Homeobox protein prospero

Overview
NameHomeobox protein prospero
Smed IDSMED30014189
Length (bp)558
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Homeobox protein prospero (SMED30014189) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Homeobox protein prospero (SMED30014189) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014189

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30014189SMESG000012837.1 dd_Smed_v4_48508_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014189SMESG000012837.1 dd_Smed_v4_48508_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30014189SMESG000012837.1 dd_Smed_v4_48508_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30014189SMESG000012837.1 dd_Smed_v4_48508_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Homeobox protein prospero vs. Ensembl Human
Match: PROX1 (prospero homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9459])

HSP 1 Score: 178.718 bits (452), Expect = 3.913e-52
Identity = 88/176 (50.00%), Postives = 118/176 (67.05%), Query Frame = 3
Query:   15 KAYSKALRSNLDLSDYHAGQQFKVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFGELDKLMHE-DLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWF 539
            K+    L+   ++S Y      + L PNHL+KAKLMFFYTRYPSS+ LK+ F D+KF +  T+QL+KWFSNFREFYYIQ+EK+ARQ +++G    E   +  + +LYR L +HYN+ N   VP+ F  V + TL EF+ AI +GKD + SWKK IYK I +LD + P  FK+PN  
Sbjct:  556 KSECGDLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCL 731          
BLAST of Homeobox protein prospero vs. Ensembl Human
Match: PROX1 (prospero homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9459])

HSP 1 Score: 178.718 bits (452), Expect = 3.913e-52
Identity = 88/176 (50.00%), Postives = 118/176 (67.05%), Query Frame = 3
Query:   15 KAYSKALRSNLDLSDYHAGQQFKVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFGELDKLMHE-DLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWF 539
            K+    L+   ++S Y      + L PNHL+KAKLMFFYTRYPSS+ LK+ F D+KF +  T+QL+KWFSNFREFYYIQ+EK+ARQ +++G    E   +  + +LYR L +HYN+ N   VP+ F  V + TL EF+ AI +GKD + SWKK IYK I +LD + P  FK+PN  
Sbjct:  556 KSECGDLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCL 731          
BLAST of Homeobox protein prospero vs. Ensembl Human
Match: PROX1 (prospero homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9459])

HSP 1 Score: 178.718 bits (452), Expect = 3.913e-52
Identity = 88/176 (50.00%), Postives = 118/176 (67.05%), Query Frame = 3
Query:   15 KAYSKALRSNLDLSDYHAGQQFKVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFGELDKLMHE-DLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWF 539
            K+    L+   ++S Y      + L PNHL+KAKLMFFYTRYPSS+ LK+ F D+KF +  T+QL+KWFSNFREFYYIQ+EK+ARQ +++G    E   +  + +LYR L +HYN+ N   VP+ F  V + TL EF+ AI +GKD + SWKK IYK I +LD + P  FK+PN  
Sbjct:  556 KSECGDLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCL 731          
BLAST of Homeobox protein prospero vs. Ensembl Human
Match: PROX1 (prospero homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9459])

HSP 1 Score: 178.718 bits (452), Expect = 3.913e-52
Identity = 88/176 (50.00%), Postives = 118/176 (67.05%), Query Frame = 3
Query:   15 KAYSKALRSNLDLSDYHAGQQFKVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFGELDKLMHE-DLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWF 539
            K+    L+   ++S Y      + L PNHL+KAKLMFFYTRYPSS+ LK+ F D+KF +  T+QL+KWFSNFREFYYIQ+EK+ARQ +++G    E   +  + +LYR L +HYN+ N   VP+ F  V + TL EF+ AI +GKD + SWKK IYK I +LD + P  FK+PN  
Sbjct:  556 KSECGDLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCL 731          
BLAST of Homeobox protein prospero vs. Ensembl Human
Match: PROX2 (prospero homeobox 2 [Source:HGNC Symbol;Acc:HGNC:26715])

HSP 1 Score: 165.236 bits (417), Expect = 8.572e-48
Identity = 77/151 (50.99%), Postives = 108/151 (71.52%), Query Frame = 3
Query:   87 LGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFGE-LDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNW 536
            L P HL+KAKLMFF+TRYPSS+ LK  FPD++F +  T+Q++KWFSNFREFYYIQ+EK ARQ +S+G    + L  L + +L++ L +HYN+ N   VP  F  +   TL+EF+ A+ +G+D + SWKK IYK I++LD D P  FK+ ++
Sbjct:  440 LNPGHLKKAKLMFFFTRYPSSNLLKVYFPDVQFNRCITSQMIKWFSNFREFYYIQMEKSARQAISDGVTNPKMLVVLRNSELFQALNMHYNKGNDFEVPDCFLEIASLTLQEFFRAVSAGRDSDPSWKKPIYKIISKLDSDIPEIFKSSSY 590          
BLAST of Homeobox protein prospero vs. Ensembl Celegans
Match: pros-1 (Homeobox protein prospero homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:P34522])

HSP 1 Score: 189.889 bits (481), Expect = 2.154e-57
Identity = 96/169 (56.80%), Postives = 115/169 (68.05%), Query Frame = 3
Query:   45 LDLSDYHAGQQFKVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFGELDKLMHED--LYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWFTK 545
            L    Y  G    +L P HLRKAKLMFFYTRYP+S+ LKS FPDI+F K+NTAQLVKWFSNFREFYY Q+EKFARQ L+EG +    D  + +D  L+++L  HYNRNN I  P     VV+ TL EF+ AI  GKD E SWKK IYK I RL+   P +FK PN+  +
Sbjct:  424 LSECGYEGGGSSSMLTPMHLRKAKLMFFYTRYPNSNLLKSYFPDIRFNKNNTAQLVKWFSNFREFYYNQMEKFARQALAEG-ITDRNDIFVSKDSELFKVLNTHYNRNNHIKAPDRLVFVVQETLREFHDAIKQGKDIEPSWKKTIYKVINRLEDQIPDFFKEPNFLER 591          
BLAST of Homeobox protein prospero vs. Ensembl Fly
Match: pros (gene:FBgn0004595 transcript:FBtr0304606)

HSP 1 Score: 205.682 bits (522), Expect = 3.314e-61
Identity = 106/191 (55.50%), Postives = 128/191 (67.02%), Query Frame = 3
Query:   12 SKAYSKALRSNLDLSDYH-----AGQQF-------KVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEG-KLFGELDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWFTK 545
            S  Y   LR+ +D  D       A  QF         L P HLRKAKLMFF+ RYPSS+ LK  FPDIKF K+NTAQLVKWFSNFREFYYIQ+EK+ARQ ++EG K   +L      +LYR+L +HYNRNN I VP+ F  VV++TL EF+ AI  GKD EQSWKK IYK I+R+D   P YFK+PN+  +
Sbjct: 1343 SPDYKTCLRAVMDAQDRQSECNSADMQFDGMAPTSSTLTPMHLRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAVTEGIKTPDDLLIAGDSELYRVLNLHYNRNNHIEVPQNFRFVVESTLREFFRAIQGGKDTEQSWKKSIYKIISRMDDPVPEYFKSPNFLEQ 1533          
BLAST of Homeobox protein prospero vs. Ensembl Fly
Match: pros (gene:FBgn0004595 transcript:FBtr0304604)

HSP 1 Score: 205.682 bits (522), Expect = 3.391e-61
Identity = 106/191 (55.50%), Postives = 128/191 (67.02%), Query Frame = 3
Query:   12 SKAYSKALRSNLDLSDYH-----AGQQF-------KVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEG-KLFGELDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWFTK 545
            S  Y   LR+ +D  D       A  QF         L P HLRKAKLMFF+ RYPSS+ LK  FPDIKF K+NTAQLVKWFSNFREFYYIQ+EK+ARQ ++EG K   +L      +LYR+L +HYNRNN I VP+ F  VV++TL EF+ AI  GKD EQSWKK IYK I+R+D   P YFK+PN+  +
Sbjct: 1643 SPDYKTCLRAVMDAQDRQSECNSADMQFDGMAPTSSTLTPMHLRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAVTEGIKTPDDLLIAGDSELYRVLNLHYNRNNHIEVPQNFRFVVESTLREFFRAIQGGKDTEQSWKKSIYKIISRMDDPVPEYFKSPNFLEQ 1833          
BLAST of Homeobox protein prospero vs. Ensembl Fly
Match: pros (gene:FBgn0004595 transcript:FBtr0304603)

HSP 1 Score: 204.527 bits (519), Expect = 7.377e-61
Identity = 106/191 (55.50%), Postives = 128/191 (67.02%), Query Frame = 3
Query:   12 SKAYSKALRSNLDLSDYH-----AGQQF-------KVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEG-KLFGELDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWFTK 545
            S  Y   LR+ +D  D       A  QF         L P HLRKAKLMFF+ RYPSS+ LK  FPDIKF K+NTAQLVKWFSNFREFYYIQ+EK+ARQ ++EG K   +L      +LYR+L +HYNRNN I VP+ F  VV++TL EF+ AI  GKD EQSWKK IYK I+R+D   P YFK+PN+  +
Sbjct: 1482 SPDYKTCLRAVMDAQDRQSECNSADMQFDGMAPTSSTLTPMHLRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAVTEGIKTPDDLLIAGDSELYRVLNLHYNRNNHIEVPQNFRFVVESTLREFFRAIQGGKDTEQSWKKSIYKIISRMDDPVPEYFKSPNFLEQ 1672          
BLAST of Homeobox protein prospero vs. Ensembl Fly
Match: pros (gene:FBgn0004595 transcript:FBtr0304607)

HSP 1 Score: 204.527 bits (519), Expect = 8.219e-61
Identity = 106/191 (55.50%), Postives = 128/191 (67.02%), Query Frame = 3
Query:   12 SKAYSKALRSNLDLSDYH-----AGQQF-------KVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEG-KLFGELDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWFTK 545
            S  Y   LR+ +D  D       A  QF         L P HLRKAKLMFF+ RYPSS+ LK  FPDIKF K+NTAQLVKWFSNFREFYYIQ+EK+ARQ ++EG K   +L      +LYR+L +HYNRNN I VP+ F  VV++TL EF+ AI  GKD EQSWKK IYK I+R+D   P YFK+PN+  +
Sbjct: 1182 SPDYKTCLRAVMDAQDRQSECNSADMQFDGMAPTSSTLTPMHLRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAVTEGIKTPDDLLIAGDSELYRVLNLHYNRNNHIEVPQNFRFVVESTLREFFRAIQGGKDTEQSWKKSIYKIISRMDDPVPEYFKSPNFLEQ 1372          
BLAST of Homeobox protein prospero vs. Ensembl Fly
Match: pros (gene:FBgn0004595 transcript:FBtr0304608)

HSP 1 Score: 201.83 bits (512), Expect = 5.744e-60
Identity = 97/154 (62.99%), Postives = 117/154 (75.97%), Query Frame = 3
Query:   87 LGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEG-KLFGELDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWFTK 545
            L P HLRKAKLMFF+ RYPSS+ LK  FPDIKF K+NTAQLVKWFSNFREFYYIQ+EK+ARQ ++EG K   +L      +LYR+L +HYNRNN I VP+ F  VV++TL EF+ AI  GKD EQSWKK IYK I+R+D   P YFK+PN+  +
Sbjct: 1548 LTPMHLRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAVTEGIKTPDDLLIAGDSELYRVLNLHYNRNNHIEVPQNFRFVVESTLREFFRAIQGGKDTEQSWKKSIYKIISRMDDPVPEYFKSPNFLEQ 1701          
BLAST of Homeobox protein prospero vs. Ensembl Zebrafish
Match: prox2 (prospero homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-081003-3])

HSP 1 Score: 180.644 bits (457), Expect = 7.914e-54
Identity = 90/170 (52.94%), Postives = 115/170 (67.65%), Query Frame = 3
Query:   33 LRSNLDLSDYHAGQQFKVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKL-FGELDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWF 539
            L+S  D S Y A    + L PNHL+KAKLMFFYTRYPSS+ LK+ FPD+KF +  T+QL+KWFSNFREFYYIQ+EKFARQ + +G     ++      +L+R L +HYN+ N   VP  F  V + TL+EFY AI   KD + SWKK IYK I +LD D P  FK+P++ 
Sbjct:  413 LQSMADRSSYMALNIQEGLTPNHLKKAKLMFFYTRYPSSNLLKNFFPDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAIIDGVTDVKDISVSRESELFRALNMHYNKANDFQVPDRFLEVAEVTLQEFYSAISLSKDSDPSWKKAIYKVICKLDSDVPEEFKSPSYL 582          
BLAST of Homeobox protein prospero vs. Ensembl Zebrafish
Match: prox2 (prospero homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-081003-3])

HSP 1 Score: 180.644 bits (457), Expect = 9.398e-54
Identity = 91/171 (53.22%), Postives = 115/171 (67.25%), Query Frame = 3
Query:   33 LRSNLDLSDYHA-GQQFKVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKL-FGELDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWF 539
            L+S  D S Y A    F  L PNHL+KAKLMFFYTRYPSS+ LK+ FPD+KF +  T+QL+KWFSNFREFYYIQ+EKFARQ + +G     ++      +L+R L +HYN+ N   VP  F  V + TL+EFY AI   KD + SWKK IYK I +LD D P  FK+P++ 
Sbjct:  413 LQSMADRSSYMALNISFHSLTPNHLKKAKLMFFYTRYPSSNLLKNFFPDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAIIDGVTDVKDISVSRESELFRALNMHYNKANDFQVPDRFLEVAEVTLQEFYSAISLSKDSDPSWKKAIYKVICKLDSDVPEEFKSPSYL 583          
BLAST of Homeobox protein prospero vs. Ensembl Zebrafish
Match: prox1a (prospero homeobox 1a [Source:ZFIN;Acc:ZDB-GENE-980526-397])

HSP 1 Score: 177.948 bits (450), Expect = 6.566e-52
Identity = 90/176 (51.14%), Postives = 116/176 (65.91%), Query Frame = 3
Query:   15 KAYSKALRSNLDLSDYHAGQQFKVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFG-ELDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWF 539
            K+    L+   D+S Y      + L PNHL+KAKLMFFYTRYPSS+ LK  F D+KF +  T+QL+KWFSNFREFYYIQ+EKFARQ +++G     EL      +L+R L +HYN+ N   VP+ F  V + TL EF+ AI +GKD + SWKK IYK I +LD + P  FK+PN  
Sbjct:  558 KSECGDLQDMSDISPYSGSTIQEGLSPNHLKKAKLMFFYTRYPSSNMLKMFFSDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAINDGVTGSEELSVSRDCELFRALNMHYNKANDFEVPERFLEVAQITLREFFNAIVAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCL 733          
BLAST of Homeobox protein prospero vs. Ensembl Zebrafish
Match: prox1a (prospero homeobox 1a [Source:ZFIN;Acc:ZDB-GENE-980526-397])

HSP 1 Score: 177.948 bits (450), Expect = 6.566e-52
Identity = 90/176 (51.14%), Postives = 116/176 (65.91%), Query Frame = 3
Query:   15 KAYSKALRSNLDLSDYHAGQQFKVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFG-ELDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWF 539
            K+    L+   D+S Y      + L PNHL+KAKLMFFYTRYPSS+ LK  F D+KF +  T+QL+KWFSNFREFYYIQ+EKFARQ +++G     EL      +L+R L +HYN+ N   VP+ F  V + TL EF+ AI +GKD + SWKK IYK I +LD + P  FK+PN  
Sbjct:  558 KSECGDLQDMSDISPYSGSTIQEGLSPNHLKKAKLMFFYTRYPSSNMLKMFFSDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAINDGVTGSEELSVSRDCELFRALNMHYNKANDFEVPERFLEVAQITLREFFNAIVAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCL 733          
BLAST of Homeobox protein prospero vs. Ensembl Zebrafish
Match: prox3 (prospero homeobox 3 [Source:ZFIN;Acc:ZDB-GENE-050107-3])

HSP 1 Score: 162.925 bits (411), Expect = 8.778e-47
Identity = 82/159 (51.57%), Postives = 107/159 (67.30%), Query Frame = 3
Query:   66 AGQQFKVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFGELDKLMH----EDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNP 530
            AG   + L P HL+KAKLMFFYTRYPSSS LK+ FPD+KF +  T+QL+KWFSNFREF+YIQ+E+FARQ   E  L    ++ +      +LYRIL +HYN++N   VP+ F  + +  L EF+ AI SG+D +  WKK IYK I +LD   P  F+ P
Sbjct:  492 AGSSQEGLSPCHLKKAKLMFFYTRYPSSSTLKTYFPDVKFNRCVTSQLIKWFSNFREFFYIQMERFARQAARE-VLTSARERALRLGRDTELYRILNMHYNKSNDYQVPERFVEISEVALREFFTAIQSGRDADPCWKKSIYKIICKLDSPVPDSFRLP 649          
BLAST of Homeobox protein prospero vs. Ensembl Xenopus
Match: PROX1 (prospero homeobox 1 [Source:NCBI gene;Acc:100134995])

HSP 1 Score: 174.481 bits (441), Expect = 1.482e-50
Identity = 86/167 (51.50%), Postives = 115/167 (68.86%), Query Frame = 3
Query:   48 DLSDYHAGQQF--KVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFGELDKLMHE-DLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWF 539
            D+S Y     +  + L PNHL+KAKLMFFYTRYPSS+ LK+ F D+KF +  T+QL+KWFSNFREFYYIQ+EK+ARQ +++G    E   +  + +LYR L +HYN+ N   VP+ F  V + TL EF+ AI +GKD + SWKK IYK I +LD + P  F++PN  
Sbjct:  567 DISPYSGSALYMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTFFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGITSTEELCITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPDIFRSPNCL 733          
BLAST of Homeobox protein prospero vs. Ensembl Mouse
Match: Prox1 (prospero homeobox 1 [Source:MGI Symbol;Acc:MGI:97772])

HSP 1 Score: 181.03 bits (458), Expect = 4.930e-53
Identity = 89/176 (50.57%), Postives = 118/176 (67.05%), Query Frame = 3
Query:   15 KAYSKALRSNLDLSDYHAGQQFKVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFGELDKLMHE-DLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWF 539
            K+    L+   D+S Y      + L PNHL+KAKLMFFYTRYPSS+ LK+ F D+KF +  T+QL+KWFSNFREFYYIQ+EK+ARQ +++G    E   +  + +LYR L +HYN+ N   VP+ F  V + TL EF+ AI +GKD + SWKK IYK I +LD + P  FK+PN  
Sbjct:  556 KSECGDLQDMSDISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCL 731          
BLAST of Homeobox protein prospero vs. Ensembl Mouse
Match: Prox1 (prospero homeobox 1 [Source:MGI Symbol;Acc:MGI:97772])

HSP 1 Score: 181.03 bits (458), Expect = 4.930e-53
Identity = 89/176 (50.57%), Postives = 118/176 (67.05%), Query Frame = 3
Query:   15 KAYSKALRSNLDLSDYHAGQQFKVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFGELDKLMHE-DLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWF 539
            K+    L+   D+S Y      + L PNHL+KAKLMFFYTRYPSS+ LK+ F D+KF +  T+QL+KWFSNFREFYYIQ+EK+ARQ +++G    E   +  + +LYR L +HYN+ N   VP+ F  V + TL EF+ AI +GKD + SWKK IYK I +LD + P  FK+PN  
Sbjct:  556 KSECGDLQDMSDISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCL 731          
BLAST of Homeobox protein prospero vs. Ensembl Mouse
Match: Prox1 (prospero homeobox 1 [Source:MGI Symbol;Acc:MGI:97772])

HSP 1 Score: 181.03 bits (458), Expect = 4.930e-53
Identity = 89/176 (50.57%), Postives = 118/176 (67.05%), Query Frame = 3
Query:   15 KAYSKALRSNLDLSDYHAGQQFKVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFGELDKLMHE-DLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWF 539
            K+    L+   D+S Y      + L PNHL+KAKLMFFYTRYPSS+ LK+ F D+KF +  T+QL+KWFSNFREFYYIQ+EK+ARQ +++G    E   +  + +LYR L +HYN+ N   VP+ F  V + TL EF+ AI +GKD + SWKK IYK I +LD + P  FK+PN  
Sbjct:  556 KSECGDLQDMSDISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCL 731          
BLAST of Homeobox protein prospero vs. Ensembl Mouse
Match: Prox2 (prospero homeobox 2 [Source:MGI Symbol;Acc:MGI:1920672])

HSP 1 Score: 175.252 bits (443), Expect = 1.112e-51
Identity = 81/152 (53.29%), Postives = 109/152 (71.71%), Query Frame = 3
Query:   87 LGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFGE-LDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWF 539
            L P HL+KAKLMFF+TRYPSSS LK+ FPD++F +  T+Q++KWFSNFREFYYIQ+EK+ARQ LS+G    + L  L   +L+R+L  HYN+ N   VP  F  +   TL+EF+ A+ +GKD + SWKK IYK I++LD D P   K+P++ 
Sbjct:  436 LSPGHLKKAKLMFFFTRYPSSSLLKAYFPDVQFNRCITSQMIKWFSNFREFYYIQMEKYARQALSDGITNAQALAVLRDSELFRVLNTHYNKGNDFEVPDCFLEIAALTLKEFFRAVLAGKDSDPSWKKPIYKVISKLDSDVPEMLKSPSFL 587          
BLAST of Homeobox protein prospero vs. Ensembl Mouse
Match: Prox2 (prospero homeobox 2 [Source:MGI Symbol;Acc:MGI:1920672])

HSP 1 Score: 175.252 bits (443), Expect = 1.112e-51
Identity = 81/152 (53.29%), Postives = 109/152 (71.71%), Query Frame = 3
Query:   87 LGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFGE-LDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWF 539
            L P HL+KAKLMFF+TRYPSSS LK+ FPD++F +  T+Q++KWFSNFREFYYIQ+EK+ARQ LS+G    + L  L   +L+R+L  HYN+ N   VP  F  +   TL+EF+ A+ +GKD + SWKK IYK I++LD D P   K+P++ 
Sbjct:  436 LSPGHLKKAKLMFFFTRYPSSSLLKAYFPDVQFNRCITSQMIKWFSNFREFYYIQMEKYARQALSDGITNAQALAVLRDSELFRVLNTHYNKGNDFEVPDCFLEIAALTLKEFFRAVLAGKDSDPSWKKPIYKVISKLDSDVPEMLKSPSFL 587          
BLAST of Homeobox protein prospero vs. UniProt/SwissProt
Match: sp|Q9U6A1|PROS_DROVI (Homeobox protein prospero OS=Drosophila virilis OX=7244 GN=pros PE=3 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 2.371e-59
Identity = 97/154 (62.99%), Postives = 116/154 (75.32%), Query Frame = 3
Query:   87 LGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEG-KLFGELDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWFTK 545
            L P HLRKAKLMFF+ RYPSS+ LK  FPDIKF K+NTAQLVKWFSNFREFYYIQ+EK+ARQ ++EG K   +L      +LYR+L +HYNRNN I VP+ F  VV+ TL EF+ AI  GKD EQSWKK IYK I+R+D   P YFK+PN+  +
Sbjct: 1401 LTPMHLRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAVTEGIKTPDDLLIAGDSELYRVLNLHYNRNNHIEVPQNFRFVVEQTLREFFRAIQGGKDTEQSWKKSIYKIISRMDDPVPEYFKSPNFLEQ 1554          
BLAST of Homeobox protein prospero vs. UniProt/SwissProt
Match: sp|P29617|PROS_DROME (Homeobox protein prospero OS=Drosophila melanogaster OX=7227 GN=pros PE=1 SV=3)

HSP 1 Score: 201.83 bits (512), Expect = 5.757e-59
Identity = 97/154 (62.99%), Postives = 117/154 (75.97%), Query Frame = 3
Query:   87 LGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEG-KLFGELDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWFTK 545
            L P HLRKAKLMFF+ RYPSS+ LK  FPDIKF K+NTAQLVKWFSNFREFYYIQ+EK+ARQ ++EG K   +L      +LYR+L +HYNRNN I VP+ F  VV++TL EF+ AI  GKD EQSWKK IYK I+R+D   P YFK+PN+  +
Sbjct: 1548 LTPMHLRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAVTEGIKTPDDLLIAGDSELYRVLNLHYNRNNHIEVPQNFRFVVESTLREFFRAIQGGKDTEQSWKKSIYKIISRMDDPVPEYFKSPNFLEQ 1701          
BLAST of Homeobox protein prospero vs. UniProt/SwissProt
Match: sp|P34522|PROS1_CAEEL (Homeobox protein prospero homolog 1 OS=Caenorhabditis elegans OX=6239 GN=pros-1 PE=2 SV=2)

HSP 1 Score: 189.889 bits (481), Expect = 2.739e-56
Identity = 96/169 (56.80%), Postives = 115/169 (68.05%), Query Frame = 3
Query:   45 LDLSDYHAGQQFKVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFGELDKLMHED--LYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWFTK 545
            L    Y  G    +L P HLRKAKLMFFYTRYP+S+ LKS FPDI+F K+NTAQLVKWFSNFREFYY Q+EKFARQ L+EG +    D  + +D  L+++L  HYNRNN I  P     VV+ TL EF+ AI  GKD E SWKK IYK I RL+   P +FK PN+  +
Sbjct:  424 LSECGYEGGGSSSMLTPMHLRKAKLMFFYTRYPNSNLLKSYFPDIRFNKNNTAQLVKWFSNFREFYYNQMEKFARQALAEG-ITDRNDIFVSKDSELFKVLNTHYNRNNHIKAPDRLVFVVQETLREFHDAIKQGKDIEPSWKKTIYKVINRLEDQIPDFFKEPNFLER 591          
BLAST of Homeobox protein prospero vs. UniProt/SwissProt
Match: sp|P48437|PROX1_MOUSE (Prospero homeobox protein 1 OS=Mus musculus OX=10090 GN=Prox1 PE=1 SV=2)

HSP 1 Score: 181.03 bits (458), Expect = 3.448e-52
Identity = 89/176 (50.57%), Postives = 118/176 (67.05%), Query Frame = 3
Query:   15 KAYSKALRSNLDLSDYHAGQQFKVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFGELDKLMHE-DLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWF 539
            K+    L+   D+S Y      + L PNHL+KAKLMFFYTRYPSS+ LK+ F D+KF +  T+QL+KWFSNFREFYYIQ+EK+ARQ +++G    E   +  + +LYR L +HYN+ N   VP+ F  V + TL EF+ AI +GKD + SWKK IYK I +LD + P  FK+PN  
Sbjct:  556 KSECGDLQDMSDISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCL 731          
BLAST of Homeobox protein prospero vs. UniProt/SwissProt
Match: sp|Q92786|PROX1_HUMAN (Prospero homeobox protein 1 OS=Homo sapiens OX=9606 GN=PROX1 PE=1 SV=2)

HSP 1 Score: 178.718 bits (452), Expect = 1.879e-51
Identity = 88/176 (50.00%), Postives = 118/176 (67.05%), Query Frame = 3
Query:   15 KAYSKALRSNLDLSDYHAGQQFKVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFGELDKLMHE-DLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWF 539
            K+    L+   ++S Y      + L PNHL+KAKLMFFYTRYPSS+ LK+ F D+KF +  T+QL+KWFSNFREFYYIQ+EK+ARQ +++G    E   +  + +LYR L +HYN+ N   VP+ F  V + TL EF+ AI +GKD + SWKK IYK I +LD + P  FK+PN  
Sbjct:  556 KSECGDLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCL 731          
BLAST of Homeobox protein prospero vs. TrEMBL
Match: C3W8S4 (Prospero related homeodomain protein (Fragment) OS=Platynereis dumerilii OX=6359 GN=prox PE=2 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 4.284e-65
Identity = 102/168 (60.71%), Postives = 121/168 (72.02%), Query Frame = 3
Query:   39 SNLDLSDYHAGQQFKVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFGE-LDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWF 539
             +LD S Y   Q    L P HLRKAKLMFFY RYPSS+ +K  FPD+KF K+NTAQLVKWFSNFREFYYIQ+EK++RQ L+EG    E L      +LYR+L +HYNRNNQI VP+ F  VV+ TL EF+ AI +GKD EQSWKK IYK I R+D   P YF++PNW 
Sbjct:   11 GSLDDSGYDGMQVTSTLTPMHLRKAKLMFFYVRYPSSAIIKMYFPDVKFNKNNTAQLVKWFSNFREFYYIQMEKYSRQALAEGMKNAEDLVVTTESELYRVLNLHYNRNNQIEVPESFLGVVEQTLREFFKAIQAGKDTEQSWKKAIYKVIGRMDDQIPEYFQSPNWM 178          
BLAST of Homeobox protein prospero vs. TrEMBL
Match: K1RD84 (Homeobox protein prospero OS=Crassostrea gigas OX=29159 GN=CGI_10022026 PE=4 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 2.719e-64
Identity = 98/151 (64.90%), Postives = 115/151 (76.16%), Query Frame = 3
Query:   87 LGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEG-KLFGELDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNW 536
            L P HLRKAKLMFFY RYPSS+ LK  FPD+KF K+NTAQLVKWFSNFREFYYIQ+EK+ARQ ++EG K   +L      +LYR+L +HYNRNNQI VP  F +VV+ TL EFY +I + KD E SWKK IYK IAR+D   P YFK+PNW
Sbjct:   25 LTPMHLRKAKLMFFYVRYPSSAILKVYFPDVKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAIAEGCKSIDDLVVTTESELYRVLNLHYNRNNQIEVPDNFRIVVQATLREFYKSIVACKDSEPSWKKAIYKVIARMDDSLPEYFKSPNW 175          
BLAST of Homeobox protein prospero vs. TrEMBL
Match: R7VCI3 (Prospero OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_2449 PE=2 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 7.165e-64
Identity = 100/156 (64.10%), Postives = 120/156 (76.92%), Query Frame = 3
Query:   99 HLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFGELDKLM---HEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWFTKSSNS 557
            HLRKAKLMFFYTRYPSSS LK  FPD++F K+NTAQLVKWFSNFREFYYIQ+EK+ARQ L+EG    E D ++     +++R+L +HYNRNNQI VP+ F  VV+ TL EFY +I S KD+EQSWKK IYK IARLD   P YFK+PNW  + + S
Sbjct:    2 HLRKAKLMFFYTRYPSSSILKIYFPDVRFNKNNTAQLVKWFSNFREFYYIQMEKYARQALAEG--VKETDDIVVTADSEIFRVLNLHYNRNNQIEVPENFKAVVQQTLREFYKSISSQKDQEQSWKKAIYKIIARLDDALPEYFKSPNWMEQLNES 155          
BLAST of Homeobox protein prospero vs. TrEMBL
Match: V3ZWV3 (Prospero domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_183824 PE=4 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 7.901e-64
Identity = 99/158 (62.66%), Postives = 117/158 (74.05%), Query Frame = 3
Query:   84 VLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEG-KLFGELDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWFTKSSN 554
            +L P HLRKAKLMFFY RYPSSS LK  FPDIKF K+NTAQLVKWFSNFREF+YIQ+EK+ARQ L+EG K   EL      +L+R+L +HYNRNNQ+ VP  F    + +L EF+ +I SGKD E SWKK IYK IARLD+  P YFK+PNW  +  N
Sbjct:    1 MLSPMHLRKAKLMFFYVRYPSSSILKVYFPDIKFNKNNTAQLVKWFSNFREFFYIQMEKYARQALAEGCKHPEELHVSTDSELFRVLTLHYNRNNQLEVPDSFRRCAQCSLREFFRSIISGKDAEPSWKKAIYKVIARLDESLPEYFKSPNWMEQLEN 158          
BLAST of Homeobox protein prospero vs. TrEMBL
Match: A0A183AEI2 (Prospero domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS5367 PE=4 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 1.713e-63
Identity = 97/163 (59.51%), Postives = 123/163 (75.46%), Query Frame = 3
Query:   72 QQFKVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEG-KLFGELDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWFTKSSNS 557
            +++  L P HLRKAKLMFFYTRYP+S+ +K  FPD+KF K+NTAQLVKWFSNFREFYYIQ+EKFAR  +SEG +   E+      +LYR L +HYNRN Q+ VP+ F +VV+ TL EF+ A+ +GKD EQSWKK IYK IAR+DQ  P +FKNPNW  + ++ 
Sbjct:    8 KRYYTLTPVHLRKAKLMFFYTRYPNSTLIKMYFPDVKFYKNNTAQLVKWFSNFREFYYIQMEKFARVAISEGVRSAEEIHVTTDSELYRALNLHYNRNQQLEVPEHFRIVVEATLREFFNALMTGKDAEQSWKKPIYKIIARMDQPVPEFFKNPNWMEQLADG 170          
BLAST of Homeobox protein prospero vs. Ensembl Cavefish
Match: prox1a (prospero homeobox protein 1 [Source:NCBI gene;Acc:103040734])

HSP 1 Score: 179.874 bits (455), Expect = 9.710e-53
Identity = 91/177 (51.41%), Postives = 119/177 (67.23%), Query Frame = 3
Query:   15 KAYSKALRSNLDLSDYHAGQQFKVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFGELDKLMHED--LYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWF 539
            K+    L+   D+S Y      + L PNHL+KAKLMFFYTRYPSS+ LK  F D+KF +  T+QL+KWFSNFREFYYIQ+EKFARQ +++G + G  +  +  D  LYR L +HYN+ N   VP+ F  V + TL+EF+ AI +GKD + SWKK IYK I +LD + P  FK+PN  
Sbjct:  559 KSECGDLQDMSDISPYSGSTIQEGLSPNHLKKAKLMFFYTRYPSSNMLKMFFSDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAINDG-VAGSEELTVSRDCELYRALNMHYNKANDFEVPERFLEVAQITLQEFFNAIVAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCL 734          
BLAST of Homeobox protein prospero vs. Ensembl Cavefish
Match: prox2 (prospero homeobox 2 [Source:NCBI gene;Acc:103029539])

HSP 1 Score: 176.022 bits (445), Expect = 1.360e-51
Identity = 84/152 (55.26%), Postives = 106/152 (69.74%), Query Frame = 3
Query:   87 LGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEG-KLFGELDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWF 539
            L PNHL+KAKLMFFYTRYPSS+ LK+ FPD+KF +  T+QL+KWFSNFREFYYIQ+EKFARQ + +G     ++      +L+R L +HYN+ N   VP  F  V + TL EFY AI   KD + SWKK IYK I +LD D P  FK+P++ 
Sbjct:  516 LTPNHLKKAKLMFFYTRYPSSNVLKTFFPDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAIVDGVSDVKDMAVTRDSELFRALNMHYNKANDFQVPDRFLEVAEITLHEFYNAISLNKDSDPSWKKAIYKVICKLDSDVPEEFKSPSYL 667          
BLAST of Homeobox protein prospero vs. Ensembl Cavefish
Match: ENSAMXT00000012572.2 (prospero homeobox protein 1-like [Source:NCBI gene;Acc:103022569])

HSP 1 Score: 175.637 bits (444), Expect = 5.027e-51
Identity = 87/163 (53.37%), Postives = 112/163 (68.71%), Query Frame = 3
Query:   48 DLSDYHAGQQFKVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFG-ELDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPN 533
            D+S Y      + L PNHL+KAKLMFFYTRYPSS+ LK  F D+KF +  T+QL+KWFSNFREFYYIQ+EKFARQ +++G     E+      +L+R L +HYN+ N   VP+ F  V + TL EF+ AI +GKD + SWKK IYK I +LD + P  FK+PN
Sbjct:  614 DISPYSGSTIQEGLSPNHLKKAKLMFFYTRYPSSNMLKMFFSDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAINDGVTGADEISVSRDSELFRALNMHYNKANDFEVPERFLEVAQITLREFFNAIVAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPN 776          
BLAST of Homeobox protein prospero vs. Ensembl Cavefish
Match: prox3 (prospero homeobox protein 1-like [Source:NCBI gene;Acc:103040122])

HSP 1 Score: 164.466 bits (415), Expect = 2.854e-47
Identity = 82/159 (51.57%), Postives = 108/159 (67.92%), Query Frame = 3
Query:   66 AGQQFKVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFGELDKLM----HEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNP 530
            AG   + L P HL+KAKLMFFYTRYPSS+ LK+ FPD+KF +  T+QL+KWFSNFREF+YIQ+E+FARQ   EG L    D+++    + +L+RIL +HYN++N   VP  F  V +  L EF+ AI  G+D +  WKK IYK I +LD   P  F+ P
Sbjct:  538 AGSSQEGLSPCHLKKAKLMFFYTRYPSSNTLKTYFPDVKFNRCVTSQLIKWFSNFREFFYIQMERFARQAAREG-LPTSRDRVLRLSRNSELFRILNMHYNKSNDYQVPDRFVEVSELALREFFAAIQGGRDTDPCWKKSIYKIICKLDSPVPDSFRLP 695          
BLAST of Homeobox protein prospero vs. Ensembl Cavefish
Match: prox3 (prospero homeobox protein 1-like [Source:NCBI gene;Acc:103040122])

HSP 1 Score: 162.54 bits (410), Expect = 1.235e-46
Identity = 80/152 (52.63%), Postives = 105/152 (69.08%), Query Frame = 3
Query:   87 LGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFGELDKLM----HEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNP 530
            L P HL+KAKLMFFYTRYPSS+ LK+ FPD+KF +  T+QL+KWFSNFREF+YIQ+E+FARQ   EG L    D+++    + +L+RIL +HYN++N   VP  F  V +  L EF+ AI  G+D +  WKK IYK I +LD   P  F+ P
Sbjct:  519 LSPCHLKKAKLMFFYTRYPSSNTLKTYFPDVKFNRCVTSQLIKWFSNFREFFYIQMERFARQAAREG-LPTSRDRVLRLSRNSELFRILNMHYNKSNDYQVPDRFVEVSELALREFFAAIQGGRDTDPCWKKSIYKIICKLDSPVPDSFRLP 669          
BLAST of Homeobox protein prospero vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007312.1 (pep scaffold:Pmarinus_7.0:GL481361:690:12474:1 gene:ENSPMAG00000006606.1 transcript:ENSPMAT00000007312.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.013 bits (297), Expect = 1.992e-35
Identity = 57/102 (55.88%), Postives = 72/102 (70.59%), Query Frame = 3
Query:   87 LGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFG-ELDKLMHEDLYRILVIHYNRNNQIMVPKEF 389
            L P HL+KAKLMF+Y+RYPSS+ LK  FPD+KF +  T+QL+KWFSNFREFYYIQ+EKFAR  L++G     EL      +L+R L +HYN+ N   V   F
Sbjct:    4 LTPGHLKKAKLMFYYSRYPSSTMLKIYFPDVKFNRCITSQLIKWFSNFREFYYIQMEKFARAALADGVTSAEELTVTRDSELFRALNVHYNKANDFQVRSCF 105          
BLAST of Homeobox protein prospero vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007316.1 (pep scaffold:Pmarinus_7.0:GL481361:12253:13226:1 gene:ENSPMAG00000006606.1 transcript:ENSPMAT00000007316.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.0182 bits (175), Expect = 5.494e-17
Identity = 33/67 (49.25%), Postives = 45/67 (67.16%), Query Frame = 3
Query:  180 KFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFG-ELDKLMHEDLYRILVIHYNRNNQIMV 377
            +F +  T+QL+KWFSNFREFYYIQ+EKFAR  L++G     EL      +L+R L +HYN+ N   +
Sbjct:    4 QFNRCITSQLIKWFSNFREFYYIQMEKFARAALADGVTSAEELTVTRDSELFRALNVHYNKANDFQI 70          
BLAST of Homeobox protein prospero vs. Ensembl Medaka
Match: prox1b (prospero-related homeobox protein 1b [Source:NCBI gene;Acc:100302040])

HSP 1 Score: 178.718 bits (452), Expect = 6.697e-52
Identity = 89/168 (52.98%), Postives = 113/168 (67.26%), Query Frame = 3
Query:   33 LRSNLDLSDYHAGQQFKVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFG-ELDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPN 533
            L+   D+S Y      + L PNHL+KAKLMFFYTRYPSS+ LK  F D+KF +  T+QL+KWFSNFREFYYIQ+EKFARQ +++G     EL      +L+R L +HYN+ N   VP  F  V + TL EF+ AI +GKD + SWKK IYK I +LD + P  FK+PN
Sbjct:  707 LQDMADISPYSGSTIQEGLSPNHLKKAKLMFFYTRYPSSNMLKMFFSDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAINDGVTGAEELTVGRDAELFRALNMHYNKANDFEVPDRFLEVAQVTLREFFNAIVAGKDADPSWKKAIYKVICKLDSEVPEVFKSPN 874          
BLAST of Homeobox protein prospero vs. Ensembl Medaka
Match: prox1 (prospero homeobox 1 [Source:NCBI gene;Acc:100302041])

HSP 1 Score: 176.407 bits (446), Expect = 2.843e-51
Identity = 88/171 (51.46%), Postives = 115/171 (67.25%), Query Frame = 3
Query:   24 SKALRSNLDLSDYHAGQQFKVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFGELDKLMHE-DLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPN 533
            S+  +   D+S Y      + L PNHL+KAKLMFFYTRYPSS+ LK  F D+KF +  T+QL+KWFSNFREFYYIQ+EKFARQ +++G    E   +  + +L+R L +HYN+ N   VP  F  V + TL EF+ AI +GKD + SWKK IYK I +LD + P  FK+PN
Sbjct:  642 SEDFQDMADISPYSGSNIQEGLSPNHLKKAKLMFFYTRYPSSNMLKMFFSDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAINDGVTGAEELSVSRDCELFRALNMHYNKANDFEVPDRFLEVAEITLREFFNAIVAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPN 812          
BLAST of Homeobox protein prospero vs. Ensembl Medaka
Match: prox1 (prospero homeobox 1 [Source:NCBI gene;Acc:100302041])

HSP 1 Score: 176.407 bits (446), Expect = 2.928e-51
Identity = 88/171 (51.46%), Postives = 115/171 (67.25%), Query Frame = 3
Query:   24 SKALRSNLDLSDYHAGQQFKVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFGELDKLMHE-DLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPN 533
            S+  +   D+S Y      + L PNHL+KAKLMFFYTRYPSS+ LK  F D+KF +  T+QL+KWFSNFREFYYIQ+EKFARQ +++G    E   +  + +L+R L +HYN+ N   VP  F  V + TL EF+ AI +GKD + SWKK IYK I +LD + P  FK+PN
Sbjct:  642 SEDFQDMADISPYSGSNIQEGLSPNHLKKAKLMFFYTRYPSSNMLKMFFSDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAINDGVTGAEELSVSRDCELFRALNMHYNKANDFEVPDRFLEVAEITLREFFNAIVAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPN 812          
BLAST of Homeobox protein prospero vs. Ensembl Medaka
Match: prox2 (prospero homeobox 2 [Source:NCBI gene;Acc:101167581])

HSP 1 Score: 170.244 bits (430), Expect = 1.024e-49
Identity = 80/147 (54.42%), Postives = 105/147 (71.43%), Query Frame = 3
Query:   87 LGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEG-KLFGELDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFK 524
            L P+HL+KAKLMFFYTRYPSS+ LK+ FPD+KF +  T+QL+KWFSNFREFYYIQ+EKFARQ +++G +   ++      +L+R L +HYN+ N   VP  F  V + TL EFY AI + KD + SWKK IYK I ++D + P  FK
Sbjct:  477 LTPSHLKKAKLMFFYTRYPSSNVLKTYFPDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAIADGIRDVKDITVSRDSELFRALNMHYNKANDFHVPDRFLEVAEITLHEFYNAISASKDSDSSWKKSIYKVICKMDSEVPEEFK 623          
BLAST of Homeobox protein prospero vs. Ensembl Medaka
Match: prox2 (prospero homeobox 2 [Source:NCBI gene;Acc:101167581])

HSP 1 Score: 170.244 bits (430), Expect = 1.424e-49
Identity = 80/147 (54.42%), Postives = 105/147 (71.43%), Query Frame = 3
Query:   87 LGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEG-KLFGELDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFK 524
            L P+HL+KAKLMFFYTRYPSS+ LK+ FPD+KF +  T+QL+KWFSNFREFYYIQ+EKFARQ +++G +   ++      +L+R L +HYN+ N   VP  F  V + TL EFY AI + KD + SWKK IYK I ++D + P  FK
Sbjct:  506 LTPSHLKKAKLMFFYTRYPSSNVLKTYFPDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAIADGIRDVKDITVSRDSELFRALNMHYNKANDFHVPDRFLEVAEITLHEFYNAISASKDSDSSWKKSIYKVICKMDSEVPEEFK 652          
BLAST of Homeobox protein prospero vs. Planmine SMEST
Match: SMESG000012837.1 (SMESG000012837.1)

HSP 1 Score: 378.252 bits (970), Expect = 1.422e-133
Identity = 183/185 (98.92%), Postives = 183/185 (98.92%), Query Frame = 3
Query:    3 NSESKAYSKALRSNLDLSDYHAGQQFKVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFGELDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWFTKSSNS 557
            NSESK YSKALRSNLDLSDYH GQQFKVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFGELDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWFTKSSNS
Sbjct:  174 NSESKVYSKALRSNLDLSDYHTGQQFKVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFGELDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWFTKSSNS 358          
BLAST of Homeobox protein prospero vs. Planmine SMEST
Match: SMESG000035419.1 (SMESG000035419.1)

HSP 1 Score: 173.326 bits (438), Expect = 1.214e-53
Identity = 87/160 (54.37%), Postives = 109/160 (68.12%), Query Frame = 3
Query:   75 QFKVLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFGELDKLMHED--LYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWFTKS 548
            Q + L   HLRKAKLMF Y RYP+SS LK  FPDI F+K++TAQLVKWFSNFREF+YIQ+EK+ R  +   +   E D  +  D  +YR LV HY+R NQI +P  F  V+KTTL  FY AI +G+D++ SWKK IYK IAR+D   P +FK+  W   S
Sbjct:  149 QSRSLTSQHLRKAKLMFLYVRYPNSSILKDFFPDITFDKNSTAQLVKWFSNFREFFYIQLEKYIRTNIINLRFTDENDVKIDMDCEIYRTLVNHYDRTNQIQIPTNFLQVLKTTLWHFYQAIVTGRDRDHSWKKPIYKIIARMDITVPEFFKHTQWLLDS 308          
BLAST of Homeobox protein prospero vs. Planmine SMEST
Match: SMESG000068287.1 (SMESG000068287.1)

HSP 1 Score: 173.711 bits (439), Expect = 3.881e-52
Identity = 85/153 (55.56%), Postives = 109/153 (71.24%), Query Frame = 3
Query:   84 VLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEG-KLFGELDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWF 539
             L P HLRKAKLMF YTRYP+S  LKS FPDI F K NTAQLVKWFSNFREFYY ++EK  ++ +S G +   ++D  +  +L++ L+ H+N+  QI+VP EF   V+ TL EF+ AI +GK+  QSWKK IYK IA+LDQ  P +FK+ NW 
Sbjct:  315 TLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWM 467          
BLAST of Homeobox protein prospero vs. Planmine SMEST
Match: SMESG000068287.1 (SMESG000068287.1)

HSP 1 Score: 174.481 bits (441), Expect = 1.840e-51
Identity = 85/153 (55.56%), Postives = 109/153 (71.24%), Query Frame = 3
Query:   84 VLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEG-KLFGELDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNWF 539
             L P HLRKAKLMF YTRYP+S  LKS FPDI F K NTAQLVKWFSNFREFYY ++EK  ++ +S G +   ++D  +  +L++ L+ H+N+  QI+VP EF   V+ TL EF+ AI +GK+  QSWKK IYK IA+LDQ  P +FK+ NW 
Sbjct:  315 TLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWM 467          
BLAST of Homeobox protein prospero vs. Planmine SMEST
Match: SMESG000032751.1 (SMESG000032751.1)

HSP 1 Score: 170.244 bits (430), Expect = 4.058e-51
Identity = 87/152 (57.24%), Postives = 107/152 (70.39%), Query Frame = 3
Query:   84 VLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEG-KLFGELDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNW 536
             L P HLRKAKLMF YTRYP+S  LK+ FPDI F K NTAQLVKWFSNFREFYY ++EK  ++ +S G K   EL      +L++ L+ H+N+N QI VPKEF + V+ TL EF+ A   GK+  QSWKK IYK IA+LDQ  P +FK+ NW
Sbjct:  280 TLTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNW 431          
The following BLAST results are available for this feature:
BLAST of Homeobox protein prospero vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PROX13.913e-5250.00prospero homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9... [more]
PROX13.913e-5250.00prospero homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9... [more]
PROX13.913e-5250.00prospero homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9... [more]
PROX13.913e-5250.00prospero homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9... [more]
PROX28.572e-4850.99prospero homeobox 2 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of Homeobox protein prospero vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pros-12.154e-5756.80Homeobox protein prospero homolog 1 [Source:UniPr... [more]
back to top
BLAST of Homeobox protein prospero vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pros3.314e-6155.50gene:FBgn0004595 transcript:FBtr0304606[more]
pros3.391e-6155.50gene:FBgn0004595 transcript:FBtr0304604[more]
pros7.377e-6155.50gene:FBgn0004595 transcript:FBtr0304603[more]
pros8.219e-6155.50gene:FBgn0004595 transcript:FBtr0304607[more]
pros5.744e-6062.99gene:FBgn0004595 transcript:FBtr0304608[more]
back to top
BLAST of Homeobox protein prospero vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prox27.914e-5452.94prospero homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-0810... [more]
prox29.398e-5453.22prospero homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-0810... [more]
prox1a6.566e-5251.14prospero homeobox 1a [Source:ZFIN;Acc:ZDB-GENE-980... [more]
prox1a6.566e-5251.14prospero homeobox 1a [Source:ZFIN;Acc:ZDB-GENE-980... [more]
prox38.778e-4751.57prospero homeobox 3 [Source:ZFIN;Acc:ZDB-GENE-0501... [more]
back to top
BLAST of Homeobox protein prospero vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
PROX11.482e-5051.50prospero homeobox 1 [Source:NCBI gene;Acc:10013499... [more]
back to top
BLAST of Homeobox protein prospero vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prox14.930e-5350.57prospero homeobox 1 [Source:MGI Symbol;Acc:MGI:977... [more]
Prox14.930e-5350.57prospero homeobox 1 [Source:MGI Symbol;Acc:MGI:977... [more]
Prox14.930e-5350.57prospero homeobox 1 [Source:MGI Symbol;Acc:MGI:977... [more]
Prox21.112e-5153.29prospero homeobox 2 [Source:MGI Symbol;Acc:MGI:192... [more]
Prox21.112e-5153.29prospero homeobox 2 [Source:MGI Symbol;Acc:MGI:192... [more]
back to top
BLAST of Homeobox protein prospero vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9U6A1|PROS_DROVI2.371e-5962.99Homeobox protein prospero OS=Drosophila virilis OX... [more]
sp|P29617|PROS_DROME5.757e-5962.99Homeobox protein prospero OS=Drosophila melanogast... [more]
sp|P34522|PROS1_CAEEL2.739e-5656.80Homeobox protein prospero homolog 1 OS=Caenorhabdi... [more]
sp|P48437|PROX1_MOUSE3.448e-5250.57Prospero homeobox protein 1 OS=Mus musculus OX=100... [more]
sp|Q92786|PROX1_HUMAN1.879e-5150.00Prospero homeobox protein 1 OS=Homo sapiens OX=960... [more]
back to top
BLAST of Homeobox protein prospero vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C3W8S44.284e-6560.71Prospero related homeodomain protein (Fragment) OS... [more]
K1RD842.719e-6464.90Homeobox protein prospero OS=Crassostrea gigas OX=... [more]
R7VCI37.165e-6464.10Prospero OS=Capitella teleta OX=283909 GN=CAPTEDRA... [more]
V3ZWV37.901e-6462.66Prospero domain-containing protein OS=Lottia gigan... [more]
A0A183AEI21.713e-6359.51Prospero domain-containing protein OS=Echinostoma ... [more]
back to top
BLAST of Homeobox protein prospero vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prox1a9.710e-5351.41prospero homeobox protein 1 [Source:NCBI gene;Acc:... [more]
prox21.360e-5155.26prospero homeobox 2 [Source:NCBI gene;Acc:10302953... [more]
ENSAMXT00000012572.25.027e-5153.37prospero homeobox protein 1-like [Source:NCBI gene... [more]
prox32.854e-4751.57prospero homeobox protein 1-like [Source:NCBI gene... [more]
prox31.235e-4652.63prospero homeobox protein 1-like [Source:NCBI gene... [more]
back to top
BLAST of Homeobox protein prospero vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000007312.11.992e-3555.88pep scaffold:Pmarinus_7.0:GL481361:690:12474:1 gen... [more]
ENSPMAT00000007316.15.494e-1749.25pep scaffold:Pmarinus_7.0:GL481361:12253:13226:1 g... [more]
back to top
BLAST of Homeobox protein prospero vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Homeobox protein prospero vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Homeobox protein prospero vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prox1b6.697e-5252.98prospero-related homeobox protein 1b [Source:NCBI ... [more]
prox12.843e-5151.46prospero homeobox 1 [Source:NCBI gene;Acc:10030204... [more]
prox12.928e-5151.46prospero homeobox 1 [Source:NCBI gene;Acc:10030204... [more]
prox21.024e-4954.42prospero homeobox 2 [Source:NCBI gene;Acc:10116758... [more]
prox21.424e-4954.42prospero homeobox 2 [Source:NCBI gene;Acc:10116758... [more]
back to top
BLAST of Homeobox protein prospero vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000012837.11.422e-13398.92SMESG000012837.1[more]
SMESG000035419.11.214e-5354.38SMESG000035419.1[more]
SMESG000068287.13.881e-5255.56SMESG000068287.1[more]
SMESG000068287.11.840e-5155.56SMESG000068287.1[more]
SMESG000032751.14.058e-5157.24SMESG000032751.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014189 ID=SMED30014189|Name=Homeobox protein prospero|organism=Schmidtea mediterranea sexual|type=transcript|length=558bp
GGAATTCAGAATCGAAGGCCTACAGCAAAGCGTTGCGCAGCAATCTTGAT
CTCTCCGATTATCACGCTGGACAACAATTTAAAGTTCTCGGTCCCAATCA
TTTGAGAAAGGCCAAATTAATGTTTTTCTATACCAGATACCCAAGTTCCT
CGTTCCTCAAATCACAGTTTCCGGATATCAAGTTTGAAAAGTCCAATACA
GCTCAATTAGTGAAGTGGTTTAGTAATTTCAGAGAATTCTATTACATTCA
AATTGAGAAATTCGCCCGGCAGATTTTGAGTGAAGGAAAATTATTTGGGG
AGCTTGATAAACTAATGCACGAGGATCTTTATCGCATTTTAGTAATTCAT
TATAATAGAAACAATCAAATAATGGTACCGAAAGAATTCTCATTGGTGGT
TAAAACTACTCTGGAAGAGTTCTATTTAGCAATTGGAAGCGGCAAAGACA
AAGAGCAGTCATGGAAGAAAGTGATTTACAAAAAGATCGCGAGGCTTGAT
CAGGATACTCCTTCATATTTTAAAAATCCAAATTGGTTCACAAAATCCTC
AAACAGTA
back to top

protein sequence of SMED30014189-orf-1

>SMED30014189-orf-1 ID=SMED30014189-orf-1|Name=SMED30014189-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=185bp
NSESKAYSKALRSNLDLSDYHAGQQFKVLGPNHLRKAKLMFFYTRYPSSS
FLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEGKLFGE
LDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDK
EQSWKKVIYKKIARLDQDTPSYFKNPNWFTKSSNS
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR037131Homeo_prospero_dom_sf
IPR039350Prospero_homeodomain
IPR023082Homeo_prospero_dom
IPR009057Homeobox-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0001078transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding
GO:0003700transcription factor activity, sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0007402ganglion mother cell fate determination
GO:0007405neuroblast proliferation
GO:0007406negative regulation of neuroblast proliferation
GO:0007409axonogenesis
GO:0007411axon guidance
GO:0007416synapse assembly
GO:0007417central nervous system development
GO:0007419ventral cord development
GO:0007420brain development
GO:0007422peripheral nervous system development
GO:0007423sensory organ development
GO:0007465R7 cell fate commitment
GO:0007619courtship behavior
GO:0008049male courtship behavior
GO:0008104protein localization
GO:0008285negative regulation of cell proliferation
GO:0008356asymmetric cell division
GO:0010001glial cell differentiation
GO:0010628positive regulation of gene expression
GO:0010629negative regulation of gene expression
GO:0042673regulation of retinal cone cell fate specification
GO:0042676compound eye cone cell fate commitment
GO:0045165cell fate commitment
GO:0045664regulation of neuron differentiation
GO:0045676regulation of R7 cell differentiation
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0048813dendrite morphogenesis
GO:0050771negative regulation of axonogenesis
GO:0050909sensory perception of taste
GO:0055059asymmetric neuroblast division
GO:0055060asymmetric neuroblast division resulting in ganglion mother cell formation
GO:0060385axonogenesis involved in innervation
GO:0070314G1 to G0 transition
GO:0070983dendrite guidance
GO:1900180regulation of protein localization to nucleus
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0001708cell fate specification
GO:0001754eye photoreceptor cell differentiation
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006909phagocytosis
GO:0007275multicellular organism development
GO:0007399nervous system development
GO:0007400neuroblast fate determination
Vocabulary: cellular component
TermDefinition
GO:0045178basal part of cell
GO:0045179apical cortex
GO:0045180basal cortex
GO:0005634nucleus
GO:0005875microtubule associated complex
GO:0005886plasma membrane
GO:0005938cell cortex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR023082Homeo-prospero domainPFAMPF05044HPDcoord: 29..179
e-value: 3.7E-65
score: 218.5
IPR023082Homeo-prospero domainPROSITEPS51818HOMEO_PROSPEROcoord: 26..183
score: 71.025
IPR037131Homeo-prospero domain superfamilyGENE3DG3DSA:1.10.10.500coord: 15..184
e-value: 2.4E-70
score: 237.5
NoneNo IPR availablePANTHERPTHR12198:SF0HOMEOBOX PROTEIN PROSPEROcoord: 24..179
IPR039350Prospero homeodomain familyPANTHERPTHR12198HOMEOBOX PROTEIN PROSPERO/PROX-1/CEH-26coord: 24..179
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 28..176