDVEPSTYDSKARHLAGIDDDGKLHTAGWTSLHSFAIGLPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVPFLDREFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKEQFSDGVGYS----WIDGLKDTAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTVADTVMRWIPKADWGCAEDPSGR 562          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Yeast
Match: ASN2 (Asparagine synthetase; catalyzes the synthesis of L-asparagine from L-aspartate in the asparagine biosynthetic pathway; ASN2 has a paralog, ASN1, that arose from the whole genome duplication [Source:SGD;Acc:S000003356])

HSP 1 Score: 206.453 bits (524), Expect = 2.028e-59
Identity = 176/513 (34.31%), Postives = 264/513 (51.46%), Query Frame = 2
Query:  296 THSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHEEGIQINILKPGCVLEFDLYDNGT--VNTSFKEHSF--AKIGNQPIFKSLVEPDPNKNIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDY--------------------------KLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDP--KLRQPKDG-IEKWLLRKSFSGLN------LIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNL-TPYYWMPR--FVEAKDPSAR 1708
            T SD E +I LY +   +   + LDG+F+  + D+ K ++   RD  GV  +        ++G  S+     Y     +    K L D+  +I+           PG V     YD+ T  +   F        +I + P+             Y  IR  LE AV KRL +E   G LLSGGLDSSLIA +  +  ++A  D                           +L +F+IG+  +  D+ AARKV+KF+G+ H E  F+L++ +  L D+IY LET+D+TTIRAS  M+LL++ I+     +V+ SGEGSDE+ GGY+YF +AP+   FH E ++ + +L   D  RA+++    GLE RVPFLD  F    +++DP  K+ +PK+G IEK++LRK+F   +       +PEEILWR KE FSDGV  +    +   L+D     ISD  ++     +    P+TKEA++YR  F+ +FP +    T   W+P+  +  A+DPS R
Sbjct:   94 TFSDCEPIIPLYLE-HDIDAPKYLDGMFAFCLYDSKKDRIVAARDPIGVVTL--------YMGRSSQSPETVY-----FASELKCLTDVCDSIIS--------FPPGHV-----YDSETDKITRYFTPDWLDEKRIPSTPV------------DYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDSSLIAAIAARETEKANADANEDNNVDEKQLAGIDDQGHLHTSGWSRLHSFAIGL-PNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKEQFSDGVGYS----WIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTAADTVMRWIPKADWGCAEDPSGR 561          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Yeast
Match: YML096W_mRNA (Putative protein with similarity to asparagine synthetases; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm; YML096W is not an essential gene and partially overlaps the verified gene RAD10 [Source:SGD;Acc:S000004562])

HSP 1 Score: 56.9954 bits (136), Expect = 5.185e-9
Identity = 44/122 (36.07%), Postives = 61/122 (50.00%), Query Frame = 2
Query: 1130 IVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDA---KFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQA 1486
            IV+FSG G+DEL GGY  F   P P    EE  R +N++   ++ R D+ I+  G+E R PFLD    K S+  + ++ K       + K +LRK  S   L  + I   PK A   G   A
Sbjct:  392 IVLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYDRNLNRDDKVIAHNGVEVRYPFLDEYVIKLSTAEIPINFK-------VNKLILRKVASQY-LKLDGISSEPKRAIQFGAKSA 504          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Nematostella
Match: EDO43756 (Asparagine synthetase [Source:UniProtKB/TrEMBL;Acc:A7RXD3])

HSP 1 Score: 525.013 bits (1351), Expect = 0.000e+0
Identity = 294/578 (50.87%), Postives = 375/578 (64.88%), Query Frame = 2
Query:   17 MCGIWAIIG---YEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKG---FLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNIL-HEEGIQINILKPGCVLEFDLYDNGTVNTSFKEHSFAKIGNQPIFKSLVEPDPNKNIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGV-SQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYWMPRFVEAKDPSARDLSHYK 1726
            MCGIWAI G   Y   T S M     I  RGPD +R+E I H+ +CCL FHRL++V D+ GMQP+RIK+ PHL LI NGEIYN+K +  +F  DV T  D E ++HLY+K G    AQ LDGVF+  I+DT KK+V L RD  G+RPM  +  E      L ICSE K                L +I      +   +Q+    PG    + L  NG V    +   +  IG  P+F + V P   ++  ENIR  +  AV KRL ++RRIGC LSGGLDSSL+A LL K  K A IDY +QTFSIGM +   D+ AARKV+  +G+EH EV F+ E+ I+ L D+IY LE++DITTIRAS+ MYL+AK++  NTD +V++SGEGSDEL  GYIYFHKAP+PE   +E +RLL DL  +D+ R DR+ +  GLE RVPFLD  F+SY+LSL P  RQPK+G+EKWLLR +F G  L+P EILWRPKEAFSDGV S A  K ++ +LQ Y  + ++DE  +K+S+LYP  TP TKE+FYYR  FE+ FP    L PY W+P++  A DPSAR LSHYK
Sbjct:    1 MCGIWAIFGIHDYHKYTTSSM----AIKGRGPDCFRMETIPHFSNCCLAFHRLAVVDDLYGMQPMRIKKLPHLFLIYNGEIYNHKQVEEKFGFDVFTQCDGEVILHLYDKFGAEKAAQMLDGVFAFCIIDTKKKQVHLGRDTFGIRPMFTLKQEDTKPTVLAICSEAKS---------------LTEIEKTFTGNGHKMQLETFPPGHYHSYSLGANGQVAL-LESGPYTYIGKPPVFDTGVVP--VRDTMENIRLYMTQAVKKRLMADRRIGCFLSGGLDSSLVAALLTKEAKNAGIDYPIQTFSIGM-EGSPDVAAARKVAAHIGSEHHEVTFTPEEGIQALHDVIYALESYDITTIRASVPMYLVAKYVSENTDTVVVYSGEGSDELCQGYIYFHKAPSPEEGDKESLRLLKDLYLYDVLRGDRSTAVHGLEIRVPFLDVAFTSYFLSLPPAERQPKEGVEKWLLRAAFDGTGLLPHEILWRPKEAFSDGVTSNAPGKSWFEILQCYVEDHVADEALAKASKLYPFNTPRTKESFYYRSVFEELFPGHHELIPYMWLPQWTGATDPSARTLSHYK 555          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Nematostella
Match: EDO25657 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DVV2])

HSP 1 Score: 195.667 bits (496), Expect = 1.262e-56
Identity = 160/459 (34.86%), Postives = 236/459 (51.42%), Query Frame = 2
Query:   17 MCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDC--CLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEF--SLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIK--G*QYKSFF*YFVLFKGLIDIIPNILHEEGIQINILKPGCVLEFDLYDNGTVNTSFKEHSFAKIGNQPIFKSLVEPDPNKNIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPK 1375
            MCGI AIIG       +    + ++ RGPD   I    H  +C   L   RLSIV    G QPI+        ++ NGEIYN+ +L           T SD E ++HLYE+ G       LDG+F+  ++D         RD  G++P+ Y + E+G     SE+K    Q K+F                         +   PG           T  T F ++   +   Q   K++ E D     Y  IR  L  +V KRL ++   G LLSGGLDSSL + +  + + ++K    L +FSIG+ ++  D++AARKV++ LGTEH EV FS+E+ IK +  LI+ LET+D+T+IRAS  M+ ++K I T+    ++ SGEG+DE+ GGY+YF  AP+ + F +E +  +  L   D+ RAD++    GLE RVPFLD +F    + + P+ +QPK
Sbjct:    1 MCGILAIIGKGKEEALVQQLSKRMSHRGPDESDI----HVTECGHILSHERLSIVDLHTGKQPIQGTSTA--WMVHNGEIYNHIALRETVLKHHAFRTTSDSEVIVHLYEEFG-YDFCHYLDGMFAFVVVD--GDDFIAGRDPLGIKPLYYGIDERGRYYFASEMKSIADQCKTF-------------------------STFPPGHYY--------TTKTGFVKYYKPEWEEQS--KAVEELD-----YAAIRTTLTESVRKRLMADVPFGVLLSGGLDSSLTSSIAKRLLGDSKT---LHSFSIGLDENAPDLVAARKVAEVLGTEHHEVYFSVEEGIKNIEKLIWHLETYDVTSIRASTPMFFMSKKI-TDLGIKMVLSGEGADEIFGGYLYFRNAPSADDFQKETIERVQKLFTADLLRADKSTMAHGLEARVPFLDKEFLELAMKIKPEEKQPK 406          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Nematostella
Match: EDO28991 (Asparagine synthetase [Source:UniProtKB/TrEMBL;Acc:A7T4X2])

HSP 1 Score: 55.4546 bits (132), Expect = 4.526e-8
Identity = 51/174 (29.31%), Postives = 78/174 (44.83%), Query Frame = 2
Query:   17 MCGIWAIIGYEGNTMSLMHYFQTIAD-------RGPDSYRIENINHYKDCCLGFHRLSIVGDID-GMQPIRIKEEPHLSLICNGEIYNYKSLVSEF-SLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG*Q 511
            MCGI     Y  N  S+   F  ++D       RGPDS      NH     L  +RLS++   D  +QP    E     L+ NGEIYN+  L  E   +   + SD E + +  +  G     + + G+F+    +    ++ L+RDR G++P+ Y +     L   SE+K  Q
Sbjct:    1 MCGISGF--YNLNKSSIKKEF--LSDMIDVQNHRGPDSNNFYYNNH---IGLAHNRLSLIDLSDNAIQPFYTDE---YVLVYNGEIYNFLELKKELPKVAYESSSDTEVLFYCLQFWGIEKTLEKIQGMFAFAWYNINSDELILVRDRIGIKPLFYGVDSNSCLWFASEVKTIQ 164          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Medaka
Match: asns (asparagine synthetase (glutamine-hydrolyzing) [Source:NCBI gene;Acc:101158956])

HSP 1 Score: 523.857 bits (1348), Expect = 0.000e+0
Identity = 292/581 (50.26%), Postives = 383/581 (65.92%), Query Frame = 2
Query:   17 MCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHE--EGIQINILKPGCVLEFDLYDNGTVNTSFKEHSFAKIGNQPI------FKSLVEPDPNKNIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYWMPRFVEAKDPSARDLSHYKCSK 1735
            MCGIWA+ G +            IA RGPD++R EN+N + +CC GFHRL+IV  + GMQP+RIK+ P+L L  NGEIYN+ +L   F  D  T  D E ++HLY++ G   MA  LDGVF+  +LDT  +KV L RD +GVRP+  +L + GFL +CSE KG                   + NI H   E + I    PG +  FDL  +G V  S +   F     +P        ++L      + +  NIR LLE AV KRL + RRIGCLLSGGLDSSLIA LLVK  KE K+ YK+QTFSIG  +D  DILAARKV+  +G+EH EVNF+ E+ I+ + ++I+ LET+DITTIRAS+GM+L++K I+  TD++VIFSGEGSDELT GYIYFHKAP+  A  ++ +RLL +L  FD+ RADRT +  GLE RVPFLD +F++YYLSL   +R PKDG+EK LLR SF GLNLIPEEILWR KEAFSDG+  + KK +Y  LQ++    ++D++  K+S+ +P   P+TKEA+Y+RQ FEK +P +     +YWMPR++EA DPSAR LS Y+  K
Sbjct:    1 MCGIWALFGSDECLSVQCTCAMKIAHRGPDAFRFENVNGFTNCCFGFHRLAIVDQLYGMQPLRIKKFPYLWLCYNGEIYNHHTLQKTFDFDFQTKVDGEVLLHLYDRFGIKKMASLLDGVFAFILLDTANRKVHLGRDTYGVRPLFKLLTDDGFLAVCSEAKG-------------------LTNISHSMSEEVSIEPFLPGHIEVFDLKLSGKVQ-SLQMEPFHCCTQEPTHALYDPLQTLPAGLDEETVKSNIRSLLENAVRKRLMAHRRIGCLLSGGLDSSLIAALLVKLAKEEKLPYKIQTFSIG-SEDSPDILAARKVAAHIGSEHHEVNFTAEEGIRAVEEVIFHLETYDITTIRASVGMFLVSKHIREKTDSVVIFSGEGSDELTQGYIYFHKAPSAAAAAKDSVRLLKELYLFDVLRADRTTAAHGLELRVPFLDHRFTAYYLSLPENMRVPKDGVEKHLLRDSFKGLNLIPEEILWRRKEAFSDGM-MSMKKSWYTCLQEHLEAIVNDDQMEKASKTFPHNPPTTKEAYYFRQVFEKLYPGRAQWLSHYWMPRWIEAADPSARTLSIYEPDK 559          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Planmine SMEST
Match: SMESG000068121.1 (SMESG000068121.1)

HSP 1 Score: 1117.06 bits (2888), Expect = 0.000e+0
Identity = 562/577 (97.40%), Postives = 562/577 (97.40%), Query Frame = 2
Query:   17 MCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHEEGIQINILKPGCVLEFDLYDNGTVNTSFKEHSFAKIGNQPIFKSLVEPDPNKNIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYWMPRFVEAKDPSARDLSHYKCSKTNEN 1747
            MCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG               LIDIIPNILHEEGIQINILKPGCVLEFDLYDNGTVNTSFKEHSFAKIGNQPIFKSLVEPDPNKNIYENIRGLLEAAVTKRLQSERRIGCLLSGGLDSSLIAGLLVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYWMPRFVEAKDPSARDLSHYKCSKTNEN
Sbjct:    1 MCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG---------------LIDIIPNILHEEGIQINILKPGCVLEFDLYDNGTVNTSFKEHSFAKIGNQPIFKSLVEPDPNKNIYENIRGLLEAAVTKRLQSERRIGCLLSGGLDSSLIAGLLVKTMKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYWMPRFVEAKDPSARDLSHYKCSKTNEN 562          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Planmine SMEST
Match: SMESG000051174.1 (SMESG000051174.1)

HSP 1 Score: 439.113 bits (1128), Expect = 2.526e-148
Identity = 245/555 (44.14%), Postives = 342/555 (61.62%), Query Frame = 2
Query:   17 MCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKG*QYKSFF*YFVLFKGLIDIIPNILHEEGIQINILKPGCVLEFDLYDNGTVNTSFKE-HSFAKIGNQPIFKSLVEPDPNKNIYENIRGLLEAAVTKRLQSERRIGCXXXXXXXXXXXXXXXVKTMKEAKI---DYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYW 1669
            MCGIW ++ Y   T+ L+  F+ +  RGPDSYR+E I      C+GFHRLSI+GD   MQP+   + PHL ++CNGEIYNYK L   F       SD+EC++H+YEK G   MA +LDG+F+  ++D   KK FLIRD  G+RP+ ++      + + SE KG                   +  +      +I I+ PG ++E +L   G      KE +S+  +G   +     + +  +NI++NIR +L+ AV KRLQS+RRIGCLLSGGLDSS++AGL+ +  KE+ +     +L+TFS+GM +DG+D L A  V+K L T H +  F+ ED IK LP++IY LE+FD ++IRASIG+Y L KF++ N++ +V+ +GEGSDELT GY +FH+  + E    E  RLL +L YFDIRR+D  IS   +E RVPFLD +F +YY SLD KL+QPK G+EKWLLRKSF     +P E+LWR K  F  G+         + L +Y++  ISDEE  +    Y  L P TK+ + YR+ FE+YFP Q +L P  W
Sbjct:    1 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNTNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILHIYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKG-------------------LMEMALSSKCEIEIVLPGNIVEINLSHKGA---KVKEINSYYVLGQNLLHSKFYQSEKTENIFQNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIESSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQYSLCPQTW 533          
The following BLAST results are available for this feature:
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ASNS5.159e-17348.19asparagine synthetase (glutamine-hydrolyzing) [Sou... [more]
ASNS5.159e-17348.19asparagine synthetase (glutamine-hydrolyzing) [Sou... [more]
ASNS5.159e-17348.19asparagine synthetase (glutamine-hydrolyzing) [Sou... [more]
ASNS4.915e-16948.92asparagine synthetase (glutamine-hydrolyzing) [Sou... [more]
ASNS4.915e-16948.92asparagine synthetase (glutamine-hydrolyzing) [Sou... [more]
back to top
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
asns-18.590e-7234.86Asparagine synthetase [Source:UniProtKB/TrEMBL;Ac... [more]
asns-28.160e-6644.38Asparagine synthetase [Source:UniProtKB/TrEMBL;Ac... [more]
asns-23.486e-6544.20Asparagine synthetase [Source:UniProtKB/TrEMBL;Ac... [more]
asns-21.897e-649.38Asparagine synthetase [Source:UniProtKB/TrEMBL;Ac... [more]
back to top
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
AsnS9.762e-8032.84gene:FBgn0270926 transcript:FBtr0089463[more]
back to top
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
asns9.404e-17248.38asparagine synthetase [Source:ZFIN;Acc:ZDB-GENE-04... [more]
back to top
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
asns1.091e-17147.42asparagine synthetase (glutamine-hydrolyzing) [Sou... [more]
asns3.387e-13247.19asparagine synthetase (glutamine-hydrolyzing) [Sou... [more]
asns9.487e-12147.38asparagine synthetase (glutamine-hydrolyzing) [Sou... [more]
back to top
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Asns1.644e-18048.70asparagine synthetase [Source:MGI Symbol;Acc:MGI:1... [more]
Asns1.644e-18048.70asparagine synthetase [Source:MGI Symbol;Acc:MGI:1... [more]
Asns3.986e-4649.08asparagine synthetase [Source:MGI Symbol;Acc:MGI:1... [more]
Asns3.104e-4448.10asparagine synthetase [Source:MGI Symbol;Acc:MGI:1... [more]
Asns5.917e-3246.46asparagine synthetase [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P19891|ASNS_CRIGR6.054e-18048.45Asparagine synthetase [glutamine-hydrolyzing] OS=C... [more]
sp|Q61024|ASNS_MOUSE1.150e-17948.70Asparagine synthetase [glutamine-hydrolyzing] OS=M... [more]
sp|P49088|ASNS_RAT4.192e-17948.88Asparagine synthetase [glutamine-hydrolyzing] OS=R... [more]
sp|P17714|ASNS_MESAU1.946e-17648.19Asparagine synthetase [glutamine-hydrolyzing] OS=M... [more]
sp|Q5ZJU3|ASNS_CHICK1.825e-17549.91Asparagine synthetase [glutamine-hydrolyzing] OS=G... [more]
back to top
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S0ZWP20.000e+050.17Glutamine amidotransferase type-2 domain-containin... [more]
V4ASQ30.000e+051.66Glutamine amidotransferase type-2 domain-containin... [more]
A0A1S3INM50.000e+052.01asparagine synthetase [glutamine-hydrolyzing] OS=L... [more]
A0A3B4CTN00.000e+050.77Asparagine synthetase [glutamine-hydrolyzing] OS=P... [more]
A0A3P8V7M70.000e+049.91Asparagine synthetase [glutamine-hydrolyzing] OS=C... [more]
back to top
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
asns1.997e-17948.89asparagine synthetase [glutamine-hydrolyzing]-like... [more]
asns1.525e-17848.71asparagine synthetase [glutamine-hydrolyzing]-like... [more]
asns2.459e-17848.71asparagine synthetase [glutamine-hydrolyzing]-like... [more]
asns3.366e-17848.63asparagine synthetase [glutamine-hydrolyzing]-like... [more]
asns3.717e-17848.88asparagine synthetase [glutamine-hydrolyzing]-like... [more]
back to top
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
ASN12.481e-6934.42Asparagine synthetase; catalyzes the synthesis of ... [more]
ASN22.028e-5934.31Asparagine synthetase; catalyzes the synthesis of ... [more]
YML096W_mRNA5.185e-936.07Putative protein with similarity to asparagine syn... [more]
back to top
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO437560.000e+050.87Asparagine synthetase [Source:UniProtKB/TrEMBL;Ac... [more]
EDO256571.262e-5634.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
EDO289914.526e-829.31Asparagine synthetase [Source:UniProtKB/TrEMBL;Ac... [more]
back to top
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
asns0.000e+050.26asparagine synthetase (glutamine-hydrolyzing) [Sou... [more]
back to top
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000068121.10.000e+097.40SMESG000068121.1[more]
SMESG000051174.12.526e-14844.14SMESG000051174.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014191 ID=SMED30014191|Name=Asparagine synthetase [glutamine-hydrolyzing]|organism=Schmidtea mediterranea sexual|type=transcript|length=1798bp
CTTTGAAACCTATAACATGTGCGGAATATGGGCAATAATTGGATACGAAG
GTAACACCATGTCACTCATGCATTACTTCCAAACTATTGCCGATCGCGGA
CCGGATTCATATAGAATTGAAAACATTAACCATTACAAAGATTGCTGCTT
AGGCTTCCACAGATTGTCCATTGTCGGAGATATAGACGGAATGCAGCCAA
TCAGAATCAAAGAAGAGCCTCATTTGTCTTTGATTTGTAATGGAGAGATT
TACAATTACAAATCACTGGTCAGCGAGTTCAGTCTTGACGTAACGACTCA
TTCTGACATAGAATGCATGATTCATTTATACGAAAAATTGGGACCCGTTG
GAATGGCTCAAAATTTAGATGGGGTTTTCAGTTGTTTCATTCTAGATACC
TTGAAGAAAAAGGTTTTCCTTATTCGGGATAGACATGGAGTTCGTCCAAT
GAAATACATTCTAGCGGAAAAAGGATTTTTAGGAATCTGTTCTGAAATCA
AAGGTTGACAGTATAAATCTTTTTTTTAATATTTCGTATTATTTAAAGGA
TTAATCGACATAATTCCGAATATTCTACATGAAGAGGGAATCCAAATAAA
TATTCTTAAACCTGGCTGCGTTCTGGAATTTGACCTGTATGATAATGGGA
CAGTAAATACAAGTTTCAAAGAACATTCTTTTGCCAAGATTGGTAACCAA
CCTATTTTTAAAAGTCTAGTTGAACCAGATCCAAATAAAAATATTTATGA
AAATATTCGTGGCTTACTAGAAGCTGCGGTCACAAAACGTCTTCAGTCTG
AGAGAAGAATCGGATGTCTTTTGTCTGGTGGTTTAGATTCAAGTTTGATT
GCTGGCCTGTTAGTAAAAACTATGAAGGAAGCCAAAATTGACTATAAATT
ACAAACATTTTCTATCGGAATGGGAGATGATGGAGTAGACATTTTGGCTG
CTCGGAAAGTATCAAAATTCCTGGGCACAGAACATTTTGAAGTAAACTTT
TCATTAGAAGATAGTATTAAATTGTTGCCAGATCTCATATACAGACTCGA
AACGTTTGATATCACAACAATAAGAGCATCAATAGGGATGTATCTTTTAG
CAAAATTTATACAAACAAATACCGACAACATAGTCATATTTTCCGGAGAA
GGTTCAGATGAATTAACTGGAGGATATATTTATTTTCATAAAGCGCCGAA
CCCTGAAGCGTTTCACGAAGAATGCATGCGACTGTTGAATGATCTTTGCT
ACTTTGATATCCGAAGAGCAGATCGAACTATTTCTGGTTGTGGCTTGGAA
CCAAGAGTTCCATTTTTAGATGCTAAATTTTCGTCTTACTATCTGAGCTT
AGATCCAAAATTGAGACAGCCGAAAGATGGCATTGAAAAATGGTTGCTTC
GAAAATCATTCAGTGGGTTGAATCTTATACCAGAAGAAATTTTATGGCGA
CCCAAGGAGGCATTTAGTGATGGGGTGTCTCAAGCAACCAAAAAGCCGTT
TTATTTATTATTGCAAGATTACTTTAACGAAAAGATTTCCGACGAAGAAT
ACTCCAAATCATCTGAATTATATCCTAAGTTAACCCCATCAACCAAAGAA
GCTTTTTATTATAGGCAAACATTTGAAAAATATTTTCCAAACCAGGTTAA
TCTCACACCGTATTATTGGATGCCTCGATTTGTTGAAGCAAAAGATCCTT
CCGCCCGAGATCTGTCACATTATAAATGCTCAAAAACCAATGAAAATTGA
AACATAATTTACAATCTTTCCAAACTATTATTTTTAATTGAAATTTAC
back to top

protein sequence of SMED30014191-orf-1

>SMED30014191-orf-1 ID=SMED30014191-orf-1|Name=SMED30014191-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=293bp
MKEAKIDYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIK
LLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTG
GYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLD
AKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSD
GVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQT
FEKYFPNQVNLTPYYWMPRFVEAKDPSARDLSHYKCSKTNEN*
back to top

protein sequence of SMED30014191-orf-2

>SMED30014191-orf-2 ID=SMED30014191-orf-2|Name=SMED30014191-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=169bp
FETYNMCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCL
GFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTH
SDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPM
KYILAEKGFLGICSEIKG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005829cytosol
Vocabulary: biological process
TermDefinition
GO:0042149cellular response to glucose starvation
GO:0043066negative regulation of apoptotic process
GO:0045931positive regulation of mitotic cell cycle
GO:0006529asparagine biosynthetic process
GO:0006541glutamine metabolic process
GO:0008652cellular amino acid biosynthetic process
GO:0070981L-asparagine biosynthetic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR014729Rossmann-like_a/b/a_fold
IPR001962Asn_synthase
IPR029055Ntn_hydrolases_N
IPR017932GATase_2_dom
Vocabulary: molecular function
TermDefinition
GO:0004066asparagine synthase (glutamine-hydrolyzing) activity
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0016874ligase activity
GO:0042803protein homodimerization activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014729Rossmann-like alpha/beta/alpha sandwich foldGENE3DG3DSA:3.40.50.620coord: 1..261
e-value: 2.0E-67
score: 229.9
IPR001962Asparagine synthasePFAMPF00733Asn_synthasecoord: 109..260
e-value: 1.7E-27
score: 97.1
IPR001962Asparagine synthaseCDDcd01991Asn_Synthase_B_Ccoord: 10..201
e-value: 3.96311E-47
score: 157.196
NoneNo IPR availablePANTHERPTHR11772ASPARAGINE SYNTHETASEcoord: 1..288
NoneNo IPR availablePANTHERPTHR11772:SF23ASPARAGINE SYNTHETASE [GLUTAMINE-HYDROLYZING]coord: 1..288
NoneNo IPR availableSUPERFAMILYSSF52402Adenine nucleotide alpha hydrolases-likecoord: 8..268