Tumor necrosis factor alpha-induced protein 8-like protein

Overview
NameTumor necrosis factor alpha-induced protein 8-like protein
Smed IDSMED30014184
Length (bp)925
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tumor necrosis factor alpha-induced protein 8-like protein (SMED30014184) t-SNE clustered cells

Violin plots show distribution of expression levels for Tumor necrosis factor alpha-induced protein 8-like protein (SMED30014184) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tumor necrosis factor alpha-induced protein 8-like protein (SMED30014184) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tumor necrosis factor alpha-induced protein 8-like protein (SMED30014184) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014184

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30014184SMESG000002914.1 dd_Smed_v4_2386_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30014184SMESG000002914.1 dd_Smed_v4_2386_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014184SMESG000002914.1 dd_Smed_v4_2386_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30014184SMESG000002914.1 dd_Smed_v4_2386_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014184SMESG000002914.1 dd_Smed_v4_2386_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Human
Match: TNFAIP8L1 (TNF alpha induced protein 8 like 1 [Source:HGNC Symbol;Acc:HGNC:28279])

HSP 1 Score: 82.8037 bits (203), Expect = 1.739e-18
Identity = 44/153 (28.76%), Postives = 82/153 (53.59%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLRE-VFGRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIF 571
            ++ L+ QKK LS  A++  +  ++DD ++++L   Y   RE    RKEAQKM    +K+ +K+  L+  ++L GEE+  L   +          +SF +++FTF+   L   L +  +LL   V  H+T K+  ++  +F  ++  +FL  ++
Sbjct:    8 SLALQAQKKLLSKMASKAVVAVLVDDTSSEVLDELYRATREFTRSRKEAQKMLKNLVKVALKLGLLLRGDQLGGEELALLRRFRHRARCLAMTAVSFHQVDFTFDRRVLAAGLLECRDLLHQAVGPHLTAKSHGRINHVFGHLADCDFLAALY 160          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Human
Match: TNFAIP8L1 (TNF alpha induced protein 8 like 1 [Source:HGNC Symbol;Acc:HGNC:28279])

HSP 1 Score: 82.8037 bits (203), Expect = 1.739e-18
Identity = 44/153 (28.76%), Postives = 82/153 (53.59%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLRE-VFGRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIF 571
            ++ L+ QKK LS  A++  +  ++DD ++++L   Y   RE    RKEAQKM    +K+ +K+  L+  ++L GEE+  L   +          +SF +++FTF+   L   L +  +LL   V  H+T K+  ++  +F  ++  +FL  ++
Sbjct:    8 SLALQAQKKLLSKMASKAVVAVLVDDTSSEVLDELYRATREFTRSRKEAQKMLKNLVKVALKLGLLLRGDQLGGEELALLRRFRHRARCLAMTAVSFHQVDFTFDRRVLAAGLLECRDLLHQAVGPHLTAKSHGRINHVFGHLADCDFLAALY 160          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Human
Match: TNFAIP8L3 (TNF alpha induced protein 8 like 3 [Source:HGNC Symbol;Acc:HGNC:20620])

HSP 1 Score: 82.4185 bits (202), Expect = 4.271e-18
Identity = 44/166 (26.51%), Postives = 92/166 (55.42%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLRE-VFGRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIFTCGKNSKLGLAMI 610
            ++ L+ QKK LS  A++     ++DD ++++    Y + +E    +KEA K+    IK+ +KI  L   N+ + EE+  +++ + +   T   I+SF+E+E+TF+ + L   L + ++L+  +V  H+T +   ++  +FN  +  EFL+ +++   + +  L  I
Sbjct:   26 SLALQAQKKILSKIASKTVANMLIDDTSSEIFDELYKVTKEHTHNKKEAHKIMKDLIKVAIKIGILYRNNQFSQEELVIVEKFRKKLNQTAMTIVSFYEVEYTFDRNVLSNLLHECKDLVHELVQRHLTPRTHGRINHVFNHFADVEFLSTLYSLDGDCRPNLKRI 191          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Human
Match: TNFAIP8L3 (TNF alpha induced protein 8 like 3 [Source:HGNC Symbol;Acc:HGNC:20620])

HSP 1 Score: 81.2629 bits (199), Expect = 4.105e-17
Identity = 44/166 (26.51%), Postives = 92/166 (55.42%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLRE-VFGRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIFTCGKNSKLGLAMI 610
            ++ L+ QKK LS  A++     ++DD ++++    Y + +E    +KEA K+    IK+ +KI  L   N+ + EE+  +++ + +   T   I+SF+E+E+TF+ + L   L + ++L+  +V  H+T +   ++  +FN  +  EFL+ +++   + +  L  I
Sbjct:  114 SLALQAQKKILSKIASKTVANMLIDDTSSEIFDELYKVTKEHTHNKKEAHKIMKDLIKVAIKIGILYRNNQFSQEELVIVEKFRKKLNQTAMTIVSFYEVEYTFDRNVLSNLLHECKDLVHELVQRHLTPRTHGRINHVFNHFADVEFLSTLYSLDGDCRPNLKRI 279          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Human
Match: TNFAIP8L3 (TNF alpha induced protein 8 like 3 [Source:HGNC Symbol;Acc:HGNC:20620])

HSP 1 Score: 71.633 bits (174), Expect = 1.234e-14
Identity = 37/144 (25.69%), Postives = 80/144 (55.56%), Query Frame = 2
Query:  182 ILDDDANKLLTSAYHLLRE-VFGRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIFTCGKNSKLGLAMI 610
            ++DD ++++    Y + +E    +KEA K+    IK+ +KI  L   N+ + EE+  +++ + +   T   I+SF+E+E+TF+ + L   L + ++L+  +V  H+T +   ++  +FN  +  EFL+ +++   + +  L  I
Sbjct:    2 LIDDTSSEIFDELYKVTKEHTHNKKEAHKIMKDLIKVAIKIGILYRNNQFSQEELVIVEKFRKKLNQTAMTIVSFYEVEYTFDRNVLSNLLHECKDLVHELVQRHLTPRTHGRINHVFNHFADVEFLSTLYSLDGDCRPNLKRI 145          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Fly
Match: sigmar (gene:FBgn0034894 transcript:FBtr0072096)

HSP 1 Score: 68.1662 bits (165), Expect = 2.217e-13
Identity = 51/153 (33.33%), Postives = 85/153 (55.56%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLREVFGRK-EAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIF 571
            +I LR QKK LS  A +      +D     LL + Y L +   G K +A+K+    IKI++KI  L   N+ + EE++K +  + +F  T   I+SF+E++FTF+  +LQ+ + + +  L SIV  H+TEK+  ++  +F+   +E  L   F
Sbjct:   10 DIGLRAQKKILSRMATKNIAKTFIDGTTASLLDNLYRLCKMHTGNKAKAEKLIKNIIKIVIKIGVLHRNNQFSDEELQKAELFKRKFQNTQLSIISFYEVDFTFDLPYLQKSIAESQVALKSIVQPHLTEKSLGRIDEVFDFFGEEALLETAF 162          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Fly
Match: sigmar (gene:FBgn0034894 transcript:FBtr0072098)

HSP 1 Score: 68.1662 bits (165), Expect = 2.217e-13
Identity = 51/153 (33.33%), Postives = 85/153 (55.56%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLREVFGRK-EAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIF 571
            +I LR QKK LS  A +      +D     LL + Y L +   G K +A+K+    IKI++KI  L   N+ + EE++K +  + +F  T   I+SF+E++FTF+  +LQ+ + + +  L SIV  H+TEK+  ++  +F+   +E  L   F
Sbjct:   10 DIGLRAQKKILSRMATKNIAKTFIDGTTASLLDNLYRLCKMHTGNKAKAEKLIKNIIKIVIKIGVLHRNNQFSDEELQKAELFKRKFQNTQLSIISFYEVDFTFDLPYLQKSIAESQVALKSIVQPHLTEKSLGRIDEVFDFFGEEALLETAF 162          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Fly
Match: sigmar (gene:FBgn0034894 transcript:FBtr0072097)

HSP 1 Score: 68.1662 bits (165), Expect = 3.329e-13
Identity = 51/153 (33.33%), Postives = 85/153 (55.56%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLREVFGRK-EAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIF 571
            +I LR QKK LS  A +      +D     LL + Y L +   G K +A+K+    IKI++KI  L   N+ + EE++K +  + +F  T   I+SF+E++FTF+  +LQ+ + + +  L SIV  H+TEK+  ++  +F+   +E  L   F
Sbjct:   32 DIGLRAQKKILSRMATKNIAKTFIDGTTASLLDNLYRLCKMHTGNKAKAEKLIKNIIKIVIKIGVLHRNNQFSDEELQKAELFKRKFQNTQLSIISFYEVDFTFDLPYLQKSIAESQVALKSIVQPHLTEKSLGRIDEVFDFFGEEALLETAF 184          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Zebrafish
Match: tnfaip8l2b (tumor necrosis factor, alpha-induced protein 8-like 2b [Source:NCBI gene;Acc:393345])

HSP 1 Score: 88.1965 bits (217), Expect = 1.215e-20
Identity = 49/153 (32.03%), Postives = 85/153 (55.56%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLREVFG-RKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIF 571
            ++ L+ QKK LS  A +  +  I+DD ++++L   Y + +E  G R EAQK+    IK++VKI  L   N  N EE+K     Q +        +SF E++FTF+ + + + L +  ++L  +VN H+T K+  ++  +FN  +  E LT ++
Sbjct:    8 DMALKAQKKILSKMATKSMVQMIIDDTSSEILDELYRVSKEYTGNRSEAQKVVKDLIKVVVKIGVLFRHNRFNEEELKLAQNFQKKLRQGAMTAISFHEVDFTFDKTVMSDILTESRDMLLKLVNTHLTTKSHGRINHVFNHYADPELLTQLY 160          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Zebrafish
Match: tnfaip8l2b (tumor necrosis factor, alpha-induced protein 8-like 2b [Source:NCBI gene;Acc:393345])

HSP 1 Score: 88.1965 bits (217), Expect = 1.215e-20
Identity = 49/153 (32.03%), Postives = 85/153 (55.56%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLREVFG-RKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIF 571
            ++ L+ QKK LS  A +  +  I+DD ++++L   Y + +E  G R EAQK+    IK++VKI  L   N  N EE+K     Q +        +SF E++FTF+ + + + L +  ++L  +VN H+T K+  ++  +FN  +  E LT ++
Sbjct:    8 DMALKAQKKILSKMATKSMVQMIIDDTSSEILDELYRVSKEYTGNRSEAQKVVKDLIKVVVKIGVLFRHNRFNEEELKLAQNFQKKLRQGAMTAISFHEVDFTFDKTVMSDILTESRDMLLKLVNTHLTTKSHGRINHVFNHYADPELLTQLY 160          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Zebrafish
Match: CR407586.1 (pep chromosome:GRCz11:CHR_ALT_CTG18_1_44:39521878:39524417:-1 gene:ENSDARG00000111865.1 transcript:ENSDART00000187129.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR407586.1)

HSP 1 Score: 80.8777 bits (198), Expect = 7.535e-18
Identity = 47/166 (28.31%), Postives = 90/166 (54.22%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLREVF-GRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIFTCGKNSKLGLAMI 610
            ++ L+ QKK LS  A       + DD ++++L   Y   RE    +KEA K+    IKI +KI  L   ++ + EE++ ++  + +       ++SF+E+E+TF+   L E L +  +LL  +V +H+T ++  ++  +FN  +  +FLT ++   ++ +L L  I
Sbjct:   16 SLALQAQKKILSKMATMAVANLLTDDTSSEILDELYKASREYTKSKKEAHKIIKDVIKIALKIGILYRNHQFSPEEMETVERFKKKMNQAAMTVVSFYEVEYTFDRGILSELLLECRDLLHELVEHHLTMRSHGRIDHVFNHFADVDFLTELYGPSEDYRLNLRKI 181          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Zebrafish
Match: tnfaip8l2a (tumor necrosis factor, alpha-induced protein 8-like 2a [Source:NCBI gene;Acc:723996])

HSP 1 Score: 80.8777 bits (198), Expect = 7.636e-18
Identity = 48/158 (30.38%), Postives = 84/158 (53.16%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLREVFG-RKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIFTCGKN 586
            ++ ++ QKK LS  A++      +DD+++++L   Y + +E  G R EAQK+    IKI VK+  L    + + EE+    E + +        +SF E+EFTF+ S +   L    +LL  +V  H+T K+  +++ +FN  S  E LT+++    N
Sbjct:    8 DMAMQAQKKILSRMASKSVAQMFIDDNSSEVLDELYRVSKEHSGNRAEAQKVVKNMIKIAVKVGVLFRHEKFSAEELSIAQEFRKKLHHGAMTAISFQEVEFTFDKSVMINLLSDCRDLLLKLVEKHLTPKSLDRIRHVFNHYSNPELLTHLYDPQGN 165          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Zebrafish
Match: tnfaip8l1 (tumor necrosis factor, alpha-induced protein 8-like 1 [Source:NCBI gene;Acc:393303])

HSP 1 Score: 80.4925 bits (197), Expect = 8.712e-18
Identity = 44/153 (28.76%), Postives = 82/153 (53.59%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLRE-VFGRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIF 571
            N+ L+ QKK +S  A +      +DD ++++L   Y + +E    RKEAQK+    IK++VK+  L    + N EE+  ++  + +  T     +SF++I+FTF+   +   L     LL   +N H+T K+ +++  +FN  +  +FL  ++
Sbjct:    8 NLALQAQKKLMSKMATKTVANLFIDDTSSEVLDELYRVTKEYTRNRKEAQKIIKNLIKMVVKLGVLYRNGQFNNEELALVERFRKKVHTLAMTAVSFYQIDFTFDRRVMSNLLNDCRELLHQAINRHLTAKSHARINHVFNHFADCDFLATLY 160          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Xenopus
Match: TNFAIP8L3 (TNF alpha induced protein 8 like 3 [Source:NCBI gene;Acc:100494749])

HSP 1 Score: 80.8777 bits (198), Expect = 1.265e-17
Identity = 46/163 (28.22%), Postives = 90/163 (55.21%), Query Frame = 2
Query:  125 LRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLRE-VFGRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIFTCGKNSKLGLAMI 610
            ++ QKK LS  A +     ++DD ++++    + + +E V  +KEA K+    +K+ VK+  L   N+ + EE+K +++ + +        +SF+E+E+TF+ + L   L + + LL  +V  H+T K+ S++  +FN  +  EFLT +++   N +  L  I
Sbjct:   27 VQAQKKILSKMATKTMANMLIDDTSSEIFDELFKVTKEYVKNKKEAHKVLKDLVKVAVKVGILYRNNQFSAEELKIVEKFRKKLNQACMTAISFYEVEYTFDKNVLSGLLHECKTLLHELVQRHLTPKSHSRIDRVFNHFADVEFLTALYSLEGNYRPYLKRI 189          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Xenopus
Match: tnfaip8l2 (TNF alpha induced protein 8 like 2 [Source:NCBI gene;Acc:595002])

HSP 1 Score: 80.1073 bits (196), Expect = 1.717e-17
Identity = 47/153 (30.72%), Postives = 84/153 (54.90%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLREVFGRK-EAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIF 571
            ++ L+ QKK LS  A++  +   +D+ ++++L   Y + +E    K E+QK+    IKI VKI  L   N  + EE+    + +S+        +SF+E+EFTFE   L + L + +NLL  +V  H+T K+  +++ +FN  +  E L  ++
Sbjct:    8 DLALQAQKKILSRMASKSMVNMFIDETSSEILDELYRVSKEYTKNKSESQKVIKNLIKIAVKIGVLFRHNRFSPEELVLAQDFKSKLHNGAMTAISFYEVEFTFEKDVLPDILMECKNLLLRLVEKHLTPKSHGRIQHVFNHFADPEMLCQLY 160          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Xenopus
Match: tnfaip8l2 (TNF alpha induced protein 8 like 2 [Source:NCBI gene;Acc:595002])

HSP 1 Score: 80.1073 bits (196), Expect = 4.969e-17
Identity = 47/153 (30.72%), Postives = 84/153 (54.90%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLREVFGRK-EAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIF 571
            ++ L+ QKK LS  A++  +   +D+ ++++L   Y + +E    K E+QK+    IKI VKI  L   N  + EE+    + +S+        +SF+E+EFTFE   L + L + +NLL  +V  H+T K+  +++ +FN  +  E L  ++
Sbjct:   66 DLALQAQKKILSRMASKSMVNMFIDETSSEILDELYRVSKEYTKNKSESQKVIKNLIKIAVKIGVLFRHNRFSPEELVLAQDFKSKLHNGAMTAISFYEVEFTFEKDVLPDILMECKNLLLRLVEKHLTPKSHGRIQHVFNHFADPEMLCQLY 218          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Xenopus
Match: tnfaip8 (TNF alpha induced protein 8 [Source:NCBI gene;Acc:549938])

HSP 1 Score: 77.0258 bits (188), Expect = 2.429e-16
Identity = 43/154 (27.92%), Postives = 86/154 (55.84%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLG-PILDDDANKLLTSAYHLLREVF-GRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIF 571
            N+ ++ QKK L   A+ K +   ++DD + ++L   Y L RE    +KE++K+    IK ++K+  L   N+ N EEI  +++ + +       ++SF+++E+TF+ + L + L +   LL  ++  H+T K+  ++  +F+  S  EFL  ++
Sbjct:   10 NLAVQAQKKILGKMASSKYIATSLIDDTSGEVLDELYQLTREYTQSKKESEKVIKNLIKTVIKLAVLYRNNQFNEEEIALMEKFKRKVHQLAMTVVSFYQVEYTFDRNVLSKLLNECRELLHQVIQRHLTAKSHGRVNNVFDHFSNCEFLAALY 163          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Xenopus
Match: tnfaip8 (TNF alpha induced protein 8 [Source:NCBI gene;Acc:549938])

HSP 1 Score: 77.0258 bits (188), Expect = 2.849e-16
Identity = 43/154 (27.92%), Postives = 86/154 (55.84%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLG-PILDDDANKLLTSAYHLLREVF-GRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIF 571
            N+ ++ QKK L   A+ K +   ++DD + ++L   Y L RE    +KE++K+    IK ++K+  L   N+ N EEI  +++ + +       ++SF+++E+TF+ + L + L +   LL  ++  H+T K+  ++  +F+  S  EFL  ++
Sbjct:   20 NLAVQAQKKILGKMASSKYIATSLIDDTSGEVLDELYQLTREYTQSKKESEKVIKNLIKTVIKLAVLYRNNQFNEEEIALMEKFKRKVHQLAMTVVSFYQVEYTFDRNVLSKLLNECRELLHQVIQRHLTAKSHGRVNNVFDHFSNCEFLAALY 173          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Mouse
Match: Tnfaip8l3 (tumor necrosis factor, alpha-induced protein 8-like 3 [Source:MGI Symbol;Acc:MGI:2685363])

HSP 1 Score: 80.4925 bits (197), Expect = 1.571e-17
Identity = 43/166 (25.90%), Postives = 91/166 (54.82%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLR-EVFGRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIFTCGKNSKLGLAMI 610
            N+ L+ QKK LS  A++     ++DD ++++    Y +       +KEA K+    IK+ +KI  L    + + EE+  +++++ +   T   ++SF+E+E+TF+++ L + L + ++L+  +V  H+T +   ++  +FN  +  EFL+ ++    N +  L  I
Sbjct:   26 NLALQAQKKILSKIASKTVANMLIDDTSSEIFDELYKVTEIHTHNKKEAHKIMKDAIKVAIKIGILYRNKQFSQEEVIIVEKLRKKLNQTAMTMVSFYEVEYTFDTNVLSKLLHECKDLVHELVQRHLTPRTHGRINHVFNHFADVEFLSTLYGPHGNCRPNLKRI 191          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Mouse
Match: Tnfaip8l1 (tumor necrosis factor, alpha-induced protein 8-like 1 [Source:MGI Symbol;Acc:MGI:1913693])

HSP 1 Score: 77.411 bits (189), Expect = 1.344e-16
Identity = 42/166 (25.30%), Postives = 88/166 (53.01%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLRE-VFGRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIFTCGKNSKLGLAMI 610
            ++ L+ QKK LS  A++  +   +D+ ++++L   Y   +E    RKEAQ++    +K+ VK+  L+ A++L+  E+ +L   +    +     LSF +++FTF+   L   L +  +LL   +  H+T K+  ++  +F+  +  +FL  +++  +  +  L  I
Sbjct:    8 SLALQAQKKVLSKMASKAMVAVFVDNTSSEVLDELYQATKEFTRSRKEAQRVVKNLVKVAVKLAVLLRADQLDSNELAQLQRFRGRVRSLAMTALSFHQVDFTFDRRVLATGLLECRDLLHQAIGPHLTAKSHGRINHIFSHFANGDFLAALYSPAEPYRSHLCRI 173          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Mouse
Match: Tnfaip8l2 (tumor necrosis factor, alpha-induced protein 8-like 2 [Source:MGI Symbol;Acc:MGI:1917019])

HSP 1 Score: 70.0922 bits (170), Expect = 6.040e-14
Identity = 44/181 (24.31%), Postives = 87/181 (48.07%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLRE-VFGRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIFTCGKNSKLGLAMIEFTDNLKSLANNNKF 655
            ++ L+ +KK LS  A R      +D+ ++++L   Y + +E    R +AQ++    IK+ VK+  L  +      E+      + +        LSF E++FTFE++ L   L +  ++L  +V +H+T K+  +++ +F+  S  + L  ++       LG    +  D L+ L +  K 
Sbjct:    8 SLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPKAQRVIKDLIKVAVKVAVLHRSGCFGPGELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLVECRDILLELVEHHLTPKSHDRIRHVFDHYSDPDLLAALYGPDFTQHLG----KICDGLRKLLDEGKL 184          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Mouse
Match: Tnfaip8 (tumor necrosis factor, alpha-induced protein 8 [Source:MGI Symbol;Acc:MGI:2147191])

HSP 1 Score: 68.5514 bits (166), Expect = 1.481e-13
Identity = 37/153 (24.18%), Postives = 83/153 (54.25%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLREVF-GRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIF 571
            N+ ++ QKK L    ++     ++DD ++++L   Y + +E    +KEA+++    IK ++K+  L   N+ N +E+  +++ + +       ++SF ++E+TF+ + L   L +   LL  I+  H+T K+  ++  +F+  S  +FL  ++
Sbjct:   14 NLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTKEYTQNKKEAERVIKNLIKTVIKLAVLHRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVEYTFDRNVLSRLLNECRELLHEIIQRHLTAKSHGRVNNVFDHFSDCDFLAALY 166          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Mouse
Match: Tnfaip8 (tumor necrosis factor, alpha-induced protein 8 [Source:MGI Symbol;Acc:MGI:2147191])

HSP 1 Score: 68.9366 bits (167), Expect = 1.638e-13
Identity = 37/153 (24.18%), Postives = 83/153 (54.25%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLREVF-GRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIF 571
            N+ ++ QKK L    ++     ++DD ++++L   Y + +E    +KEA+++    IK ++K+  L   N+ N +E+  +++ + +       ++SF ++E+TF+ + L   L +   LL  I+  H+T K+  ++  +F+  S  +FL  ++
Sbjct:   10 NLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTKEYTQNKKEAERVIKNLIKTVIKLAVLHRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVEYTFDRNVLSRLLNECRELLHEIIQRHLTAKSHGRVNNVFDHFSDCDFLAALY 162          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. UniProt/SwissProt
Match: sp|Q7T364|TPL2B_DANRE (Tumor necrosis factor, alpha-induced protein 8-like protein 2 B OS=Danio rerio OX=7955 GN=tnfaip8l2b PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 9.173e-20
Identity = 49/153 (32.03%), Postives = 85/153 (55.56%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLREVFG-RKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIF 571
            ++ L+ QKK LS  A +  +  I+DD ++++L   Y + +E  G R EAQK+    IK++VKI  L   N  N EE+K     Q +        +SF E++FTF+ + + + L +  ++L  +VN H+T K+  ++  +FN  +  E LT ++
Sbjct:    8 DMALKAQKKILSKMATKSMVQMIIDDTSSEILDELYRVSKEYTGNRSEAQKVVKDLIKVVVKIGVLFRHNRFNEEELKLAQNFQKKLRQGAMTAISFHEVDFTFDKTVMSDILTESRDMLLKLVNTHLTTKSHGRINHVFNHYADPELLTQLY 160          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. UniProt/SwissProt
Match: sp|Q8WVP5|TP8L1_HUMAN (Tumor necrosis factor alpha-induced protein 8-like protein 1 OS=Homo sapiens OX=9606 GN=TNFAIP8L1 PE=1 SV=2)

HSP 1 Score: 82.8037 bits (203), Expect = 8.352e-18
Identity = 44/153 (28.76%), Postives = 82/153 (53.59%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLRE-VFGRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIF 571
            ++ L+ QKK LS  A++  +  ++DD ++++L   Y   RE    RKEAQKM    +K+ +K+  L+  ++L GEE+  L   +          +SF +++FTF+   L   L +  +LL   V  H+T K+  ++  +F  ++  +FL  ++
Sbjct:    8 SLALQAQKKLLSKMASKAVVAVLVDDTSSEVLDELYRATREFTRSRKEAQKMLKNLVKVALKLGLLLRGDQLGGEELALLRRFRHRARCLAMTAVSFHQVDFTFDRRVLAAGLLECRDLLHQAVGPHLTAKSHGRINHVFGHLADCDFLAALY 160          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. UniProt/SwissProt
Match: sp|A5PK29|TP8L1_BOVIN (Tumor necrosis factor alpha-induced protein 8-like protein 1 OS=Bos taurus OX=9913 GN=TNFAIP8L1 PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.045e-17
Identity = 43/154 (27.92%), Postives = 82/154 (53.25%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLRE-VFGRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIFT 574
            ++ L+ QKK LS  A+R      +DD ++++L   Y   +E    RKEAQK+    +K+ VK+  L+ A +L  EE+ +L  ++ +        +SF +++FTF+   L   L +  +LL      H+T K+  ++  +F  ++  +FL  +++
Sbjct:    8 SLALQAQKKLLSKMASRAVASAFIDDTSSEVLDELYRATKEFTRSRKEAQKLVKNLVKVAVKLGVLLRAGQLGAEELARLQRLRQQARRLAMTAVSFHQVDFTFDRRVLATTLLECRDLLHQAAGAHLTAKSHGRINHVFGHLADCDFLAALYS 161          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. UniProt/SwissProt
Match: sp|Q5ZJU8|TP8L1_CHICK (Tumor necrosis factor alpha-induced protein 8-like protein 1 OS=Gallus gallus OX=9031 GN=TNFAIP8L1 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 5.208e-17
Identity = 48/166 (28.92%), Postives = 89/166 (53.61%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLRE-VFGRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIFTCGKNSKLGLAMI 610
            N+ L+ QKK LS  A++      +DD ++++L   Y   +E    RKEAQK+    IKI++K+  L    + + EE+  ++  + +  T     +SF +I+FTF+   +   L +  +LL   V++H+T K+ S++  +FN  +  EFL+ ++   +  +  L  I
Sbjct:    8 NLALQAQKKLLSKMASKTVANVFIDDTSSEILDELYRATKEYTHNRKEAQKIIKNLIKIVMKLGVLYRNGQFSPEELLVMERFRKKVHTLAMTAVSFHQIDFTFDRRVVSSVLTECRDLLHQAVSSHLTAKSHSRINHVFNHFADYEFLSALYGPAEPYRTHLKRI 173          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. UniProt/SwissProt
Match: sp|Q1ECV8|TPL2A_DANRE (Tumor necrosis factor, alpha-induced protein 8-like protein 2 A OS=Danio rerio OX=7955 GN=tnfaip8l2a PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 5.764e-17
Identity = 48/158 (30.38%), Postives = 84/158 (53.16%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLREVFG-RKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIFTCGKN 586
            ++ ++ QKK LS  A++      +DD+++++L   Y + +E  G R EAQK+    IKI VK+  L    + + EE+    E + +        +SF E+EFTF+ S +   L    +LL  +V  H+T K+  +++ +FN  S  E LT+++    N
Sbjct:    8 DMAMQAQKKILSRMASKSVAQMFIDDNSSEVLDELYRVSKEHSGNRAEAQKVVKNMIKIAVKVGVLFRHEKFSAEELSIAQEFRKKLHHGAMTAISFQEVEFTFDKSVMINLLSDCRDLLLKLVEKHLTPKSLDRIRHVFNHYSNPELLTHLYDPQGN 165          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. TrEMBL
Match: A0A4Y7NL64 (EOG090X0GLS OS=Moina brachiata OX=675436 GN=EOG090X0GLS PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 4.027e-21
Identity = 56/181 (30.94%), Postives = 99/181 (54.70%), Query Frame = 2
Query:   95 ANNIDVGNIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLREVF-GRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIFTCGKNSKLGLAMIEFTDNLKS 634
            ++N    +I ++ QKK LS  + +      +DD    LL + Y L +     +KEA+K     IKI+ KI+FL   ++ + EE+ K  + Q++F    K ++SF+E++F+++  +L + L + ++LL  IV  H+TEK+  ++ M+FN  +   FL  IF   KNS     M +   ++ S
Sbjct:    2 SDNFRARDIAMKAQKKILSRMSTKSVAKVFVDDRMGALLDNVYKLCKTYTQNKKEAEKTVKNIIKIVTKISFLARNDQFSKEEMIKARDFQTKFHKAAKTVISFYEVDFSYDQKYLVQLLTECKSLLKQIVQPHLTEKSLGRIDMVFNFFANPSFLDAIF--KKNSDYSDTMTKIISDMHS 180          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. TrEMBL
Match: A0A3M6UXI6 (Uncharacterized protein OS=Pocillopora damicornis OX=46731 GN=pdam_00000031 PE=4 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.012e-20
Identity = 52/175 (29.71%), Postives = 94/175 (53.71%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLR-EVFGRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIFTCGKNSKLGLAMIEFTDNLKSL 637
            ++ LR QKK L   A++      +DD   +LL   Y L + E   +KEA+K+    +KI+VKI+ L   ++LN EEI+  ++ +  F +     +SF+E++F+F+   L + L+   +L+  I++ H+T K+  ++  +FN  +  E L  +F   ++   G  +    DNL  L
Sbjct:   15 SVALRAQKKILGKMASKNVAKAFVDDTTGELLDQLYKLAKLETGNKKEAEKLVKDLVKIVVKISILFRNDQLNREEIQIAEKFRRNFRSAAMTFISFYEVDFSFDKKFLTKNLEDCRSLIHQIIDRHLTAKSHGRVDHVFNYYANGEMLERVFQANRDGPYGTILKNIVDNLNKL 189          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. TrEMBL
Match: T1END6 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20198086 PE=4 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.641e-20
Identity = 49/159 (30.82%), Postives = 91/159 (57.23%), Query Frame = 2
Query:   95 ANNIDVGNIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLREVFGRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIF 571
            ++++DV +I LR QKK L  F +RK +   +DD + ++L + Y L++E   +K A+K+    IK ++KI  L   ++ N EE+   D+ + +F   +  ++SF ++EFT++  ++   L+     +  +V  H+TEK+  ++   FN  S E FL + F
Sbjct:   30 SDHLDVQSISLRAQKKILGKFTSRKIITTFIDDVSGRVLDNLYKLVKEFCDKKTAEKVIKHLIKTIIKIGVLYKNDQFNNEELDIADKFRKKFNALMMAVVSFHQVEFTYDRVYVISSLEAGRCCIKQLVQRHLTEKSLGRIDNFFNFFSSEVFLDSCF 188          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. TrEMBL
Match: A0A4Y7LLS5 (EOG090X0GLS OS=Eubosmina coregoni OX=186181 GN=EOG090X0GLS PE=2 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 2.456e-20
Identity = 56/181 (30.94%), Postives = 99/181 (54.70%), Query Frame = 2
Query:   95 ANNIDVGNIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLREVF-GRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIFTCGKNSKLGLAMIEFTDNLKS 634
            ++N    +I L+ QKK LS  + +  +   +DD  +KLL + Y L++     +KEA+K+    IKI+ KI+ L   ++ + +E+    + Q +F    K ++SF+E++F+++   L + L +  NLL  IV  H+T+K+  ++ M+FN  S   FL  IF   KNS+    M     ++ S
Sbjct:    2 SDNFRAKDIALKAQKKILSKMSTKSVVKVFVDDTTSKLLDNVYRLIKTYTQNKKEAEKIVKNIIKIVTKISLLAKNDQFSKDELALATDFQIKFHKAAKTVISFYEVDFSYDQKFLTQLLSECRNLLKQIVQPHLTDKSIGRVDMVFNFFSNPSFLDIIF--KKNSEYSEIMTNIIKDMHS 180          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. TrEMBL
Match: A0A2B4SDD2 (Tumor necrosis factor alpha-induced protein 8 OS=Stylophora pistillata OX=50429 GN=TNFAIP8 PE=4 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 4.614e-20
Identity = 51/175 (29.14%), Postives = 95/175 (54.29%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLR-EVFGRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIFTCGKNSKLGLAMIEFTDNLKSL 637
            ++ LR QKK L   A++      +DD   +LL   Y L + E   +KEA+K+    +KI+VKI+ L   ++LN EEI+  ++ +  F ++    +SF+E++F+F+   L + L+   +L+  I++ H+T K+  ++  +FN  +  + L  +F   ++   G  +    DNL  L
Sbjct:   15 SVALRAQKKILGKMASKSVAKAFVDDTTGELLDQLYKLAKLETGNKKEAEKLVKDLVKIVVKISILFRNDQLNREEIQIAEKFRRNFRSSAMTFISFYEVDFSFDKKFLTKNLEDCRSLIHQIIDRHLTAKSHGRVDHVFNYYANGDMLERVFQANRDGPYGTILKNIVDNLNKL 189          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Cavefish
Match: tnfaip8l3 (TNF alpha induced protein 8 like 3 [Source:NCBI gene;Acc:103022034])

HSP 1 Score: 85.8853 bits (211), Expect = 1.102e-19
Identity = 49/166 (29.52%), Postives = 89/166 (53.61%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLREVF-GRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIFTCGKNSKLGLAMI 610
            ++ L+ QKK LS  A       + DD ++ +L   Y   RE    +KEA K+    IKI +K+  L   ++   EE++ ++  + +       ++SF+E+E+TF+ S L E L +  +LL  +V NH+T ++  ++  +FN  +  EFLT ++   ++ +L L  I
Sbjct:   24 SLALQAQKKILSKMATMAVANLLTDDTSSGILDELYKASREFTKSKKEAHKIIKDVIKIALKVGILYRNHQFGPEELETVERFKKKMNQAAMTVVSFYEVEYTFDRSILSEMLLECRDLLHELVENHLTARSHGRIDHVFNHFADVEFLTELYGTAEDYRLSLRKI 189          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Cavefish
Match: tnfaip8l2b (TNF alpha induced protein 8 like 2 [Source:NCBI gene;Acc:103021955])

HSP 1 Score: 81.2629 bits (199), Expect = 4.268e-18
Identity = 50/171 (29.24%), Postives = 87/171 (50.88%), Query Frame = 2
Query:  101 NIDVGNIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLREVFG-RKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIFTCGKNSKLGLAMI 610
            N    ++ ++ QKK LS  AN+  +   +DD ++++L   Y + +E  G R EAQK+    IK++VKI  L   N  + EE+    + + +        +SF E+EFTF+ + +   L    ++L  +V  H+T K+  ++  +FN  S  E LT+++      K  L  I
Sbjct:    3 NFSSKDLAMKAQKKILSNMANKSVVQMFIDDTSSEILDELYRVSKEFTGNRTEAQKVIKDLIKVVVKIAVLFRHNRFSEEELSLAQKFKKKLQQGAMTAISFHEVEFTFDKNVMSNILTTCRDMLLKLVGTHLTPKSHGRINHVFNHYSDIELLTHLYDPDGPYKPHLTKI 173          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Cavefish
Match: tnfaip8l1 (tumor necrosis factor, alpha-induced protein 8-like 1 [Source:NCBI gene;Acc:393303])

HSP 1 Score: 78.9518 bits (193), Expect = 2.871e-17
Identity = 43/161 (26.71%), Postives = 86/161 (53.42%), Query Frame = 2
Query:   95 ANNIDVGNIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLRE-VFGRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIFT 574
              ++ + N+ L+ QKK +S  A +      +DD ++++L   Y + +E    RKEAQK+    IK++VK+  L    + + EE+  ++  + +  T     +SF +I+FTF+   +   L    +LL   +N H+T K+ +++  +FN  +  +FL  +++
Sbjct:    2 CTHVSLCNLALQAQKKLMSKMATKAVANLFIDDTSSEVLDELYRVTKEYTRNRKEAQKIIKNLIKMVVKLGVLYRNGQFSNEELVLVERFRKKVHTLAMTAVSFHQIDFTFDRRVMSGLLNDCRDLLHQAINRHLTAKSHARVNHVFNHFADCDFLATLYS 162          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Sea Lamprey
Match: tnfaip8l3 (tumor necrosis factor, alpha-induced protein 8-like 3 [Source:NCBI gene;Acc:393322])

HSP 1 Score: 72.4034 bits (176), Expect = 1.583e-15
Identity = 41/154 (26.62%), Postives = 77/154 (50.00%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLREVFG--RKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIF 571
            ++ ++ QKK L   A R   G ++DD A+ +L   Y   R+ F   RK +QK     +K+ VK+  L    + + +E+   +  + +        +SF E+EFTF+   L   L+    +L  ++ +H+TEK+ +++  +F      EFL  ++
Sbjct:   10 SLAVQAQKKLLGKMATRSVAGFLIDDAASDVLDELYRA-RKAFSHDRKASQKAVKDLVKVAVKLAVLARNGQFSTDELATAECFKRKLNQATLTAVSFHEVEFTFDRDVLARTLEDCREMLHRLIGHHLTEKSHARVDNVFRSFGDGEFLAVLY 162          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Nematostella
Match: EDO37213 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGA8])

HSP 1 Score: 83.9593 bits (206), Expect = 1.553e-19
Identity = 46/153 (30.07%), Postives = 82/153 (53.59%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLR-EVFGRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIF 571
            ++ LR QKK L   +++     ++DD    LL   Y L + E   +KEA+K+    IKI+VKI+ L   N+ N EEI   ++ +  F +     +SF+E++F+F+   L + L + + LL  ++  H+T K+  ++  +FN  +    L  +F
Sbjct:   10 SVALRAQKKVLGKLSSKGMAKALVDDTTGDLLDQLYKLAKMEASSKKEAEKLIKDLIKIVVKISILFRNNQFNKEEIMLAEKFRKNFKSAAMTFISFYEVDFSFDRQFLSKSLCECQALLHQLIERHLTSKSHGRVDHVFNYFANGALLERLF 162          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Medaka
Match: tnfaip8l2b (tumor necrosis factor, alpha-induced protein 8-like protein 2 B [Source:NCBI gene;Acc:101166904])

HSP 1 Score: 90.8929 bits (224), Expect = 1.086e-21
Identity = 49/166 (29.52%), Postives = 90/166 (54.22%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLREVFGRK-EAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIFTCGKNSKLGLAMI 610
            ++ ++ QKK LS+ A + ++   +DD ++++L   Y + +E  G K EAQK+    +KI VKI  L   N  + EE++   + + +  T     +SF+E++FTF+ + + E L    +LL  +VN H+T K+  ++  +FN     + LT ++    N +  L  I
Sbjct:    8 DMAMKAQKKILSSMATKSSVQMFIDDTSSEILDELYRVSKEYTGNKSEAQKVVKDLVKIAVKIGVLFRNNRFSNEELRVAQDFKKKLHTGAMTAISFYEVDFTFDKTVMSEILADCRDLLLKLVNTHLTPKSHGRINHVFNHYGDPQLLTKLYDPNSNFRPNLTRI 173          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Medaka
Match: tnfaip8l2b (tumor necrosis factor, alpha-induced protein 8-like protein 2 B [Source:NCBI gene;Acc:101166904])

HSP 1 Score: 90.8929 bits (224), Expect = 1.086e-21
Identity = 49/166 (29.52%), Postives = 90/166 (54.22%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLREVFGRK-EAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIFTCGKNSKLGLAMI 610
            ++ ++ QKK LS+ A + ++   +DD ++++L   Y + +E  G K EAQK+    +KI VKI  L   N  + EE++   + + +  T     +SF+E++FTF+ + + E L    +LL  +VN H+T K+  ++  +FN     + LT ++    N +  L  I
Sbjct:    8 DMAMKAQKKILSSMATKSSVQMFIDDTSSEILDELYRVSKEYTGNKSEAQKVVKDLVKIAVKIGVLFRNNRFSNEELRVAQDFKKKLHTGAMTAISFYEVDFTFDKTVMSEILADCRDLLLKLVNTHLTPKSHGRINHVFNHYGDPQLLTKLYDPNSNFRPNLTRI 173          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Medaka
Match: tnfaip8l2b (tumor necrosis factor, alpha-induced protein 8-like protein 2 B [Source:NCBI gene;Acc:101166904])

HSP 1 Score: 90.5077 bits (223), Expect = 2.164e-21
Identity = 52/176 (29.55%), Postives = 94/176 (53.41%), Query Frame = 2
Query:   86 SMDANNIDVGNIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLREVFGRK-EAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIFTCGKNSKLGLAMI 610
            +MDA      ++ ++ QKK LS+ A + ++   +DD ++++L   Y + +E  G K EAQK+    +KI VKI  L   N  + EE++   + + +  T     +SF+E++FTF+ + + E L    +LL  +VN H+T K+  ++  +FN     + LT ++    N +  L  I
Sbjct:   20 TMDA--FSSKDMAMKAQKKILSSMATKSSVQMFIDDTSSEILDELYRVSKEYTGNKSEAQKVVKDLVKIAVKIGVLFRNNRFSNEELRVAQDFKKKLHTGAMTAISFYEVDFTFDKTVMSEILADCRDLLLKLVNTHLTPKSHGRINHVFNHYGDPQLLTKLYDPNSNFRPNLTRI 193          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Medaka
Match: tnfaip8l2b (tumor necrosis factor, alpha-induced protein 8-like protein 2 B [Source:NCBI gene;Acc:101166904])

HSP 1 Score: 90.8929 bits (224), Expect = 4.284e-21
Identity = 52/176 (29.55%), Postives = 94/176 (53.41%), Query Frame = 2
Query:   86 SMDANNIDVGNIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLREVFGRK-EAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIFTCGKNSKLGLAMI 610
            +MDA      ++ ++ QKK LS+ A + ++   +DD ++++L   Y + +E  G K EAQK+    +KI VKI  L   N  + EE++   + + +  T     +SF+E++FTF+ + + E L    +LL  +VN H+T K+  ++  +FN     + LT ++    N +  L  I
Sbjct:   58 TMDA--FSSKDMAMKAQKKILSSMATKSSVQMFIDDTSSEILDELYRVSKEYTGNKSEAQKVVKDLVKIAVKIGVLFRNNRFSNEELRVAQDFKKKLHTGAMTAISFYEVDFTFDKTVMSEILADCRDLLLKLVNTHLTPKSHGRINHVFNHYGDPQLLTKLYDPNSNFRPNLTRI 231          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Medaka
Match: tnfaip8l3 (TNF alpha induced protein 8 like 3 [Source:NCBI gene;Acc:101174899])

HSP 1 Score: 82.0333 bits (201), Expect = 2.918e-18
Identity = 49/166 (29.52%), Postives = 89/166 (53.61%), Query Frame = 2
Query:  116 NIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLREVF-GRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIFTCGKNSKLGLAMI 610
            ++ L+ QKK LS  A       + DD ++++L   Y + RE    +KEA K+    IKI +KI  L   ++ + EE+  ++  + +        +SF+E+E+TF+ + L E L +  +LL S+V  H+T ++  ++  +FN  +  EFL  ++  G+  +L L  I
Sbjct:   24 SLALQAQKKILSKMATMVVANMLTDDTSSEILDELYKVSREFTKSKKEAHKIIKDVIKISLKIGILYRNHQFSQEELDTVERFKKKMNQAAMTAVSFYEVEYTFDRNILSELLFECRDLLHSLVEQHLTARSHGRIDHVFNHFAHGEFLAELYGDGEEYRLSLRKI 189          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Planmine SMEST
Match: SMESG000002914.1 (SMESG000002914.1)

HSP 1 Score: 376.711 bits (966), Expect = 1.924e-133
Identity = 189/189 (100.00%), Postives = 189/189 (100.00%), Query Frame = 2
Query:   89 MDANNIDVGNIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLREVFGRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIFTCGKNSKLGLAMIEFTDNLKSLANNNKF 655
            MDANNIDVGNIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLREVFGRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIFTCGKNSKLGLAMIEFTDNLKSLANNNKF
Sbjct:    1 MDANNIDVGNIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLREVFGRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIFTCGKNSKLGLAMIEFTDNLKSLANNNKF 189          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Planmine SMEST
Match: SMESG000023256.1 (SMESG000023256.1)

HSP 1 Score: 53.5286 bits (127), Expect = 2.449e-8
Identity = 40/167 (23.95%), Postives = 83/167 (49.70%), Query Frame = 2
Query:   83 QSMDANNIDVGNIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLREVFG-RKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIEF--TFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLTNIFT 574
            +S++ ++ +   I ++ QKK  S  + +K +   +D+ + ++  +   LLR   G +KEA K+    +KI  K+  L     L+  +I+ L + ++ F    ++ L+    ++  T     L E+  +  N +  I  N++TEK++ K+    N    +EFL  +F+
Sbjct:   12 ESIEEDHFNSQTISIKVQKKLASKLSTKKLVKFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFS 178          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Planmine SMEST
Match: SMESG000055619.1 (SMESG000055619.1)

HSP 1 Score: 51.9878 bits (123), Expect = 7.312e-8
Identity = 42/155 (27.10%), Postives = 79/155 (50.97%), Query Frame = 2
Query:  104 IDVGNIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLL-REVFGRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIE-FTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLT 562
            I    ++LR QKK  S F+++  +  ++++ AN++  + + LL      R+ A K     IK+ +KIT L   +  + EEI+K ++ +  F    ++I+        +     L E L K +++L  +V+ H+T+K+K K+      +   EFLT
Sbjct:   11 IPTQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCRNHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLT 165          
The following BLAST results are available for this feature:
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TNFAIP8L11.739e-1828.76TNF alpha induced protein 8 like 1 [Source:HGNC Sy... [more]
TNFAIP8L11.739e-1828.76TNF alpha induced protein 8 like 1 [Source:HGNC Sy... [more]
TNFAIP8L34.271e-1826.51TNF alpha induced protein 8 like 3 [Source:HGNC Sy... [more]
TNFAIP8L34.105e-1726.51TNF alpha induced protein 8 like 3 [Source:HGNC Sy... [more]
TNFAIP8L31.234e-1425.69TNF alpha induced protein 8 like 3 [Source:HGNC Sy... [more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sigmar2.217e-1333.33gene:FBgn0034894 transcript:FBtr0072096[more]
sigmar2.217e-1333.33gene:FBgn0034894 transcript:FBtr0072098[more]
sigmar3.329e-1333.33gene:FBgn0034894 transcript:FBtr0072097[more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tnfaip8l2b1.215e-2032.03tumor necrosis factor, alpha-induced protein 8-lik... [more]
tnfaip8l2b1.215e-2032.03tumor necrosis factor, alpha-induced protein 8-lik... [more]
CR407586.17.535e-1828.31pep chromosome:GRCz11:CHR_ALT_CTG18_1_44:39521878:... [more]
tnfaip8l2a7.636e-1830.38tumor necrosis factor, alpha-induced protein 8-lik... [more]
tnfaip8l18.712e-1828.76tumor necrosis factor, alpha-induced protein 8-lik... [more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TNFAIP8L31.265e-1728.22TNF alpha induced protein 8 like 3 [Source:NCBI ge... [more]
tnfaip8l21.717e-1730.72TNF alpha induced protein 8 like 2 [Source:NCBI ge... [more]
tnfaip8l24.969e-1730.72TNF alpha induced protein 8 like 2 [Source:NCBI ge... [more]
tnfaip82.429e-1627.92TNF alpha induced protein 8 [Source:NCBI gene;Acc:... [more]
tnfaip82.849e-1627.92TNF alpha induced protein 8 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tnfaip8l31.571e-1725.90tumor necrosis factor, alpha-induced protein 8-lik... [more]
Tnfaip8l11.344e-1625.30tumor necrosis factor, alpha-induced protein 8-lik... [more]
Tnfaip8l26.040e-1424.31tumor necrosis factor, alpha-induced protein 8-lik... [more]
Tnfaip81.481e-1324.18tumor necrosis factor, alpha-induced protein 8 [So... [more]
Tnfaip81.638e-1324.18tumor necrosis factor, alpha-induced protein 8 [So... [more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7T364|TPL2B_DANRE9.173e-2032.03Tumor necrosis factor, alpha-induced protein 8-lik... [more]
sp|Q8WVP5|TP8L1_HUMAN8.352e-1828.76Tumor necrosis factor alpha-induced protein 8-like... [more]
sp|A5PK29|TP8L1_BOVIN1.045e-1727.92Tumor necrosis factor alpha-induced protein 8-like... [more]
sp|Q5ZJU8|TP8L1_CHICK5.208e-1728.92Tumor necrosis factor alpha-induced protein 8-like... [more]
sp|Q1ECV8|TPL2A_DANRE5.764e-1730.38Tumor necrosis factor, alpha-induced protein 8-lik... [more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y7NL644.027e-2130.94EOG090X0GLS OS=Moina brachiata OX=675436 GN=EOG090... [more]
A0A3M6UXI61.012e-2029.71Uncharacterized protein OS=Pocillopora damicornis ... [more]
T1END61.641e-2030.82Uncharacterized protein OS=Helobdella robusta OX=6... [more]
A0A4Y7LLS52.456e-2030.94EOG090X0GLS OS=Eubosmina coregoni OX=186181 GN=EOG... [more]
A0A2B4SDD24.614e-2029.14Tumor necrosis factor alpha-induced protein 8 OS=S... [more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tnfaip8l31.102e-1929.52TNF alpha induced protein 8 like 3 [Source:NCBI ge... [more]
tnfaip8l2b4.268e-1829.24TNF alpha induced protein 8 like 2 [Source:NCBI ge... [more]
tnfaip8l12.871e-1726.71tumor necrosis factor, alpha-induced protein 8-lik... [more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tnfaip8l31.583e-1526.62tumor necrosis factor, alpha-induced protein 8-lik... [more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO372131.553e-1930.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tnfaip8l2b1.086e-2129.52tumor necrosis factor, alpha-induced protein 8-lik... [more]
tnfaip8l2b1.086e-2129.52tumor necrosis factor, alpha-induced protein 8-lik... [more]
tnfaip8l2b2.164e-2129.55tumor necrosis factor, alpha-induced protein 8-lik... [more]
tnfaip8l2b4.284e-2129.55tumor necrosis factor, alpha-induced protein 8-lik... [more]
tnfaip8l32.918e-1829.52TNF alpha induced protein 8 like 3 [Source:NCBI ge... [more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000002914.11.924e-133100.00SMESG000002914.1[more]
SMESG000023256.12.449e-823.95SMESG000023256.1[more]
SMESG000055619.17.312e-827.10SMESG000055619.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014184 ID=SMED30014184|Name=Tumor necrosis factor alpha-induced protein 8-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=925bp
ATTAGTTCTGACAATTAATTAGTAGTATAGTATTGATCATTTCAAATTCA
AGTTTGAGTCTTTTTCAATTGTGGCTTTCTAACAATCTATGGATGCAAAT
AACATAGATGTTGGTAATATTATTCTCAGAACCCAAAAGAAATTTCTCAG
TGCATTTGCTAATAGGAAAACTCTTGGGCCAATTCTTGATGATGATGCGA
ACAAACTTCTAACCTCAGCTTATCATCTACTCAGAGAGGTTTTCGGTAGG
AAAGAAGCTCAAAAAATGACGACAAGATGGATTAAAATTCTAGTCAAAAT
TACATTTCTGGTAAACGCCAATGAACTTAATGGTGAGGAAATCAAAAAGC
TCGATGAAGTGCAATCGGAATTTGGTACAACGGTGAAGGTAATATTGAGC
TTTTGGGAAATTGAGTTCACTTTCGAAAGCAGTCATTTGCAAGAGAAACT
AAAAAAGATGGAAAATTTACTCGCGTCAATAGTAAATAATCACATGACAG
AAAAAAACAAATCCAAACTGAAAATGCTTTTCAATTTGATTTCTCAAGAA
GAATTTCTGACAAATATTTTTACATGTGGCAAAAACTCCAAATTAGGCCT
AGCTATGATAGAATTTACCGACAATCTCAAATCTCTCGCAAATAACAATA
AATTTTAATCTCATCTGATCCTAGACATGAATATTTTTCTAATATAAACT
CTTGTTCGTTTTGCTATATTTGAGTTCTGTAGTGACAAGAAAGTTTTAGA
ATAAATTACAAATGTCAATGTGAAAAAAAAAAATGTTCACATCGAGAACA
ACTTTAGGTCAATCGAATTAAACAAACACCTTTTTCAAAGAAAATTCTGA
ACCGGATTATGAGTCATGACAGTTTGTCATACGTTATAATTAAAATGTCG
ATCAAACGGCAATGATCGATCGGCA
back to top

protein sequence of SMED30014184-orf-1

>SMED30014184-orf-1 ID=SMED30014184-orf-1|Name=SMED30014184-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=190bp
MDANNIDVGNIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLRE
VFGRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVK
VILSFWEIEFTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNL
ISQEEFLTNIFTCGKNSKLGLAMIEFTDNLKSLANNNKF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0042981regulation of apoptotic process
GO:0002376immune system process
GO:0045087innate immune response
GO:0050728negative regulation of inflammatory response
GO:0050868negative regulation of T cell activation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR038355TNFAIP8_sf
IPR008477TNFAIP8-like
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 114..134
NoneNo IPR availablePANTHERPTHR12757:SF1TUMOR NECROSIS FACTOR ALPHA-INDUCED PROTEIN 8-LIKE PROTEINcoord: 2..187
NoneNo IPR availableCDDcd17760MCM9coord: 27..91
e-value: 0.00832768
score: 34.0583
IPR038355TNFAIP8 superfamilyGENE3DG3DSA:1.20.1440.160coord: 5..188
e-value: 8.8E-39
score: 135.0
IPR008477Tumor necrosis factor alpha-induced protein 8-likePFAMPF05527DUF758coord: 10..182
e-value: 2.1E-38
score: 132.1
IPR008477Tumor necrosis factor alpha-induced protein 8-likePANTHERPTHR12757TUMOR NECROSIS FACTOR INDUCED PROTEINcoord: 2..187