slc23a-2

Overview
Nameslc23a-2 (AKN21561.1)
Smed IDSMED30014181
Length (bp)1947
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc23a-2 (SMED30014181) t-SNE clustered cells

Violin plots show distribution of expression levels for slc23a-2 (SMED30014181) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc23a-2 (SMED30014181) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc23a-2 (SMED30014181) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014181

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30014181SMESG000066926.1 SMESG000066923.1 SMESG000066912.1 SMESG000066905.1 dd_Smed_v4_9401_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014181SMESG000066926.1 SMESG000066923.1 SMESG000066912.1 SMESG000066905.1 dd_Smed_v4_9401_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30014181SMESG000066923.1 SMESG000066905.1 SMESG000066904.1 Contig34438uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
protonephridiaSMED30014181SMESG000066923.1 SMESG000066905.1 SMESG000066904.1 Contig34438newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
oocyteSMED30014181SMESG000066923.1 SMESG000066905.1 Contig34615uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30014181SMESG000066923.1 SMESG000066905.1 Contig34615uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30014181SMESG000066923.1 SMESG000066905.1 Contig34615newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30014181SMESG000066923.1 SMESG000066905.1 Contig34615newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
ovarySMED30014181SMESG000066923.1 SMESG000066905.1 PL030009B10A04ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
proximal tubuleSMED30014181SMESG000066926.1 SMESG000066923.1 SMESG000066912.1 SMESG000066905.1 Smed-slc23a-2smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc23a-2 vs. Ensembl Human
Match: SLC23A2 (solute carrier family 23 member 2 [Source:HGNC Symbol;Acc:HGNC:10973])

HSP 1 Score: 298.901 bits (764), Expect = 1.112e-91
Identity = 184/578 (31.83%), Postives = 316/578 (54.67%), Query Frame = 1
Query:  190 MDETCKEDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENG-SKSVENCNKSHSELEKSLAFDFIYLRWVALKFPCLQILPLFPAYRNLREEQVLDLEDSR 1920
            +D T   D    +DM Y     PPWYL I LG+QH+LT  +G      ++++ +C+    +  S+LI + F  +GI++ LQT  GC+LP+ Q ++F  + P+ ++L+  + K CN + ++ +   +      E +   +IR + GAI++SSLIE+ + + GL   L K I PL++     ++ L+  +   +   + W I ++ + L ++       V  P+P  KS   W   + ++F+M PI++A+ + W+LC I T++ VF  +   +G+ ARTD +   +  A   K PYP QWG P +  + +IG+++A++ SIIES+GDY   A +  AP  P  AINRGIF+EG+   L G  G+    TS S NIGV+ ITK G+ R+ Q  +A+M+  G+   F A+F S+P+PV+G +   +   +   G++N Q+ID  S+RN+ + GFS+ FGL  P++   N   +  G   +D+++++LLT  +F+    +  LDN +PG           E G  K  +   K +  L+   +++  +   +  K+ C   LP+ P +     + +   ++SR
Sbjct:   76 LDSTGSLDP-QRSDMIYTIEDVPPWYLCIFLGLQHYLTCFSGTIAVPFLLADAMCVGYDQWATSQLIGTIFFCVGITTLLQTTFGCRLPLFQASAFAFLAPARAILSLDKWK-CN-TTDVSVANGTAELLHTEHIWYPRIREIQGAIIMSSLIEVVIGLLGLPGALLKYIGPLTITPTVALIGLSGFQAAGERAGKHWGIAMLTIFLVLLFSQYARNVKFPLPIYKSKKGWTAYKLQLFKMFPIILAILVSWLLCFIFTVTDVFPPDSTKYGFYARTDARQGVLLVAPWFKVPYPFQWGLPTVSAAGVIGMLSAVVASIIESIGDYYACARLSCAPPPPIHAINRGIFVEGLSCVLDGIFGTGNGSTSSSPNIGVLGITKVGSRRVIQCGAALMLALGMIGKFSALFASLPDPVLGALFCTLFGMITAVGLSNLQFIDLNSSRNLFVLGFSIFFGLVLPSYLRQNP--LVTGITGIDQVLNVLLTTAMFVGGCVAFILDNTIPGT--------PEERGIRKWKKGVGKGNKSLDGMESYNLPFGMNIIKKYRCFSYLPISPTFVGYTWKGLRKSDNSR 640          
BLAST of slc23a-2 vs. Ensembl Human
Match: SLC23A2 (solute carrier family 23 member 2 [Source:HGNC Symbol;Acc:HGNC:10973])

HSP 1 Score: 298.901 bits (764), Expect = 1.112e-91
Identity = 184/578 (31.83%), Postives = 316/578 (54.67%), Query Frame = 1
Query:  190 MDETCKEDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENG-SKSVENCNKSHSELEKSLAFDFIYLRWVALKFPCLQILPLFPAYRNLREEQVLDLEDSR 1920
            +D T   D    +DM Y     PPWYL I LG+QH+LT  +G      ++++ +C+    +  S+LI + F  +GI++ LQT  GC+LP+ Q ++F  + P+ ++L+  + K CN + ++ +   +      E +   +IR + GAI++SSLIE+ + + GL   L K I PL++     ++ L+  +   +   + W I ++ + L ++       V  P+P  KS   W   + ++F+M PI++A+ + W+LC I T++ VF  +   +G+ ARTD +   +  A   K PYP QWG P +  + +IG+++A++ SIIES+GDY   A +  AP  P  AINRGIF+EG+   L G  G+    TS S NIGV+ ITK G+ R+ Q  +A+M+  G+   F A+F S+P+PV+G +   +   +   G++N Q+ID  S+RN+ + GFS+ FGL  P++   N   +  G   +D+++++LLT  +F+    +  LDN +PG           E G  K  +   K +  L+   +++  +   +  K+ C   LP+ P +     + +   ++SR
Sbjct:   76 LDSTGSLDP-QRSDMIYTIEDVPPWYLCIFLGLQHYLTCFSGTIAVPFLLADAMCVGYDQWATSQLIGTIFFCVGITTLLQTTFGCRLPLFQASAFAFLAPARAILSLDKWK-CN-TTDVSVANGTAELLHTEHIWYPRIREIQGAIIMSSLIEVVIGLLGLPGALLKYIGPLTITPTVALIGLSGFQAAGERAGKHWGIAMLTIFLVLLFSQYARNVKFPLPIYKSKKGWTAYKLQLFKMFPIILAILVSWLLCFIFTVTDVFPPDSTKYGFYARTDARQGVLLVAPWFKVPYPFQWGLPTVSAAGVIGMLSAVVASIIESIGDYYACARLSCAPPPPIHAINRGIFVEGLSCVLDGIFGTGNGSTSSSPNIGVLGITKVGSRRVIQCGAALMLALGMIGKFSALFASLPDPVLGALFCTLFGMITAVGLSNLQFIDLNSSRNLFVLGFSIFFGLVLPSYLRQNP--LVTGITGIDQVLNVLLTTAMFVGGCVAFILDNTIPGT--------PEERGIRKWKKGVGKGNKSLDGMESYNLPFGMNIIKKYRCFSYLPISPTFVGYTWKGLRKSDNSR 640          
BLAST of slc23a-2 vs. Ensembl Human
Match: SLC23A1 (solute carrier family 23 member 1 [Source:HGNC Symbol;Acc:HGNC:10974])

HSP 1 Score: 297.36 bits (760), Expect = 1.240e-91
Identity = 193/591 (32.66%), Postives = 324/591 (54.82%), Query Frame = 1
Query:  178 RTYHMDETCKEDNVA-----ENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENGSKSVENCNKSHSELEKSL-AFDF-----IYLRWVALKFPCLQILPLFPAYRNLREEQVLDLEDS 1917
            RT H  ET ++ +       + DM Y     PPWYL I LG QH+LT  +G      +++  LC+     + S+LI + F  +GI++ +QT +G +LP+ Q ++F  ++P+ ++L     K C   E I        +T+   +   +IR + GAIM+SS++E+ + + GL   L   I PL++    +++ L++ +         W I    ++L ++    L  +T  +P  +        R +IF+M PI++A+  +W+LC +LT++ V  T+PK +G+ ARTD +   +  A  ++ PYPCQWG P +  +A++G+ +A +  IIES+GDY   A +  AP  P  AINRGIF EGI   ++G LG+    TS S NIGV+ ITK G+ R+ Q  +AIM++ G    F A+F S+P+P++GG+   +   +   G++N Q++D  S+RN+ + GFS+ FGL  P +  SN   I+ G   +D+I+ +LLT  +F+    +  LDN +PG+          E G    +    ++S++  SL ++DF     I  R   LK+  + I P+F  + +  ++Q+   ED+
Sbjct:   10 RTQH--ETTRDPSTPLPTEPKFDMLYKIEDVPPWYLCILLGFQHYLTCFSGTIAVPFLLAEALCVGHDQHMVSQLIGTIFTCVGITTLIQTTVGIRLPLFQASAFAFLVPAKAILALERWK-CPPEEEIYGNWSLPLNTS--HIWHPRIREVQGAIMVSSVVEVVIGLLGLPGALLNYIGPLTVTPTVSLIGLSVFQAAGDRAGSHWGISACSILLIILFSQYLRNLTFLLPVYRWGKGLTLLRIQIFKMFPIMLAIMTVWLLCYVLTLTDVLPTDPKAYGFQARTDARGDIMAIAPWIRIPYPCQWGLPTVTAAAVLGMFSATLAGIIESIGDYYACARLAGAPPPPVHAINRGIFTEGICCIIAGLLGTGNGSTSSSPNIGVLGITKVGSRRVVQYGAAIMLVLGTIGKFTALFASLPDPILGGMFCTLFGMITAVGLSNLQFVDMNSSRNLFVLGFSMFFGLTLPNYLESNPGAINTGILEVDQILIVLLTTEMFVGGCLAFILDNTVPGS--------PEERGLIQWKAGAHANSDMSSSLKSYDFPIGMGIVKRITFLKY--IPICPVFKGFSSSSKDQIAIPEDT 585          
BLAST of slc23a-2 vs. Ensembl Human
Match: SLC23A1 (solute carrier family 23 member 1 [Source:HGNC Symbol;Acc:HGNC:10974])

HSP 1 Score: 294.664 bits (753), Expect = 1.218e-90
Identity = 191/596 (32.05%), Postives = 323/596 (54.19%), Query Frame = 1
Query:  178 RTYHMDETCKEDNVA-----ENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLT-----SPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENGSKSVENCNKSHSELEKSL-AFDF-----IYLRWVALKFPCLQILPLFPAYRNLREEQVLDLEDS 1917
            RT H  ET ++ +       + DM Y     PPWYL I LG QH+LT  +G      +++  LC+     + S+LI + F  +GI++ +QT +G +LP+ Q ++F  ++P+ ++L       P  +   G+ ++ +    I       V L     + GAIM+SS++E+ + + GL   L   I PL++    +++ L++ +         W I    ++L ++    L  +T  +P  +        R +IF+M PI++A+  +W+LC +LT++ V  T+PK +G+ ARTD +   +  A  ++ PYPCQWG P +  +A++G+ +A +  IIES+GDY   A +  AP  P  AINRGIF EGI   ++G LG+    TS S NIGV+ ITK G+ R+ Q  +AIM++ G    F A+F S+P+P++GG+   +   +   G++N Q++D  S+RN+ + GFS+ FGL  P +  SN   I+ G   +D+I+ +LLT  +F+    +  LDN +PG+          E G    +    ++S++  SL ++DF     I  R   LK+  + I P+F  + +  ++Q+   ED+
Sbjct:   10 RTQH--ETTRDPSTPLPTEPKFDMLYKIEDVPPWYLCILLGFQHYLTCFSGTIAVPFLLAEALCVGHDQHMVSQLIGTIFTCVGITTLIQTTVGIRLPLFQASAFAFLVPAKAILALERWKCPPEEEIYGNWSLPLNTSHIWHPRIREVGLH----VQGAIMVSSVVEVVIGLLGLPGALLNYIGPLTVTPTVSLIGLSVFQAAGDRAGSHWGISACSILLIILFSQYLRNLTFLLPVYRWGKGLTLLRIQIFKMFPIMLAIMTVWLLCYVLTLTDVLPTDPKAYGFQARTDARGDIMAIAPWIRIPYPCQWGLPTVTAAAVLGMFSATLAGIIESIGDYYACARLAGAPPPPVHAINRGIFTEGICCIIAGLLGTGNGSTSSSPNIGVLGITKVGSRRVVQYGAAIMLVLGTIGKFTALFASLPDPILGGMFCTLFGMITAVGLSNLQFVDMNSSRNLFVLGFSMFFGLTLPNYLESNPGAINTGILEVDQILIVLLTTEMFVGGCLAFILDNTVPGS--------PEERGLIQWKAGAHANSDMSSSLKSYDFPIGMGIVKRITFLKY--IPICPVFKGFSSSSKDQIAIPEDT 589          
BLAST of slc23a-2 vs. Ensembl Human
Match: SLC23A2 (solute carrier family 23 member 2 [Source:HGNC Symbol;Acc:HGNC:10973])

HSP 1 Score: 193.741 bits (491), Expect = 5.131e-56
Identity = 98/246 (39.84%), Postives = 151/246 (61.38%), Query Frame = 1
Query:  847 LPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSN 1584
             P+P  KS   W   + ++F+M PI++A+ + W+LC I T++ VF  +   +G+ ARTD +   +  A   K PYP QWG P +  + +IG+++A++ SIIES+GDY   A +  AP  P  AINRGIF+EG+   L G  G+    TS S NIGV+ ITK G+ R+ Q  +A+M+  G+   F A+F S+P+PV+G +   +   +   G++N Q+ID  S+RN+ + GFS+ FGL  P++   N
Sbjct:   49 FPLPIYKSKKGWTAYKLQLFKMFPIILAILVSWLLCFIFTVTDVFPPDSTKYGFYARTDARQGVLLVAPWFKVPYPFQWGLPTVSAAGVIGMLSAVVASIIESIGDYYACARLSCAPPPPIHAINRGIFVEGLSCVLDGIFGTGNGSTSSSPNIGVLGITKVGSRRVIQCGAALMLALGMIGKFSALFASLPDPVLGALFCTLFGMITAVGLSNLQFIDLNSSRNLFVLGFSIFFGLVLPSYLRQN 294          
BLAST of slc23a-2 vs. Ensembl Celegans
Match: C51E3.6 (pep chromosome:WBcel235:V:10164135:10166463:-1 gene:WBGene00008252.1 transcript:C51E3.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C51E3.6)

HSP 1 Score: 207.994 bits (528), Expect = 4.963e-59
Identity = 139/459 (30.28%), Postives = 244/459 (53.16%), Query Frame = 1
Query:  205 KEDNVAENDMDYDFNTPPPWYLSIAL--GVQHFLTMCAGNAITTIIVSNYLCLQDH-SFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAW 1572
            +E   A+       +TPP   + IAL  G+Q  +   +      +I+++ +C     + ++  LISS+F+  GIS+ +QT+ G +L ++QG +F  V PS+    S    +CN +E         S   PE V   K+ LL G ++ SS + I +  +GL+ +LTK I PL+++ +  +L+ +  + ++  I++ W + I+  V     I+ L++V +P+P  K NG++ + R  +F   P ++A+   WI C  LT   +F+  P+G       +     I ++  ++ PYP ++G P       +  + + + S+ ESVGDY   A V +    P  AINRGI  EG+G  +SG LG     T+++ NIGV+ +T+  +     ++   +I+ G+    GA+  +IP+P+VGGVL      ++G  ++N Q +D   +RN+ I+GFS+ FGL  P +
Sbjct:   11 REKKTAQRPFLKARDTPP---IGIALLYGLQQVMVCVSALLTVPLIMADSMCPGSSIAVLRQTLISSTFVSSGISTIIQTLFGMRLALLQGTAFAYV-PSVQGFMSLPENTCNATE---------SDYVPEEVYYGKLALLQGCLIASSFVPILIGATGLVGMLTKFIGPLTVSPLMLLLAFSQVDLMVTHISKHW-VAIVQAVTLFATILYLAEVKVPVPGIK-NGKFHWYRINLFGQYPYLIAICTSWIFCVALT---IFNLTPEGSAARVDKNISLAVIRESSWLEVPYPGKFGPPQFNTGLFLLFLLSAMTSVFESVGDYHAAARVSEERPPPSHAINRGILAEGLGSLISGLLGPGVGMTTHTENIGVIGVTRVASRWTMVMAGVFLIILGLITKIGALLSTIPDPLVGGVLASSMAMVVGVAVSNLQTVDMTLSRNMGIFGFSMMFGLIVPKY 451          
BLAST of slc23a-2 vs. Ensembl Celegans
Match: R11E3.2 (pep chromosome:WBcel235:IV:4772092:4775133:1 gene:WBGene00020004.1 transcript:R11E3.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R11E3.2)

HSP 1 Score: 195.667 bits (496), Expect = 1.456e-54
Identity = 155/570 (27.19%), Postives = 278/570 (48.77%), Query Frame = 1
Query:  223 ENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQD-HSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIP-FSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTD--TKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENGSKSVENCNKSHSELEKSLAFDFIYLRWVALKFPCLQILPLFPAYRNLREEQVLDLEDSR 1920
            E+++ +  N  P     + +G Q  +   +   +   ++S+ +C  D  + I+ +LIS+SF+  GI++ LQT  G +L I+ G SF   LP ++   S     CN   +  + +              K+++++G+ +++ L+      +GL+  L++ I P+++  I T+L+++   ++ Q +A  W +  +  ++ VV IV+L    +P+P +S     +   R KI    P ++ + I W++C ILT++     N       ARTD  +  + +     V  P P Q+GTP++  S + G + +  +++IES+GDY + A + K   +P   +NRG  +EGIG  LS   G  T  T+Y+ NI +M +TK  +    Q +   +++ GIF  F A+   IP PVVGGVL I    + G  + N   +D   +RN+ I G +V  GL       +N   +  G + +D +   LLTI + I  + +  LDN+ PG     +     ++  +       +   L   +   F+  RW       L  +PL P+      E++LD+E+ R
Sbjct:    6 EDELVHHVNDIPSIPTILLIGFQQMMICISMLLVIPYMMSDMVCPGDKETEIRVQLISASFVTAGIATILQTTFGMRLAILHGPSF-AYLPVLNTFQS--TYPCNEHTDTSLWQ-------------HKMQMISGSCLVAVLVMPLFGFTGLIGFLSQFIGPITIVPIMTLLTISAVSDVEQKMALHW-MSSVEFLMLVVFIVLLEHWEMPLPAYSLKRRHFYIARRKILSQFPYIIGIAIGWLICYILTVTNAIPANSP-----ARTDQNSTMEILKSTPWVHVPIPGQYGTPIIDISLLCGFIASSFVAMIESIGDYNLCAKLSKQGRIPTSNLNRGFIVEGIGCMLSSSFGIGTGITTYAENIAIMSVTKVASRITMQTAGIFLLIAGIFSKFAAVLAMIPEPVVGGVLAIGICMVNGVVLRNLMTVDLRLSRNLTIMGIAVIMGLTVALHFENN--PLKTGNQTVDNVFGTLLTIRMLIGGIIAFTLDNIAPGATREQRGFRKADDDGEDDIPVENNGFALPSFMNRFFLKYRW-------LTYIPLIPS-----REEILDIEEKR 539          
BLAST of slc23a-2 vs. Ensembl Celegans
Match: T07G12.2 (pep chromosome:WBcel235:IV:10530709:10532915:1 gene:WBGene00011593.1 transcript:T07G12.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T07G12.2)

HSP 1 Score: 192.2 bits (487), Expect = 2.037e-53
Identity = 155/572 (27.10%), Postives = 282/572 (49.30%), Query Frame = 1
Query:  226 NDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCL-QDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIP-FSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQ--AIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENGSKSVENCNKSHSELEKSLAFDFIYLRWVALKFPCLQILPLFPAYRNLR--EEQVLDLEDSRL 1923
             D+ +  N  P        G+Q  L   +   +T   VSN LC   + + ++ +LI+++F+  GI++ LQT  G +L I+ G SF    P+  L T  ++  CN   +    K              K+++++G++ ++ LI  F+ ++G++  + K I P+++  +  +L +   +++ Q ++  W I I+ ++L ++ +V+L +  +P+P FS     +   + KIF   P ++ + I W +C ILT+     T+ + +G SARTD       + +   ++  YP Q+G P L    II    +++ + IES+G+Y I A +C+  + P  ++NR   +EG G  L+  +G  T  T+YS NI +M++TK  +    Q +  I+IL GIF  F A    IP  ++GGVL      + G   +N Q +D   +RN+ I G S+  G   PA    +   +  G K +D+I   LL + + +  + +  LD +  G     +     E+  + +E   + +     S A   I      LK P L  LP+ P+ +++R  EE  + + D ++
Sbjct:    6 GDLHFHVNDVPHKSAIFFFGLQQMLVCISALLVTPYFVSNLLCAGAETTEVRVQLIAATFISSGIATILQTTFGLRLAILHGPSF-AFFPA--LHTFGDVYPCNSDTDTTQWKE-------------KLQMISGSLFVAVLIMPFLGITGMVGRIAKHIGPITIVPMLMLLCIGTVQDIEQKVSHHW-ISIVEILLLIIFVVLLEEFEVPMPAFSMEKKAFYTAKMKIFSQFPYLLGIMIAWFVCWILTI-----TDLEPYGCSARTDRNESLFVLENTPWIQIQYPLQYGLPKLSAPLIIAFSASMLAATIESIGNYGICARICQQGSPPSSSMNRAFVVEGFGSMLAALMGVGTGVTTYSENIAIMQVTKVTSRITMQCAGVILILMGIFSKFAAFLAMIPEAIIGGVLTAGMSMICGVAFSNLQSVDLRLSRNLTIIGLSIILGCTIPAHFEKS--PLHSGNKTIDDIFGTLLKMRMLVGGLIAFCLDIIASGATRKQRGF---EDKLEKIEISVEKNGFALSSFANQTI------LKIPSLTKLPIVPSEKSIRRIEELRMKVIDHKI 544          
BLAST of slc23a-2 vs. Ensembl Celegans
Match: T07G12.4 (pep chromosome:WBcel235:IV:10536736:10538684:-1 gene:WBGene00011595.1 transcript:T07G12.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T07G12.4)

HSP 1 Score: 179.489 bits (454), Expect = 8.456e-49
Identity = 151/572 (26.40%), Postives = 278/572 (48.60%), Query Frame = 1
Query:  226 NDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQ-DHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIP-FSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQ--AIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENGSKSVENCNKSHSELEKSLAFDFIYLRWVALKFPCLQILPLFPAYRNLR--EEQVLDLEDSRL 1923
            +D+ Y  N  P        G Q  L   +   IT  +VSN LC   + + ++ +LIS++F+  GI++ LQ+  G +L I+ G S     P+  L T  ++  CN   +    +              +++L++G++  + LI  F+ ++G++  + K I P+++  +  +L + +  ++   ++  W   I+ +++ +  +V+L +  +PIP FS    ++   + K+F   P ++ + I W  C ILT+S +     + +G SARTD       + +   ++  YP Q+G P L    +I    +++ ++IES+G Y I A +C+  + P  ++NR   +EG G  L+  +G  T  T+YS NI +M++TK  +    Q +  I+IL GIF  F A    IP  ++GGVL      + G   +N Q +D   +RN+ I G S+  G   PA    +   +  G K +D+I   LL + + +  + +  LD +  G     +     E+  + +E   + +     S A   I      LK P L  LP+ P+ +++R  EE  + + D ++
Sbjct:    9 SDLYYYVNDIPNISAIFFYGFQQMLVCISALLITPYLVSNLLCAGVETTAVRVQLISATFITGGIATILQSTFGLRLAILHGPS-AAFFPA--LHTFGDLYPCNSDTDTTQWRE-------------RLQLISGSLFAAVLIMPFLGLTGMVGRMAKHIGPITIVPMLILLCIGVIPDIEHKVSLHWIS-IIEILILIAFVVLLEEYEVPIPAFSMEQKKFNTMKIKLFSQFPYLLGIMIAWFACWILTISDL-----EPYGSSARTDRNDSLFVLENTPWIQIQYPLQFGFPRLSAPLVIAFTASMLAAMIESIGSYGICARICQQGSPPSSSMNRAFVVEGFGSMLAALMGVGTGVTTYSENIAIMQVTKVTSRITMQCAGVILILMGIFSKFAAFLAMIPEAIIGGVLTAGMSMICGVAFSNLQSVDLRLSRNLTIIGLSIILGCTIPAHFEKSP--LHSGNKTIDDIFGTLLKMRMLVGGLIAFCLDIIASGATRKQRGF---EDKLEKIEISVEKNGFALSSFANQTI------LKIPSLTKLPIVPSEKSIRRIEELRMKVIDHKI 547          
BLAST of slc23a-2 vs. Ensembl Celegans
Match: T07G12.5 (pep chromosome:WBcel235:IV:10541495:10545091:-1 gene:WBGene00011596.1 transcript:T07G12.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T07G12.5)

HSP 1 Score: 172.17 bits (435), Expect = 4.232e-46
Identity = 130/443 (29.35%), Postives = 229/443 (51.69%), Query Frame = 1
Query:  241 DFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSF-IKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIP-FSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQ-AIYDAKI-VKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGL 1557
            +  +PP   L    G+Q  +   +   +   +VS+ LC  D +  I+ +LIS++F+  GI++ LQT  G +L I+ G SF   LP+  L T      C+ + +        +S   E     K+++++G+ +I+ LI   +  +GL+  ++K I P+++  I ++L++    ++   +A  W I I+  +  ++ +V+L +  +PIP FS S  +++F R KIF   P ++ + I+W +C I+T+     TN +  G  ARTD      ++D    V+ P P  +G P    + + G   +   ++IES+GDY + A + K    P    NR   +EGIG  L+   G  T  T+Y+ NI +M +TK  +    Q++   +IL G+   F A    IP P++GG+L +    + G  ++N Q +D   +RN+ I G S+  GL
Sbjct:   10 EIPSPPSIML---FGLQQMMICLSSLLVIPYVVSDMLCAGDQAMEIRVQLISATFVTSGIATILQTTFGMRLSILHGPSF-AFLPA--LHTFQATFPCDANTD--------TSNWQE-----KMQMISGSCLIAVLIMPILGFTGLVGKISKYIGPVTIVPIMSLLTIGTVPDIESKMALHW-ISIVEFLTLILFVVILERYEVPIPIFSLSEKKFKFTRQKIFSQFPYLLGISIVWFICFIMTI-----TNAEPRGGEARTDQNASITVFDQTPWVQMPMPLFFGPPKFNLALVCGFTASCFAAMIESIGDYNLCAKISKQSRPPPSNTNRAFVVEGIGCILAALWGVGTGVTTYAENIAIMSVTKVTSRITMQMAGVFLILAGVISKFAAFLSMIPEPIIGGLLAMGVCLINGVSLSNLQTVDMKLSRNLTIIGVSIIMGL 427          
BLAST of slc23a-2 vs. Ensembl Fly
Match: CG6293 (gene:FBgn0037807 transcript:FBtr0337051)

HSP 1 Score: 267.7 bits (683), Expect = 4.726e-81
Identity = 166/582 (28.52%), Postives = 297/582 (51.03%), Query Frame = 1
Query:  139 LTSLQISKLVEVIRTY-HMDETCKEDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENGSKSVENCNK-SHSELEKSLAFDFIYLRWVALKFPCLQILPLFPAYR 1878
            L ++ I    +  ++Y     T   +   +  + Y  N  PPWYLSI L  QH+LTM         I++  LC+ D    +  +IS+   V GI ++ Q   G +LPI+QG +   ++P++++L  P+ K C   E   M  M  +    E +   ++R L+GAI +S+++++ +  +GL+  + K ++PL++    +++ L L E+  +  ++ W I +    +  +   ++S V +PI   +     + ++F++F++ P+++ + I+W LCGILT + VF  +     + +RTD +   +  AK    PYP Q+G P +  S ++G++  ++   +ES+  Y   + +  A + P  AINRGI  EG G  L+G  G+     ++  N+G + +TK G+ R+ Q ++ IM+L G+   FGAIFI IP+ VVGG+  ++   ++  G++  QY+D  S RN+ I G S+ F +    W   N   I  G K +D  + +LL   + +  V    LDN++PG       I          +N N  + ++ +  L  D I  RW    +     +P  P Y+
Sbjct:    3 LNNVTIEDATDASKSYSQAANTPPSNEKPKPQLLYAINDNPPWYLSIFLAFQHYLTMIGAIVSIPFILTPALCMSDEDANRGIIISTMIFVTGIVTYFQATWGVRLPIVQGGTISFLVPTLAILALPQWK-C--PEQAVMDAMDEAER--EELWQVRMRELSGAIAVSAMVQVILGYTGLVGKILKYVTPLTIVPTVSLVGLTLFEHAAETASKHWGIAVGTTGMLTLFSQIMSNVPVPILAYRKGHGLEIRQFQLFRLFPVLLTIMIMWGLCGILTATDVFPPS-----HPSRTDVRLNVLTSAKWFYVPYPGQFGWPSVTLSGVLGMLAGVLACTVESLSYYPTVSQMSGAHSPPLHAINRGIGTEGFGTVLAGLWGAGNGTNTFGENVGAIGVTKIGSRRVIQWAALIMVLQGVIGKFGAIFILIPDSVVGGIFCVMFGMIIAFGLSTLQYVDLRSARNLYILGLSIFFPMVLCRWMQKNPGAIDTGNKTVDSTLSVLLGTTILVGGVLGCLLDNIIPGTPEERGLIDWANEMPLGDDNVNDGTATDYDFPLGMDAIR-RWKWTYY-----IPFMPTYK 568          
BLAST of slc23a-2 vs. Ensembl Fly
Match: CG6293 (gene:FBgn0037807 transcript:FBtr0082240)

HSP 1 Score: 267.7 bits (683), Expect = 4.726e-81
Identity = 166/582 (28.52%), Postives = 297/582 (51.03%), Query Frame = 1
Query:  139 LTSLQISKLVEVIRTY-HMDETCKEDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENGSKSVENCNK-SHSELEKSLAFDFIYLRWVALKFPCLQILPLFPAYR 1878
            L ++ I    +  ++Y     T   +   +  + Y  N  PPWYLSI L  QH+LTM         I++  LC+ D    +  +IS+   V GI ++ Q   G +LPI+QG +   ++P++++L  P+ K C   E   M  M  +    E +   ++R L+GAI +S+++++ +  +GL+  + K ++PL++    +++ L L E+  +  ++ W I +    +  +   ++S V +PI   +     + ++F++F++ P+++ + I+W LCGILT + VF  +     + +RTD +   +  AK    PYP Q+G P +  S ++G++  ++   +ES+  Y   + +  A + P  AINRGI  EG G  L+G  G+     ++  N+G + +TK G+ R+ Q ++ IM+L G+   FGAIFI IP+ VVGG+  ++   ++  G++  QY+D  S RN+ I G S+ F +    W   N   I  G K +D  + +LL   + +  V    LDN++PG       I          +N N  + ++ +  L  D I  RW    +     +P  P Y+
Sbjct:    3 LNNVTIEDATDASKSYSQAANTPPSNEKPKPQLLYAINDNPPWYLSIFLAFQHYLTMIGAIVSIPFILTPALCMSDEDANRGIIISTMIFVTGIVTYFQATWGVRLPIVQGGTISFLVPTLAILALPQWK-C--PEQAVMDAMDEAER--EELWQVRMRELSGAIAVSAMVQVILGYTGLVGKILKYVTPLTIVPTVSLVGLTLFEHAAETASKHWGIAVGTTGMLTLFSQIMSNVPVPILAYRKGHGLEIRQFQLFRLFPVLLTIMIMWGLCGILTATDVFPPS-----HPSRTDVRLNVLTSAKWFYVPYPGQFGWPSVTLSGVLGMLAGVLACTVESLSYYPTVSQMSGAHSPPLHAINRGIGTEGFGTVLAGLWGAGNGTNTFGENVGAIGVTKIGSRRVIQWAALIMVLQGVIGKFGAIFILIPDSVVGGIFCVMFGMIIAFGLSTLQYVDLRSARNLYILGLSIFFPMVLCRWMQKNPGAIDTGNKTVDSTLSVLLGTTILVGGVLGCLLDNIIPGTPEERGLIDWANEMPLGDDNVNDGTATDYDFPLGMDAIR-RWKWTYY-----IPFMPTYK 568          
BLAST of slc23a-2 vs. Ensembl Zebrafish
Match: zgc:110789 (zgc:110789 [Source:ZFIN;Acc:ZDB-GENE-050306-38])

HSP 1 Score: 324.709 bits (831), Expect = 5.150e-102
Identity = 195/551 (35.39%), Postives = 302/551 (54.81%), Query Frame = 1
Query:  187 HMDETCKE-DNVAE----NDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRL--LNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENGSKSVENCNKSH-SELEKSLAFDFIY 1815
             + E  KE D  +E    N + Y     PPWYL I LG+QH+LT   G     +I+S  LCLQ     +S LIS+ F V G+ + LQ   G +LPI+QG +F  + P+++LL+ PE      ++N  +    +++T+PE + +++ R+  L G+IM+ SL ++ +  SGL+ L  + I PL++A   +++ L+L ++        W I  M   L V+    L  + +P+P      ++   R  IFQ+ P+++ + + W++C +LT+  V  ++P  +GY ARTD K      A   +FPYP QWG P +  + + G++  +I S+IESVGDY   A +  AP  P+ AINRGI IEGIG  L+G  G+    TSYS N+G + ITK G+  +   S  IMI+ G+F   GAIF +IP PV+GG+  ++   +   GI+N QY D  S+RNI I+GFS+  GL  P W   N   I+ G   LD ++ +LLT  +F+       LDN +PG               + +   NK+H  + + +L  D +Y
Sbjct:   25 ELPENKKESDGFSERGDPNKLAYCVTDIPPWYLCIFLGIQHYLTAFGGIIAIPLILSQGLCLQHDGLTQSHLISTIFFVSGVCTLLQVTFGVRLPILQGGTFTLLSPTMALLSMPEWTCPAWTQNASL----VNTTSPEFIHVWQSRMQMLQGSIMVGSLFQVLVGFSGLIGLFMRFIGPLTIAPTISLIGLSLFDSAGMNAGHHWGISAMTTCLIVIFSQYLRHIAIPVPKYSRAKKFHTTRIFIFQILPVLLGITLSWLICYLLTIYNVLPSDPDKYGYLARTDIKGDVTGKAPWFRFPYPGQWGVPSVSLAGVFGILAGVISSMIESVGDYHACARLSGAPPPPRHAINRGIGIEGIGCLLAGAWGTGNGTTSYSENVGALGITKVGSRMVIVASGFIMIIMGMFGKIGAIFTTIPTPVIGGMFLVMFGVITAAGISNLQYTDMNSSRNIFIFGFSMFTGLTIPNWIIKNPTSIATGVVELDHVLQVLLTTSMFVGGFFGFLLDNTIPGT-----------KRERGITAWNKAHQDDSDNTLESDEVY 560          
BLAST of slc23a-2 vs. Ensembl Zebrafish
Match: zgc:110789 (zgc:110789 [Source:ZFIN;Acc:ZDB-GENE-050306-38])

HSP 1 Score: 324.709 bits (831), Expect = 5.150e-102
Identity = 195/551 (35.39%), Postives = 302/551 (54.81%), Query Frame = 1
Query:  187 HMDETCKE-DNVAE----NDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRL--LNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENGSKSVENCNKSH-SELEKSLAFDFIY 1815
             + E  KE D  +E    N + Y     PPWYL I LG+QH+LT   G     +I+S  LCLQ     +S LIS+ F V G+ + LQ   G +LPI+QG +F  + P+++LL+ PE      ++N  +    +++T+PE + +++ R+  L G+IM+ SL ++ +  SGL+ L  + I PL++A   +++ L+L ++        W I  M   L V+    L  + +P+P      ++   R  IFQ+ P+++ + + W++C +LT+  V  ++P  +GY ARTD K      A   +FPYP QWG P +  + + G++  +I S+IESVGDY   A +  AP  P+ AINRGI IEGIG  L+G  G+    TSYS N+G + ITK G+  +   S  IMI+ G+F   GAIF +IP PV+GG+  ++   +   GI+N QY D  S+RNI I+GFS+  GL  P W   N   I+ G   LD ++ +LLT  +F+       LDN +PG               + +   NK+H  + + +L  D +Y
Sbjct:   25 ELPENKKESDGFSERGDPNKLAYCVTDIPPWYLCIFLGIQHYLTAFGGIIAIPLILSQGLCLQHDGLTQSHLISTIFFVSGVCTLLQVTFGVRLPILQGGTFTLLSPTMALLSMPEWTCPAWTQNASL----VNTTSPEFIHVWQSRMQMLQGSIMVGSLFQVLVGFSGLIGLFMRFIGPLTIAPTISLIGLSLFDSAGMNAGHHWGISAMTTCLIVIFSQYLRHIAIPVPKYSRAKKFHTTRIFIFQILPVLLGITLSWLICYLLTIYNVLPSDPDKYGYLARTDIKGDVTGKAPWFRFPYPGQWGVPSVSLAGVFGILAGVISSMIESVGDYHACARLSGAPPPPRHAINRGIGIEGIGCLLAGAWGTGNGTTSYSENVGALGITKVGSRMVIVASGFIMIIMGMFGKIGAIFTTIPTPVIGGMFLVMFGVITAAGISNLQYTDMNSSRNIFIFGFSMFTGLTIPNWIIKNPTSIATGVVELDHVLQVLLTTSMFVGGFFGFLLDNTIPGT-----------KRERGITAWNKAHQDDSDNTLESDEVY 560          
BLAST of slc23a-2 vs. Ensembl Zebrafish
Match: si:dkey-106n21.1 (si:dkey-106n21.1 [Source:ZFIN;Acc:ZDB-GENE-131120-167])

HSP 1 Score: 314.694 bits (805), Expect = 2.033e-98
Identity = 199/591 (33.67%), Postives = 324/591 (54.82%), Query Frame = 1
Query:  145 SLQISKLVEVIRTYHMDETCKE--DNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRL--LNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPG--NFYGNKCIHLTENGSKSVENCNKSHSELEKSLAFDFIYLRWVALKFPCLQILPLFP--AYRNLREE 1893
            S   S+  E I      ++ +E  D   E ++ Y  +  PPWYL I LG QH++    G     +I++  LC+++++  KS+LIS+ F V G+ + LQT LG +LPI+QG +F  + P++++L  P+ +  + S + Q+     +S       L+K+R+  + GAI+++SL+++ + +SGL+ L+ K I PL++A    ++ L+L     Q     W I  + + L  +    LS+V LP+  +  + +W+  ++ +F++   +  +   W+LC +LT      ++P  +GY ARTD    A+  A     PYP QWG P +  S+++G++  ++ S +ES+GDY   A +  AP  P  AINRGI +EG+G  L+   GS    TSYS NI  + IT+ G+  + Q +  +MI+ G+F  F A+FI+IP PV+GG+  ++   +   GI+N QY+D  S+RN++I GFS   GL  P W  SN  +I+ G K LD++I IL T H+FI       LDN +PG     G KC        K+V    + H+  +      F    ++A +F  LQ LP  P  A + LR +
Sbjct:   27 SADSSRDPEKIIAEPQSDSLEEGLDPSPEGNLIYSISDRPPWYLCILLGFQHYILAFGGILAIPLILAEPLCIKENNAAKSQLISTIFFVSGLCTLLQTTLGTRLPILQGGTFTFITPTLAILALPKWRCPDSSADPQVNGTDPASLLVNEDELWKVRIREIQGAILVASLLQLVLGLSGLVGLVLKFIGPLAIAPTINLIGLSLFIQAGQKSGAHWGIAALTVCLIFLFSQYLSKVNLPL-IAYKDKKWKVFQYPLFKLFSALFGMCGAWLLCFLLTYFNALPSSPSEYGYKARTDINLSAVKSAAWFYLPYPGQWGVPTVSMSSVLGMMAGVLASTMESIGDYYACARLSGAPPPPTHAINRGIAVEGVGCILAALWGSGNGTTSYSQNIAALGITRVGSRLVLQTAGLLMIILGLFGKFSAVFITIPEPVIGGMFLVMFGMVAAVGISNLQYVDLNSSRNLLILGFSTFSGLVLPTWFHSNPGMINTGVKELDQLIMILFTTHMFIGGFFGFVLDNTIPGTEEERGIKCWR------KAVHKGPQMHTTDDSCYNLPFC-TNFIA-RFRLLQRLPFLPSTATQELRTQ 608          
BLAST of slc23a-2 vs. Ensembl Zebrafish
Match: slc23a2 (solute carrier family 23 member 2 [Source:ZFIN;Acc:ZDB-GENE-090521-3])

HSP 1 Score: 310.457 bits (794), Expect = 3.300e-96
Identity = 190/581 (32.70%), Postives = 314/581 (54.04%), Query Frame = 1
Query:  196 ETCKEDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENGSKSVENCNKSHSELEKSLAFDF----IYLRWVALKFPCLQILPLFPAY---------RNLREEQV 1899
            ++    +    DM Y     PPWYL + LG+QH+LT  +G      +++  +C+    +  S+LI + F  +GI++ LQT  GC+LP+ Q ++F  + P+ ++L+  + K CN +  + +    +  T  E +   +IR + GAI++SSLIE+ +   GL  +L K I PL++    T++ L+  +   +   + W I ++ + L ++       + LP+P  KS   W   R ++F+M PI+MA+ + W LC I T++ VF      +G+ ARTD +   +  A   K PYP QWG P +  + +IG+++A++ SIIES+GDY   A +  AP  P  AINRGIF EG+   L G  G+    TS S NIGV+ ITK G+ R+ Q  +A M+L G+   F A+F S+P+PV+G +   +   +   G++N Q++D  S+RN+ + GFS+ FGL  P++   N   +  G   +D+++++LLT  +F+    +  LDN +PG           E G + +   N S S+ E+  ++D      +LR   + F  L I P F  Y         RN ++E +
Sbjct:   75 DSADSIDAGRIDMIYTIEDTPPWYLCVFLGLQHYLTCFSGTIAVPFLLAEAMCVGFDQWATSQLIGTIFFCVGITTLLQTTFGCRLPLFQASAFAFLAPARAILSLEKWK-CNATATLFLNSTELPHT--EDIWYPRIREIQGAIIVSSLIEVVIGALGLPGVLLKYIGPLTITPTVTLIGLSGFQAAGERAGKHWGIAMLTIFLVLLFSQYARNIHLPLPVYKSKKGWTSYRLQLFKMFPIIMAILVSWFLCFIFTVTDVFPPEKDKYGFYARTDARQGILAAAPWFKIPYPFQWGLPTVTAAGVIGMLSAVVASIIESIGDYYACARLSGAPPPPIHAINRGIFTEGLSCVLDGVFGTGNGSTSSSPNIGVLGITKVGSRRVIQYGAAFMLLLGMVGKFSALFASLPDPVLGALFCTLFGMITAVGLSNLQFVDLNSSRNLFVLGFSIFFGLVLPSYLKENP--LVTGIVQIDQVLNVLLTTAMFVGGSVAFVLDNTIPGT--------AEERGIRKMNRGNSS-SKRERMESYDLPIGMDFLRRHRI-FQYLPISPTFAGYQWSIFTHSCRNRKDESM 640          
BLAST of slc23a-2 vs. Ensembl Zebrafish
Match: slc23a2 (solute carrier family 23 member 2 [Source:ZFIN;Acc:ZDB-GENE-090521-3])

HSP 1 Score: 310.457 bits (794), Expect = 3.300e-96
Identity = 190/581 (32.70%), Postives = 314/581 (54.04%), Query Frame = 1
Query:  196 ETCKEDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENGSKSVENCNKSHSELEKSLAFDF----IYLRWVALKFPCLQILPLFPAY---------RNLREEQV 1899
            ++    +    DM Y     PPWYL + LG+QH+LT  +G      +++  +C+    +  S+LI + F  +GI++ LQT  GC+LP+ Q ++F  + P+ ++L+  + K CN +  + +    +  T  E +   +IR + GAI++SSLIE+ +   GL  +L K I PL++    T++ L+  +   +   + W I ++ + L ++       + LP+P  KS   W   R ++F+M PI+MA+ + W LC I T++ VF      +G+ ARTD +   +  A   K PYP QWG P +  + +IG+++A++ SIIES+GDY   A +  AP  P  AINRGIF EG+   L G  G+    TS S NIGV+ ITK G+ R+ Q  +A M+L G+   F A+F S+P+PV+G +   +   +   G++N Q++D  S+RN+ + GFS+ FGL  P++   N   +  G   +D+++++LLT  +F+    +  LDN +PG           E G + +   N S S+ E+  ++D      +LR   + F  L I P F  Y         RN ++E +
Sbjct:   75 DSADSIDAGRIDMIYTIEDTPPWYLCVFLGLQHYLTCFSGTIAVPFLLAEAMCVGFDQWATSQLIGTIFFCVGITTLLQTTFGCRLPLFQASAFAFLAPARAILSLEKWK-CNATATLFLNSTELPHT--EDIWYPRIREIQGAIIVSSLIEVVIGALGLPGVLLKYIGPLTITPTVTLIGLSGFQAAGERAGKHWGIAMLTIFLVLLFSQYARNIHLPLPVYKSKKGWTSYRLQLFKMFPIIMAILVSWFLCFIFTVTDVFPPEKDKYGFYARTDARQGILAAAPWFKIPYPFQWGLPTVTAAGVIGMLSAVVASIIESIGDYYACARLSGAPPPPIHAINRGIFTEGLSCVLDGVFGTGNGSTSSSPNIGVLGITKVGSRRVIQYGAAFMLLLGMVGKFSALFASLPDPVLGALFCTLFGMITAVGLSNLQFVDLNSSRNLFVLGFSIFFGLVLPSYLKENP--LVTGIVQIDQVLNVLLTTAMFVGGSVAFVLDNTIPGT--------AEERGIRKMNRGNSS-SKRERMESYDLPIGMDFLRRHRI-FQYLPISPTFAGYQWSIFTHSCRNRKDESM 640          
BLAST of slc23a-2 vs. Ensembl Xenopus
Match: ENSXETT00000048921.1 (solute carrier family 23 member 2-like [Source:NCBI gene;Acc:100490216])

HSP 1 Score: 338.191 bits (866), Expect = 4.319e-108
Identity = 194/529 (36.67%), Postives = 305/529 (57.66%), Query Frame = 1
Query:  166 VEVIRTYHM----------DETCKEDN---VAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALF--KIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIP-FSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGN 1704
            +E +  YH+           ET K++       N + Y     PPWYL I LG+QH+LT   G     +I+S  LCL      +S LIS+ F V G+ + LQ + G +LPI+QG +F  + P++++L+ P+ K    ++N+ +    +++++PE V ++  +IR + GAIM++S  +I +  SGL+  L K I PL++A   T+++L L E+  +     W I  M     V+    +  V LP+P +S+S  ++ + R  +FQ+ P+++ + I W++C ILT++ V  T P+ +GY ARTD K   + +A   +FPYP QWG P +  + + G++  +I S++ESVGDY   A +  AP  P+ AINRGI IEGIG  L+G  G+    TSYS N+G + IT+ G+  +  V   +M+L G+F   GA+F +IP PV+GG+  ++   +   GI+N Q+ D  S+RNI I GFS+  GL  P W   N  L+  G + LD+II +LLT  +F+      FLDN +PG 
Sbjct:    5 IEDVNHYHIMSSYDAKIPEKETQKKEGKILSDRNKLAYSVTDVPPWYLCIFLGIQHYLTALGGIVAIPLILSKELCLTHDPLTQSLLISTIFFVSGMCTLLQVLFGVRLPILQGGTFAFLTPTLAMLSLPKWKCPEWTQNVSL----VNASSPEFVEVWQSRIREVQGAIMVASCFQIIVGFSGLIGFLMKFIGPLTIAPTITLIALPLFESAGRDAGTHWGISAMTTFFIVLFSQYMRNVPLPVPVYSRSQRKFTYSRLYLFQIFPVLLGISISWLICCILTITDVLPTKPESYGYFARTDVKAMVLDEAPWFRFPYPGQWGLPTISLAGVFGILAGVISSMVESVGDYHACARLSGAPPPPKHAINRGIGIEGIGCLLAGAWGTGNGTTSYSENVGALGITRVGSRMVIIVGGVLMLLMGMFGKIGAVFATIPTPVIGGMFLVMFGVIAAVGISNLQFADMNSSRNIFIAGFSIFSGLTIPNWVNQNAALLETGIRELDQIILVLLTTGMFVGGFFGFFLDNTIPGK 529          
BLAST of slc23a-2 vs. Ensembl Xenopus
Match: ENSXETT00000048896.1 (solute carrier family 23 member 2-like [Source:NCBI gene;Acc:100490216])

HSP 1 Score: 338.191 bits (866), Expect = 5.134e-108
Identity = 195/532 (36.65%), Postives = 306/532 (57.52%), Query Frame = 1
Query:  157 SKLVEVIRTYHM----------DETCKEDN---VAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALF--KIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIP-FSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGN 1704
            S L + +  YH+           ET K++       N + Y     PPWYL I LG+QH+LT   G     +I+S  LCL      +S LIS+ F V G+ + LQ + G +LPI+QG +F  + P++++L+ P+ K    ++N+ +    +++++PE V ++  +IR + GAIM++S  +I +  SGL+  L K I PL++A   T+++L L E+  +     W I  M     V+    +  V LP+P +S+S  ++ + R  +FQ+ P+++ + I W++C ILT++ V  T P+ +GY ARTD K   + +A   +FPYP QWG P +  + + G++  +I S++ESVGDY   A +  AP  P+ AINRGI IEGIG  L+G  G+    TSYS N+G + IT+ G+  +  V   +M+L G+F   GA+F +IP PV+GG+  ++   +   GI+N Q+ D  S+RNI I GFS+  GL  P W   N  L+  G + LD+II +LLT  +F+      FLDN +PG 
Sbjct:    5 STLPDYVNHYHIMSSYDAKIPEKETQKKEGKILSDRNKLAYSVTDVPPWYLCIFLGIQHYLTALGGIVAIPLILSKELCLTHDPLTQSLLISTIFFVSGMCTLLQVLFGVRLPILQGGTFAFLTPTLAMLSLPKWKCPEWTQNVSL----VNASSPEFVEVWQSRIREVQGAIMVASCFQIIVGFSGLIGFLMKFIGPLTIAPTITLIALPLFESAGRDAGTHWGISAMTTFFIVLFSQYMRNVPLPVPVYSRSQRKFTYSRLYLFQIFPVLLGISISWLICCILTITDVLPTKPESYGYFARTDVKAMVLDEAPWFRFPYPGQWGLPTISLAGVFGILAGVISSMVESVGDYHACARLSGAPPPPKHAINRGIGIEGIGCLLAGAWGTGNGTTSYSENVGALGITRVGSRMVIIVGGVLMLLMGMFGKIGAVFATIPTPVIGGMFLVMFGVIAAVGISNLQFADMNSSRNIFIAGFSIFSGLTIPNWVNQNAALLETGIRELDQIILVLLTTGMFVGGFFGFFLDNTIPGK 532          
BLAST of slc23a-2 vs. Ensembl Xenopus
Match: ENSXETT00000048874.1 (solute carrier family 23 member 2-like [Source:NCBI gene;Acc:100490216])

HSP 1 Score: 337.035 bits (863), Expect = 6.720e-108
Identity = 191/510 (37.45%), Postives = 299/510 (58.63%), Query Frame = 1
Query:  193 DETCKEDN---VAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALF--KIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIP-FSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGN 1704
             ET K++       N + Y     PPWYL I LG+QH+LT   G     +I+S  LCL      +S LIS+ F V G+ + LQ + G +LPI+QG +F  + P++++L+ P+ K    ++N+ +    +++++PE V ++  +IR + GAIM++S  +I +  SGL+  L K I PL++A   T+++L L E+  +     W I  M     V+    +  V LP+P +S+S  ++ + R  +FQ+ P+++ + I W++C ILT++ V  T P+ +GY ARTD K   + +A   +FPYP QWG P +  + + G++  +I S++ESVGDY   A +  AP  P+ AINRGI IEGIG  L+G  G+    TSYS N+G + IT+ G+  +  V   +M+L G+F   GA+F +IP PV+GG+  ++   +   GI+N Q+ D  S+RNI I GFS+  GL  P W   N  L+  G + LD+II +LLT  +F+      FLDN +PG 
Sbjct:   11 KETQKKEGKILSDRNKLAYSVTDVPPWYLCIFLGIQHYLTALGGIVAIPLILSKELCLTHDPLTQSLLISTIFFVSGMCTLLQVLFGVRLPILQGGTFAFLTPTLAMLSLPKWKCPEWTQNVSL----VNASSPEFVEVWQSRIREVQGAIMVASCFQIIVGFSGLIGFLMKFIGPLTIAPTITLIALPLFESAGRDAGTHWGISAMTTFFIVLFSQYMRNVPLPVPVYSRSQRKFTYSRLYLFQIFPVLLGISISWLICCILTITDVLPTKPESYGYFARTDVKAMVLDEAPWFRFPYPGQWGLPTISLAGVFGILAGVISSMVESVGDYHACARLSGAPPPPKHAINRGIGIEGIGCLLAGAWGTGNGTTSYSENVGALGITRVGSRMVIIVGGVLMLLMGMFGKIGAVFATIPTPVIGGMFLVMFGVIAAVGISNLQFADMNSSRNIFIAGFSIFSGLTIPNWVNQNAALLETGIRELDQIILVLLTTGMFVGGFFGFFLDNTIPGK 516          
BLAST of slc23a-2 vs. Ensembl Xenopus
Match: ENSXETT00000048883.1 (solute carrier family 23 member 2-like [Source:NCBI gene;Acc:100490216])

HSP 1 Score: 337.806 bits (865), Expect = 1.554e-107
Identity = 194/529 (36.67%), Postives = 305/529 (57.66%), Query Frame = 1
Query:  166 VEVIRTYHM----------DETCKEDN---VAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALF--KIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIP-FSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGN 1704
            +E +  YH+           ET K++       N + Y     PPWYL I LG+QH+LT   G     +I+S  LCL      +S LIS+ F V G+ + LQ + G +LPI+QG +F  + P++++L+ P+ K    ++N+ +    +++++PE V ++  +IR + GAIM++S  +I +  SGL+  L K I PL++A   T+++L L E+  +     W I  M     V+    +  V LP+P +S+S  ++ + R  +FQ+ P+++ + I W++C ILT++ V  T P+ +GY ARTD K   + +A   +FPYP QWG P +  + + G++  +I S++ESVGDY   A +  AP  P+ AINRGI IEGIG  L+G  G+    TSYS N+G + IT+ G+  +  V   +M+L G+F   GA+F +IP PV+GG+  ++   +   GI+N Q+ D  S+RNI I GFS+  GL  P W   N  L+  G + LD+II +LLT  +F+      FLDN +PG 
Sbjct:   35 IEDVNHYHIMSSYDAKIPEKETQKKEGKILSDRNKLAYSVTDVPPWYLCIFLGIQHYLTALGGIVAIPLILSKELCLTHDPLTQSLLISTIFFVSGMCTLLQVLFGVRLPILQGGTFAFLTPTLAMLSLPKWKCPEWTQNVSL----VNASSPEFVEVWQSRIREVQGAIMVASCFQIIVGFSGLIGFLMKFIGPLTIAPTITLIALPLFESAGRDAGTHWGISAMTTFFIVLFSQYMRNVPLPVPVYSRSQRKFTYSRLYLFQIFPVLLGISISWLICCILTITDVLPTKPESYGYFARTDVKAMVLDEAPWFRFPYPGQWGLPTISLAGVFGILAGVISSMVESVGDYHACARLSGAPPPPKHAINRGIGIEGIGCLLAGAWGTGNGTTSYSENVGALGITRVGSRMVIIVGGVLMLLMGMFGKIGAVFATIPTPVIGGMFLVMFGVIAAVGISNLQFADMNSSRNIFIAGFSIFSGLTIPNWVNQNAALLETGIRELDQIILVLLTTGMFVGGFFGFFLDNTIPGK 559          
BLAST of slc23a-2 vs. Ensembl Xenopus
Match: ENSXETT00000048916.1 (solute carrier family 23 member 2-like [Source:NCBI gene;Acc:100490216])

HSP 1 Score: 334.339 bits (856), Expect = 2.515e-106
Identity = 188/497 (37.83%), Postives = 294/497 (59.15%), Query Frame = 1
Query:  223 ENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALF--KIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIP-FSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGN 1704
             N + Y     PPWYL I LG+QH+LT   G     +I+S  LCL      +S LIS+ F V G+ + LQ + G +LPI+QG +F  + P++++L+ P+ K    ++N+ +    +++++PE V ++  +IR + GAIM++S  +I +  SGL+  L K I PL++A   T+++L L E+  +     W I  M     V+    +  V LP+P +S+S  ++ + R  +FQ+ P+++ + I W++C ILT++ V  T P+ +GY ARTD K   + +A   +FPYP QWG P +  + + G++  +I S++ESVGDY   A +  AP  P+ AINRGI IEGIG  L+G  G+    TSYS N+G + IT+ G+  +  V   +M+L G+F   GA+F +IP PV+GG+  ++   +   GI+N Q+ D  S+RNI I GFS+  GL  P W   N  L+  G + LD+II +LLT  +F+      FLDN +PG 
Sbjct:   61 RNKLAYSVTDVPPWYLCIFLGIQHYLTALGGIVAIPLILSKELCLTHDPLTQSLLISTIFFVSGMCTLLQVLFGVRLPILQGGTFAFLTPTLAMLSLPKWKCPEWTQNVSL----VNASSPEFVEVWQSRIREVQGAIMVASCFQIIVGFSGLIGFLMKFIGPLTIAPTITLIALPLFESAGRDAGTHWGISAMTTFFIVLFSQYMRNVPLPVPVYSRSQRKFTYSRLYLFQIFPVLLGISISWLICCILTITDVLPTKPESYGYFARTDVKAMVLDEAPWFRFPYPGQWGLPTISLAGVFGILAGVISSMVESVGDYHACARLSGAPPPPKHAINRGIGIEGIGCLLAGAWGTGNGTTSYSENVGALGITRVGSRMVIIVGGVLMLLMGMFGKIGAVFATIPTPVIGGMFLVMFGVIAAVGISNLQFADMNSSRNIFIAGFSIFSGLTIPNWVNQNAALLETGIRELDQIILVLLTTGMFVGGFFGFFLDNTIPGK 553          
BLAST of slc23a-2 vs. Ensembl Mouse
Match: Slc23a4 (solute carrier family 23 member 4 [Source:MGI Symbol;Acc:MGI:1917272])

HSP 1 Score: 330.102 bits (845), Expect = 4.073e-104
Identity = 196/574 (34.15%), Postives = 319/574 (55.57%), Query Frame = 1
Query:  193 DETCKEDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALF--KIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENGSKSVENCNKSHSELEKSLAFDFIY-LRW-VALKF---PCLQILPLFPAYRNLREE 1893
             +  ++D  + +++ Y     PPWYL I LG+QHFLT   G     +I++  LCLQ     +S LIS+ F V GI + LQ  LG +LPI+QG +F  V PS+++L+ P  K    + N       +++++PE +  +  +IR L GAIM++S +++ +  SGL+  L + I PL++A   ++++L L ++        W I  + + L V+    L  V +P+P      +    RF +FQ+ P+++AL + W+ C +LT++     +P  +GY ARTDTK   +  A   +FPYP QWG P +  + + G++  +I S++ESVGDY   A +  AP  P+ AINRGI IEG+G  L+G  G+    TSYS N+G + IT+ G+  +   +  ++++ G+F   GA F +IP PV+GG+  ++   +   GI+N QY+D  S+RN+ ++GFS+  GL  P W   N + +  G   LD++I +LLT  +F+       LDN +PG+        L E G   +   +K   + E+S     +Y L W +  KF    C ++LP +P   + R+E
Sbjct:   31 QDGVQKDPNSNSNLAYGILDSPPWYLCIFLGIQHFLTALGGLVAVPLILAKDLCLQHDPLTQSYLISTIFFVSGICTLLQVFLGVRLPILQGGTFAFVAPSLAMLSLPAWKCPEWTLNAS----QVNTSSPEFIEEWQKRIRELQGAIMVASCVQMLVGFSGLIGFLMRFIGPLTIAPTISLVALPLFDSAGSDAGIHWGISALTIFLIVLFSQYLKNVMVPVPVYGRRKKCHISRFNLFQVFPVLLALCLSWLFCFVLTVTNTLPESPTAYGYMARTDTKGSVLSQAPWFRFPYPGQWGLPTISLAGVFGIIAGVISSMVESVGDYHACARLVGAPPPPKHAINRGIGIEGLGCLLAGAWGTGNGTTSYSENVGALGITRVGSRMVIVAAGCVLLVMGMFGKIGAAFATIPTPVIGGMFLVMFGIISAVGISNLQYVDMNSSRNLFVFGFSIYCGLAIPNWVNKNPEKLQTGILQLDQVIQVLLTTGMFVGGFLGFVLDNTIPGS--------LEERG---LLAWSKIQEDSEESSKVSKVYGLPWGIGTKFCTSSCTRLLPFWPRLDHHRDE 589          
BLAST of slc23a-2 vs. Ensembl Mouse
Match: Slc23a2 (solute carrier family 23 (nucleobase transporters), member 2 [Source:MGI Symbol;Acc:MGI:1859682])

HSP 1 Score: 303.908 bits (777), Expect = 9.411e-94
Identity = 189/578 (32.70%), Postives = 319/578 (55.19%), Query Frame = 1
Query:  190 MDETCKEDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENG-SKSVENCNKSHSELEKSLAFDFIYLRWVALKFPCLQILPLFPAYRNLREEQVLDLEDSR 1920
            +D T   D    +DM Y     PPWYL I LG+QH+LT  +G      ++++ +C+ D  +  S+LI + F  +GI++ LQT  GC+LP+ Q ++F  + P+ ++L+  + K CN +E   +   + ++   E +   +I+ + GAI++SSLIE+ + + GL   L + I PL++     ++ L+  +   +   + W I ++ + L ++       V  P+P  KS   W   +F++F+M PI++A+ + W+LC I T++ VF +N   +GY ARTD +   +  A   K PYP QWG P +  + +IG+++A++ SIIES+GDY   A +  AP  P  AINRGIF+EG+   L G  G+    TS S NIGV+ ITK G+ R+ Q  +A+M+  G+   F A+F S+P+PV+G +   +   +   G++N Q+ID  S+RN+ + GFS+ FGL  P++   N   +  G   +D+I+++LLT  +F+    +  LDN +PG           E G  K  +  +K    L+   +++  +   +  K+ C   LP+ P +     +     E+SR
Sbjct:   76 LDSTGSLDP-QRSDMIYTIEDVPPWYLCIFLGLQHYLTCFSGTIAVPFLLADAMCVGDDQWATSQLIGTIFFCVGITTLLQTTFGCRLPLFQASAFAFLAPARAILSLDKWK-CNTTE---ITVANGTAELLEHIWHPRIQEIQGAIIMSSLIEVVIGLLGLPGALLRYIGPLTITPTVALIGLSGFQAAGERAGKHWGIAMLTIFLVLLFSQYARNVKFPLPIYKSKKGWTAYKFQLFKMFPIILAILVSWLLCFIFTVTDVFPSNSTDYGYYARTDARKGVLLVAPWFKVPYPFQWGMPTVSAAGVIGMLSAVVASIIESIGDYYACARLSCAPPPPIHAINRGIFVEGLSCVLDGIFGTGNGSTSSSPNIGVLGITKVGSRRVIQYGAALMLGLGMVGKFSALFASLPDPVLGALFCTLFGMITAVGLSNLQFIDLNSSRNLFVLGFSIFFGLVLPSYLRQNP--LVTGITGIDQILNVLLTTAMFVGGCVAFILDNTIPGT--------PEERGIKKWKKGVSKGSKSLDGMESYNLPFGMNIIKKYRCFSYLPISPTFAGYTWKGFGKSENSR 638          
BLAST of slc23a-2 vs. Ensembl Mouse
Match: Slc23a1 (solute carrier family 23 (nucleobase transporters), member 1 [Source:MGI Symbol;Acc:MGI:1341903])

HSP 1 Score: 298.13 bits (762), Expect = 5.402e-92
Identity = 187/595 (31.43%), Postives = 319/595 (53.61%), Query Frame = 1
Query:  145 SLQISKLVEVIRTYHMDETCKEDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENGSKSVENCNKSHSELEKSL-AFDFIYLRWVALKFPCLQILPLFPAYRNLREE---QVLDLEDS 1917
            S +  ++V+   T   D         + DM Y     PPWYL I LG QH+LT  +G      +++  LC+     + S+LI + F  +GI++ +QT +G +LP+ Q ++F  ++P+ S+L     K  +  E      M ++++    +   +IR + GAIM+SS++E+ + + GL   L   I PL++    +++ L++ +         W I    ++L V+    L  +T  +P  +        R +IF+M PIV+A+  +W+LC +LT++ V   +P  +G+ ARTD +   +  +  ++ PYPCQWG P +  +A++G+ +A +  IIES+GDY   A +  AP  P  AINRGIF EGI   ++G LG+    TS S NIGV+ ITK G+ R+ Q  + IM++ G    F A+F S+P+P++GG+   +   +   G++N Q++D  S+RN+ + GFS+ FGL  P +  SN   I+ G   +D+I+ +LLT  +F+    +  LDN +PG+          E G    +    ++SE   SL ++DF +   +  +    + +P+ P +R   ++   Q   LED+
Sbjct:    9 SPKQHEVVDSAGTSTRDRQAPLPTEPKFDMLYKIEDVPPWYLCILLGFQHYLTCFSGTIAVPFLLAEALCVGRDQHMVSQLIGTIFTCVGITTLIQTTVGIRLPLFQASAFAFLVPAKSILALERWKCPSEEEIYGNWSMPLNTSH---IWHPRIREVQGAIMVSSMVEVVIGLMGLPGALLSYIGPLTVTPTVSLIGLSVFQAAGDRAGSHWGISACSILLIVLFSQYLRNLTFLLPVYRWGKGLTLFRVQIFKMFPIVLAIMTVWLLCYVLTLTDVLPADPTVYGFQARTDARGDIMAISPWIRIPYPCQWGLPTVTVAAVLGMFSATLAGIIESIGDYYACARLAGAPPPPVHAINRGIFTEGICCIIAGLLGTGNGSTSSSPNIGVLGITKVGSRRVVQYGAGIMLILGAIGKFTALFASLPDPILGGMFCTLFGMITAVGLSNLQFVDMNSSRNLFVLGFSMFFGLTLPNYLDSNPGAINTGIPEVDQILTVLLTTEMFVGGCLAFILDNTVPGS--------PEERGLIQWKAGAHANSETSASLKSYDFPFGMGMVKRTTFFRYIPICPVFRGFSKKTQNQPPVLEDT 592          
BLAST of slc23a-2 vs. Ensembl Mouse
Match: Slc23a4 (solute carrier family 23 member 4 [Source:MGI Symbol;Acc:MGI:1917272])

HSP 1 Score: 185.652 bits (470), Expect = 4.077e-54
Identity = 89/223 (39.91%), Postives = 140/223 (62.78%), Query Frame = 1
Query:  889 KRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGL 1557
             RF +FQ+ P+++AL + W+ C +LT++     +P  +GY ARTDTK   +  A   +FPYP QWG P +  + + G++  +I S++ESVGDY   A +  AP  P+ AINRGI IEG+G  L+G  G+    TSYS N+G + IT+ G+  +   +  ++++ G+F   GA F +IP PV+GG+  ++   +   GI+N QY+D  S+RN+ ++GFS+  GL
Sbjct:    3 SRFNLFQVFPVLLALCLSWLFCFVLTVTNTLPESPTAYGYMARTDTKGSVLSQAPWFRFPYPGQWGLPTISLAGVFGIIAGVISSMVESVGDYHACARLVGAPPPPKHAINRGIGIEGLGCLLAGAWGTGNGTTSYSENVGALGITRVGSRMVIVAAGCVLLVMGMFGKIGAAFATIPTPVIGGMFLVMFGIISAVGISNLQYVDMNSSRNLFVFGFSIYCGL 225          
BLAST of slc23a-2 vs. Ensembl Mouse
Match: Slc23a4 (solute carrier family 23 member 4 [Source:MGI Symbol;Acc:MGI:1917272])

HSP 1 Score: 170.629 bits (431), Expect = 2.172e-47
Identity = 91/256 (35.55%), Postives = 151/256 (58.98%), Query Frame = 1
Query:  568 ISSTAPEAVALF--KIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITK 1329
            +++++PE +  +  +IR L GAIM++S +++ +  SGL+  L + I PL++A   ++++L L ++        W I  + + L V+    L  V +P+P      +    RF +FQ+ P+++AL + W+ C +LT++     +P  +GY ARTDTK   +  A   +FPYP QWG P +  + + G++  +I S++ESVGDY   A +  AP  P+ AINRGI IEG+G  L+G  G+    TSYS N+G + IT+
Sbjct:   19 VNTSSPEFIEEWQKRIRELQGAIMVASCVQMLVGFSGLIGFLMRFIGPLTIAPTISLVALPLFDSAGSDAGIHWGISALTIFLIVLFSQYLKNVMVPVPVYGRRKKCHISRFNLFQVFPVLLALCLSWLFCFVLTVTNTLPESPTAYGYMARTDTKGSVLSQAPWFRFPYPGQWGLPTISLAGVFGIIAGVISSMVESVGDYHACARLVGAPPPPKHAINRGIGIEGLGCLLAGAWGTGNGTTSYSENVGALGITR 274          
BLAST of slc23a-2 vs. UniProt/SwissProt
Match: sp|B0JZG0|S23A2_XENTR (Solute carrier family 23 member 2 OS=Xenopus tropicalis OX=8364 GN=slc23a2 PE=2 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 4.617e-93
Identity = 186/563 (33.04%), Postives = 305/563 (54.17%), Query Frame = 1
Query:  190 MDETCKEDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENG-SKSVENCNKSHSELEKSLAFDFIYLRWVALKFPCLQILPLFPAY 1875
            +D T   D     DM Y     PPWYL I LG+QH+LT  +G      +++  +C+    +  S+LI + F  +GI++  QT  GC+LP+ Q ++F  + P+ ++L+  + K CN ++        +  T  E +   +IR + GAI++SSLIE+ +   GL   L K I PL++    +++ L+  +   +   + W I ++ + L ++       V LP+P  KS   W   + ++F+M PI+MA+ + W+LC I T++ VF  +   +GY ARTD +   +  A   K PYP QWG P +  + +IG+++A++ SIIES+GDY   A +  AP  P  AINRGIFIEG+   L G  G+    TS S NIGV+ ITK  + R+ Q  +A M+L G+   F A+F S+P+PV+G +   +   +   G++N Q++D  S+RN+ + GFS+ FGL  P++   N   +  G   +D+++++LLT  +F+   ++  LDN +PG           E G  K      K  S +E   ++D  +      ++ C   LP+ P +
Sbjct:   75 LDSTGSLDR-QRLDMIYTVEDVPPWYLCIFLGLQHYLTCFSGTVAVPFLLAEAMCVGFDQWATSQLIGTIFFCVGITTLFQTTFGCRLPLFQASAFAFLAPARAILSLEKWK-CNTTDLSITNGTELLHT--EHIWYPRIREIQGAIIMSSLIEVVIGFLGLPGALLKYIGPLTITPTVSLIGLSGFQAAGERAGKHWGIAMLTIFLVLLFSQYARNVKLPLPIYKSKKGWTAYKLQLFKMFPIIMAILVSWLLCFIFTVTDVFPPDSSKYGYYARTDARQGVLTVAPWFKVPYPFQWGLPTVSAAGVIGMLSAVVASIIESIGDYYACARLSCAPPPPIHAINRGIFIEGLSCVLDGVFGTGNGSTSSSPNIGVLGITKVASRRVIQYGAAFMLLLGMIGKFSALFASLPDPVLGALFCTLFGMITAVGLSNLQFVDLNSSRNLFVLGFSIFFGLMLPSYLKQNP--LVTGIAEIDQVLNVLLTTAMFVGGCTAFILDNTIPGT--------PEERGIRKWKRGVGKGTSGIEGMESYDLPFGMGFLRRYKCFSYLPISPTF 623          
BLAST of slc23a-2 vs. UniProt/SwissProt
Match: sp|Q9EPR4|S23A2_MOUSE (Solute carrier family 23 member 2 OS=Mus musculus OX=10090 GN=Slc23a2 PE=1 SV=2)

HSP 1 Score: 303.908 bits (777), Expect = 6.583e-93
Identity = 189/578 (32.70%), Postives = 319/578 (55.19%), Query Frame = 1
Query:  190 MDETCKEDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENG-SKSVENCNKSHSELEKSLAFDFIYLRWVALKFPCLQILPLFPAYRNLREEQVLDLEDSR 1920
            +D T   D    +DM Y     PPWYL I LG+QH+LT  +G      ++++ +C+ D  +  S+LI + F  +GI++ LQT  GC+LP+ Q ++F  + P+ ++L+  + K CN +E   +   + ++   E +   +I+ + GAI++SSLIE+ + + GL   L + I PL++     ++ L+  +   +   + W I ++ + L ++       V  P+P  KS   W   +F++F+M PI++A+ + W+LC I T++ VF +N   +GY ARTD +   +  A   K PYP QWG P +  + +IG+++A++ SIIES+GDY   A +  AP  P  AINRGIF+EG+   L G  G+    TS S NIGV+ ITK G+ R+ Q  +A+M+  G+   F A+F S+P+PV+G +   +   +   G++N Q+ID  S+RN+ + GFS+ FGL  P++   N   +  G   +D+I+++LLT  +F+    +  LDN +PG           E G  K  +  +K    L+   +++  +   +  K+ C   LP+ P +     +     E+SR
Sbjct:   76 LDSTGSLDP-QRSDMIYTIEDVPPWYLCIFLGLQHYLTCFSGTIAVPFLLADAMCVGDDQWATSQLIGTIFFCVGITTLLQTTFGCRLPLFQASAFAFLAPARAILSLDKWK-CNTTE---ITVANGTAELLEHIWHPRIQEIQGAIIMSSLIEVVIGLLGLPGALLRYIGPLTITPTVALIGLSGFQAAGERAGKHWGIAMLTIFLVLLFSQYARNVKFPLPIYKSKKGWTAYKFQLFKMFPIILAILVSWLLCFIFTVTDVFPSNSTDYGYYARTDARKGVLLVAPWFKVPYPFQWGMPTVSAAGVIGMLSAVVASIIESIGDYYACARLSCAPPPPIHAINRGIFVEGLSCVLDGIFGTGNGSTSSSPNIGVLGITKVGSRRVIQYGAALMLGLGMVGKFSALFASLPDPVLGALFCTLFGMITAVGLSNLQFIDLNSSRNLFVLGFSIFFGLVLPSYLRQNP--LVTGITGIDQILNVLLTTAMFVGGCVAFILDNTIPGT--------PEERGIKKWKKGVSKGSKSLDGMESYNLPFGMNIIKKYRCFSYLPISPTFAGYTWKGFGKSENSR 638          
BLAST of slc23a-2 vs. UniProt/SwissProt
Match: sp|Q9WTW8|S23A2_RAT (Solute carrier family 23 member 2 OS=Rattus norvegicus OX=10116 GN=Slc23a2 PE=1 SV=2)

HSP 1 Score: 300.827 bits (769), Expect = 8.128e-92
Identity = 189/581 (32.53%), Postives = 318/581 (54.73%), Query Frame = 1
Query:  190 MDETCKEDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENG----SKSVENCNKSHSELEKSLAFDFIYLRWVALKFPCLQILPLFPAYRNLREEQVLDLEDSR 1920
            +D T   D    +DM Y     PPWYL I LG+QH+LT  +G      ++++ +C+ D  +  S+LI + F  +GI++ LQT  GC+LP+ Q ++F  + P+ ++L+  + K CN +E   +   + ++   E +   +I+ + GAI++SSLIE+ + + GL   L + I PL++     ++ L+  +   +   + W I ++ + L ++       V  P+P  KS   W   + ++F+M PI++A+ + W+LC I T++ VF +N   +GY ARTD +   +  A   K PYP QWG P +  + +IG+++A++ SIIES+GDY   A +  AP  P  AINRGIF+EG+   L G  G+    TS S NIGV+ ITK G+ R+ Q  +A+M+  G+   F A+F S+P+PV+G +   +   +   G++N Q+ID  S+RN+ + GFS+ FGL  P++   N   +  G   +D+++++LLT  +F+    +  LDN +PG           E G     K V   NKS   +E   +++  +   +  K+ C   LP+ P +     +     E+ R
Sbjct:   75 LDSTGSLDP-QRSDMIYTIEDVPPWYLCIFLGLQHYLTCFSGTIAVPFLLADAMCVGDDQWATSQLIGTIFFCVGITTLLQTTFGCRLPLFQASAFAFLAPARAILSLDKWK-CNTTE---ITVANGTAELLEHIWHPRIQEIQGAIIMSSLIEVVIGLLGLPGALLRYIGPLTITPTVALIGLSGFQAAGERAGKHWGIAMLTIFLVLLFSQYARNVKFPLPIYKSKKGWTAYKLQLFKMFPIILAILVSWLLCFIFTVTDVFPSNSTDYGYYARTDARKGVLLVAPWFKVPYPFQWGMPTVSAAGVIGMLSAVVASIIESIGDYYACARLSCAPPPPIHAINRGIFVEGLSCVLDGVFGTGNGSTSSSPNIGVLGITKVGSRRVIQYGAALMLGLGMIGKFSALFASLPDPVLGALFCTLFGMITAVGLSNLQFIDLNSSRNLFVLGFSIFFGLVLPSYLRQNP--LVTGITGIDQVLNVLLTTAMFVGGCVAFILDNTIPGT--------PEERGIKKWKKGVSKGNKSLDGME---SYNLPFGMNIIKKYRCFSYLPISPTFAGYTWKGFGKSENRR 637          
BLAST of slc23a-2 vs. UniProt/SwissProt
Match: sp|Q9Z2J0|S23A1_MOUSE (Solute carrier family 23 member 1 OS=Mus musculus OX=10090 GN=Slc23a1 PE=1 SV=2)

HSP 1 Score: 298.13 bits (762), Expect = 3.779e-91
Identity = 187/595 (31.43%), Postives = 319/595 (53.61%), Query Frame = 1
Query:  145 SLQISKLVEVIRTYHMDETCKEDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENGSKSVENCNKSHSELEKSL-AFDFIYLRWVALKFPCLQILPLFPAYRNLREE---QVLDLEDS 1917
            S +  ++V+   T   D         + DM Y     PPWYL I LG QH+LT  +G      +++  LC+     + S+LI + F  +GI++ +QT +G +LP+ Q ++F  ++P+ S+L     K  +  E      M ++++    +   +IR + GAIM+SS++E+ + + GL   L   I PL++    +++ L++ +         W I    ++L V+    L  +T  +P  +        R +IF+M PIV+A+  +W+LC +LT++ V   +P  +G+ ARTD +   +  +  ++ PYPCQWG P +  +A++G+ +A +  IIES+GDY   A +  AP  P  AINRGIF EGI   ++G LG+    TS S NIGV+ ITK G+ R+ Q  + IM++ G    F A+F S+P+P++GG+   +   +   G++N Q++D  S+RN+ + GFS+ FGL  P +  SN   I+ G   +D+I+ +LLT  +F+    +  LDN +PG+          E G    +    ++SE   SL ++DF +   +  +    + +P+ P +R   ++   Q   LED+
Sbjct:    9 SPKQHEVVDSAGTSTRDRQAPLPTEPKFDMLYKIEDVPPWYLCILLGFQHYLTCFSGTIAVPFLLAEALCVGRDQHMVSQLIGTIFTCVGITTLIQTTVGIRLPLFQASAFAFLVPAKSILALERWKCPSEEEIYGNWSMPLNTSH---IWHPRIREVQGAIMVSSMVEVVIGLMGLPGALLSYIGPLTVTPTVSLIGLSVFQAAGDRAGSHWGISACSILLIVLFSQYLRNLTFLLPVYRWGKGLTLFRVQIFKMFPIVLAIMTVWLLCYVLTLTDVLPADPTVYGFQARTDARGDIMAISPWIRIPYPCQWGLPTVTVAAVLGMFSATLAGIIESIGDYYACARLAGAPPPPVHAINRGIFTEGICCIIAGLLGTGNGSTSSSPNIGVLGITKVGSRRVVQYGAGIMLILGAIGKFTALFASLPDPILGGMFCTLFGMITAVGLSNLQFVDMNSSRNLFVLGFSMFFGLTLPNYLDSNPGAINTGIPEVDQILTVLLTTEMFVGGCLAFILDNTVPGS--------PEERGLIQWKAGAHANSETSASLKSYDFPFGMGMVKRTTFFRYIPICPVFRGFSKKTQNQPPVLEDT 592          
BLAST of slc23a-2 vs. UniProt/SwissProt
Match: sp|Q9UGH3|S23A2_HUMAN (Solute carrier family 23 member 2 OS=Homo sapiens OX=9606 GN=SLC23A2 PE=1 SV=1)

HSP 1 Score: 298.901 bits (764), Expect = 5.341e-91
Identity = 184/578 (31.83%), Postives = 316/578 (54.67%), Query Frame = 1
Query:  190 MDETCKEDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENG-SKSVENCNKSHSELEKSLAFDFIYLRWVALKFPCLQILPLFPAYRNLREEQVLDLEDSR 1920
            +D T   D    +DM Y     PPWYL I LG+QH+LT  +G      ++++ +C+    +  S+LI + F  +GI++ LQT  GC+LP+ Q ++F  + P+ ++L+  + K CN + ++ +   +      E +   +IR + GAI++SSLIE+ + + GL   L K I PL++     ++ L+  +   +   + W I ++ + L ++       V  P+P  KS   W   + ++F+M PI++A+ + W+LC I T++ VF  +   +G+ ARTD +   +  A   K PYP QWG P +  + +IG+++A++ SIIES+GDY   A +  AP  P  AINRGIF+EG+   L G  G+    TS S NIGV+ ITK G+ R+ Q  +A+M+  G+   F A+F S+P+PV+G +   +   +   G++N Q+ID  S+RN+ + GFS+ FGL  P++   N   +  G   +D+++++LLT  +F+    +  LDN +PG           E G  K  +   K +  L+   +++  +   +  K+ C   LP+ P +     + +   ++SR
Sbjct:   76 LDSTGSLDP-QRSDMIYTIEDVPPWYLCIFLGLQHYLTCFSGTIAVPFLLADAMCVGYDQWATSQLIGTIFFCVGITTLLQTTFGCRLPLFQASAFAFLAPARAILSLDKWK-CN-TTDVSVANGTAELLHTEHIWYPRIREIQGAIIMSSLIEVVIGLLGLPGALLKYIGPLTITPTVALIGLSGFQAAGERAGKHWGIAMLTIFLVLLFSQYARNVKFPLPIYKSKKGWTAYKLQLFKMFPIILAILVSWLLCFIFTVTDVFPPDSTKYGFYARTDARQGVLLVAPWFKVPYPFQWGLPTVSAAGVIGMLSAVVASIIESIGDYYACARLSCAPPPPIHAINRGIFVEGLSCVLDGIFGTGNGSTSSSPNIGVLGITKVGSRRVIQCGAALMLALGMIGKFSALFASLPDPVLGALFCTLFGMITAVGLSNLQFIDLNSSRNLFVLGFSIFFGLVLPSYLRQNP--LVTGITGIDQVLNVLLTTAMFVGGCVAFILDNTIPGT--------PEERGIRKWKKGVGKGNKSLDGMESYNLPFGMNIIKKYRCFSYLPISPTFVGYTWKGLRKSDNSR 640          
BLAST of slc23a-2 vs. TrEMBL
Match: A0A0H3YJ48 (Slc23a-2 OS=Schmidtea mediterranea OX=79327 GN=slc23a-2 PE=2 SV=1)

HSP 1 Score: 1081.63 bits (2796), Expect = 0.000e+0
Identity = 578/578 (100.00%), Postives = 578/578 (100.00%), Query Frame = 1
Query:  190 MDETCKEDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENGSKSVENCNKSHSELEKSLAFDFIYLRWVALKFPCLQILPLFPAYRNLREEQVLDLEDSRL 1923
            MDETCKEDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGIMGMVLSVVLIVMLSQVTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEIIHILLTIHLFIVAVSSIFLDNVLPGNFYGNKCIHLTENGSKSVENCNKSHSELEKSLAFDFIYLRWVALKFPCLQILPLFPAYRNLREEQVLDLEDSRL
Sbjct:    1 MDETCKEDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGIMGMVLSVVLIVMLSQVTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEIIHILLTIHLFIVAVSSIFLDNVLPGNFYGNKCIHLTENGSKSVENCNKSHSELEKSLAFDFIYLRWVALKFPCLQILPLFPAYRNLREEQVLDLEDSRL 578          
BLAST of slc23a-2 vs. TrEMBL
Match: A0A0H3YF36 (Slc23a-1 OS=Schmidtea mediterranea OX=79327 GN=slc23a-1 PE=2 SV=1)

HSP 1 Score: 726.087 bits (1873), Expect = 0.000e+0
Identity = 364/574 (63.41%), Postives = 469/574 (81.71%), Query Frame = 1
Query:  190 MDETCKEDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENGSKSVENCNKSHSELEKSLAFDFIYLRWVALKFPCLQILPLFPAYRNLREEQVLDLE 1911
            M+   K +   +NDMDYDFN PPPWY+S+ALG+QHFL+MCAGNA  T+I++NYLCL D+S IKSELISSSF VMGISSFLQTI GCKLPIIQGASF CVLP++SLL  P++KSCN S N   Q ++++S   E + L KIRL+NGAIM+SSL+EI ++VSGLL +LT+LISPLSLAAI+TVLSLN+SE+LL+M++EQW IGI+GM++SVV +V+LS V +PIP S+  G W+F + KIFQ+CPI+++LG LWI+C ILT S + S +PKGWGYSARTD KF+AIYD+KI K PYP QWG PLL+PSAI+G+   I++S IESVGDYMIT+  C+AP +PQFAINRGI +EG GVFLSG LG++T PTSYSGNIG+ K+TKAGN+ I Q+++ IM+LCGIFP+FGA+F+SIPN +VGGVLFIVCL +MGC INNFQYID  STRN+I++GFSVSFGLYFPAW TS++ +ISVGY+P+DEI+ ILL+IHLFIVAVS+I LDN+LPG++ GNK   +        ++ ++ +++LE+  AFD   ++W+A+   CLQILP+FPAYR  +  +  + E
Sbjct:    1 MNHPNKVNGTDKNDMDYDFNRPPPWYISMALGIQHFLSMCAGNAFATMIIANYLCLPDNSPIKSELISSSFFVMGISSFLQTICGCKLPIIQGASFACVLPTLSLLQMPDLKSCNISSNRMFQSLNLTSL--EDLPLMKIRLMNGAIMVSSLVEIIISVSGLLGILTRLISPLSLAAIYTVLSLNISESLLKMMSEQWVIGILGMIISVVSVVILSPVPIPIPVSRRGGNWKFIKVKIFQICPIIISLGSLWIVCAILTASNLLSKSPKGWGYSARTDIKFKAIYDSKIFKIPYPGQWGMPLLIPSAIVGLTAGILISTIESVGDYMITSMACRAPKIPQFAINRGILVEGSGVFLSGLLGAVTCPTSYSGNIGLFKLTKAGNVIIGQMTAFIMLLCGIFPVFGAVFVSIPNSIVGGVLFIVCLLVMGCAINNFQYIDINSTRNVIVFGFSVSFGLYFPAWITSHLHMISVGYEPVDEILRILLSIHLFIVAVSAIVLDNILPGHYSGNKKSEIVNESKDQTKDQDEEYTKLERFEAFDNKVMKWLAVNLECLQILPIFPAYRKFKGNRKNNFE 572          
BLAST of slc23a-2 vs. TrEMBL
Match: A0A402ERG2 (Uncharacterized protein OS=Paroedura picta OX=143630 GN=parPi_0006630 PE=4 SV=1)

HSP 1 Score: 342.813 bits (878), Expect = 1.282e-105
Identity = 200/578 (34.60%), Postives = 314/578 (54.33%), Query Frame = 1
Query:  202 CKED-NVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALF--KIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENGSKSVEN--CNKSHSELEKSLAFDFIYLRWVALKFPCLQILPLFPAYRNLREEQVLDLEDSR 1920
            C+E  N   +++ Y     PPWYLSI LG+QH+LT   G     +I+S  LCL+     +S LIS+ F V GI + LQ I G +LPI+QG +F  + PS+++L+ P+ K    ++N       + +T+PE + ++  ++R L GAIM++S  +IF+  SGL+  L + I PL++A   ++++L L E+        W I  + +   V+    L  V +P+P  K   +    +  +FQ+ P+++ L I W+LC  LT+S VF + P  +GY ARTD+K   +  A   +FPYP QWG P +  + + G++  +I S++ESVGDY   A +  AP  P  AINRGI +EGIG  L+G  G+    TSYS N+G + IT+ G+  +    + +M+L G+F   GA+F SIP P++GG+  ++   +   G++N QY D  S+RN+ I+GFS+  GL  P W  +N + +  G   LD++I +LLT  +F+      FLDN +PG+      +   E   +   N  C     +L   +   F    W    F  L   P  P   +  E      E+S+
Sbjct:   37 CEEKLNRPRSNLAYSVTDIPPWYLSIFLGIQHYLTALGGLVAIPLILSRGLCLEHDILTQSHLISTIFFVSGICTLLQVIFGVRLPILQGGTFAFLTPSLAMLSLPDWKCPAWTQN----ATQVDATSPEFIEVWQKRMRELQGAIMVASCFQIFVGFSGLIGFLMRFIGPLTIAPTISLVALPLFESAGNEAGAHWGIAAVTIFFIVLFSQYLKNVPVPVPAYKKRRKCYISKIHLFQIFPVLLGLSISWLLCFALTVSNVFPSTPDVYGYPARTDSKGDVLSKAPWFRFPYPGQWGVPTISVAGVFGIIAGVISSMVESVGDYYACARLSGAPPPPTHAINRGIGVEGIGCLLAGAWGTGNGTTSYSENVGALGITRVGSRIVIVAGACVMLLTGMFGKVGAVFASIPTPIIGGMFIVMFGIITAVGVSNLQYADMNSSRNLFIFGFSIYAGLTIPHWVKNNTEALKTGILQLDQVIQVLLTTGMFVGGFLGFFLDNTIPGSQEERGLLAWNETYKEESSNTLCTSDVYDLPFGIGSKFCAANW----FRYLPTCPKRPPGHSANENNSYAQENSK 606          
BLAST of slc23a-2 vs. TrEMBL
Match: A0A210R693 (Solute carrier family 23 member 2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT00050 PE=4 SV=1)

HSP 1 Score: 342.043 bits (876), Expect = 1.901e-105
Identity = 201/563 (35.70%), Postives = 318/563 (56.48%), Query Frame = 1
Query:  226 NDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPE-----IKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENG-SKSVENCNKSHSELEKSLAFDFIYLRWVALKFPCLQILPLFPAYRNLREEQ 1896
            +D+ Y     PPW L I LG QH+LT   G     +I++   C+ +     SELI + F   G+++ LQT LG +LPIIQG SF  + P+ +LL+ P+      ++ NG  NI        S   + +   ++R + GAIM++SL ++ +  SGL+ ++ + I PL++     ++ L L      + ++QW I +M MVL  +    L  +TLP       G ++   FK+F   P+++A+   W +CGILT +GVF T+  GWGY ARTDTK   + D+K  +FPYP QWG P +  + + G++  +I S+IESVGDY+  A +  AP  P  A+NRGI +EGIG  L+G  GS +  TSYS NIG + ITK G+ R+ QV   +M++ G    FGA+F++IP+PV+GG+  I+   ++  G++N Q++D  S+RNI + G S+ FGL FP W   +   I  G + +D+I+ +LL  ++F+  V  + LDN +PG           E G  K  E  + +    ++S  +D  +++ +  K  C + +P+ PA+   R  +
Sbjct:   42 SDLLYSVEEVPPWGLCILLGFQHYLTAFGGIVTVPLILNGVFCIAEDRVGLSELIGTIFFCSGMATLLQTTLGVRLPIIQGGSFTFLTPTFALLSLPKWSCEYTEAANGLRNIT-DLPPYGSLGHQEIWHMRLREVQGAIMVASLFQVVIGFSGLMGVVLRFIGPLAVTPTVALIGLGLFPEAADLASKQWYIAVMTMVLIALFSQYLRNITLP-----RCGSYKLPIFKLF---PVLIAMMSAWGICGILTAAGVFPTDQNGWGYEARTDTKLDVLRDSKWFRFPYPGQWGVPTVSTAGVFGMLAGVISSMIESVGDYIACARLSGAPPPPDHAVNRGIGMEGIGCILAGAWGSGSGTTSYSENIGAIGITKVGSRRVVQVGGCMMLILGCLGKFGALFVTIPDPVIGGMFLIMFGMVVSVGLSNLQFVDLSSSRNIFVLGTSLFFGLSFPVWIKDHPNSIDTGNEVVDQILSVLLGTNMFVGGVVGLVLDNTVPGTD--------EERGIKKWREITSVTGGNEKRSTVYDIPFIQPLLDKMACWRYVPMCPAFNGCRRRR 587          
BLAST of slc23a-2 vs. TrEMBL
Match: G1KKW2 (Uncharacterized protein OS=Anolis carolinensis OX=28377 GN=LOC100563862 PE=4 SV=2)

HSP 1 Score: 341.273 bits (874), Expect = 4.433e-105
Identity = 202/580 (34.83%), Postives = 320/580 (55.17%), Query Frame = 1
Query:  193 DETCKEDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRL--LNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTEN-GSKSVENCNKSH-SELEKSLAFDFIYLRWVALKFPCLQILPLFPAYRNLREEQVLDLEDSR 1920
            ++  K  +   N + Y     PPWYL I LG+QH+LT   G     +I+S  LCL+  +  +S LIS+ F V GI + LQ + G +LPI+QG +F  V P++++L+ P+ +    ++N  +    +++T+P  + +++ R+  + GAIMI+S  +IF+  SGLL  L + I PL++A   ++++L L ++  +   + W I  + M L V+    L  V +P+P      ++ F +  +FQ+ P++  L + WILC ILT+S  F T+   +GYSARTD+K   +  A   +FPYP QWG P +  + + G++  +I S++ESVGDY   A +  AP  P+ AINRGI +EGIG  L+G  G+    TSYS N+G + IT+ G+  +    + +M+L G+F   GA+F SIP P++GG+ F+    +   G++N QY+D  S+RN+ I+GFSV  GL  P W  +N  ++  G   LD+++ +LLT  +F+       LDN +PG+          E  G +S E    S   +L       F    W    F  L   P  PA  + RE      E S+
Sbjct:   36 EKRHKGHSKDSNRLAYIVTDIPPWYLCIFLGIQHYLTALGGLVSIPLILSRALCLEHDAITQSHLISTFFFVSGICTLLQVLFGVRLPILQGGTFAFVTPTLAMLSLPQWQCPAWTQNATL----VNATSPIFIEVWQTRMREVQGAIMIASCFQIFVGFSGLLGFLMRFIGPLTIAPTISLVALPLFDSAGREAGQHWGIAAIAMFLIVLFSQYLKNVPVPVPSYNKRKKFHFSKIYLFQIFPVLFGLILTWILCLILTVSNAFPTDSTAYGYSARTDSKGDVLSRAPWFRFPYPGQWGVPTISLAGVFGIIAGVISSMVESVGDYYACARLSGAPPPPKHAINRGIGVEGIGCLLAGAWGTGNGTTSYSENVGALGITRVGSRMVIVAGACVMLLTGLFGKIGAMFASIPTPIIGGMFFVTFGIITAVGVSNLQYVDMNSSRNLFIFGFSVFTGLTLPYWVQNNSHMLETGIVQLDQVLRVLLTTGMFVGGFLGFLLDNTIPGSKEERGIAAWREGCGEQSDETVTMSSVYDLPFGFGSKFCAANW----FQYLPTCPKRPASHSARELNSYAEETSK 607          
BLAST of slc23a-2 vs. Ensembl Cavefish
Match: zgc:110789 (solute carrier family 23 member 1-like [Source:NCBI gene;Acc:103046882])

HSP 1 Score: 326.635 bits (836), Expect = 7.034e-103
Identity = 190/535 (35.51%), Postives = 298/535 (55.70%), Query Frame = 1
Query:  196 ETCKEDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRL--LNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENGSKSVENCNKSHSELEKS 1794
            ++ +ED  + N + Y     PPWYL I LG+QHFLT   G     +I+S  LCLQ     +S LIS+ F V G+ + LQ  LG +LPI+QG +F  + PS++LL+ PE      ++N  +    +++++PE + +++ R+  L G+IM+ SL ++ +  SGL+ L    I PL++A   +++ L+L ++        W I  M   L V+    L  + +P+P      ++   R  IFQ+ P+++ + + W++C + T+  V  ++   +GY ARTD K   I  A   +FPYP QWG P +  + ++G++  II S+IESVGDY   A +  AP  P+ AINRGI IEGIG  L+G  G+    TSYS N+G + ITK G+  +   S  IMI+ G+F   GAIF +IP PV+GG+  ++   +   G++N QY D  S+RNI I+GFS+  GL  P W   N  +I+ G   LD+++ +LLT  +F+       LDN +PG               + +   N++H +   S
Sbjct:   34 DSTEED--SRNKLAYCVTDVPPWYLCIILGIQHFLTAFGGIIAIPLILSQGLCLQHDGLTQSHLISTIFFVSGLCTLLQVTLGVRLPILQGGTFTLLAPSMALLSMPEWTCPAWTQNATL----VNTSSPEFIHVWQSRMQVLQGSIMVGSLFQVLVGFSGLIGLFMHFIGPLTIAPTISLIGLSLFDSAGMNAGNHWGISAMTTCLIVLFSQYLRHIAIPVPTYSKAKKFHTSRMYIFQILPVLLGITVSWLICYLFTIYDVLPSDSDQYGYLARTDIKGDVIGGAPWFRFPYPGQWGMPTVSLAGVLGILAGIISSMIESVGDYHACARLSGAPPPPKHAINRGIGIEGIGCLLAGAWGTGNGTTSYSENVGALGITKVGSRMVIVGSGVIMIIMGVFGKIGAIFTTIPTPVIGGMFLVMFGVISAAGVSNLQYADMNSSRNIFIFGFSMFTGLAIPNWIMKNPAVIATGIVELDQVLQVLLTTSMFVGGFFGFMLDNTIPGT-----------KRERGITAWNRAHEDDSDS 551          
BLAST of slc23a-2 vs. Ensembl Cavefish
Match: si:dkey-106n21.1 (solute carrier family 23 member 2-like [Source:NCBI gene;Acc:103034292])

HSP 1 Score: 317.775 bits (813), Expect = 1.370e-99
Identity = 192/587 (32.71%), Postives = 321/587 (54.68%), Query Frame = 1
Query:  145 SLQISKLVEVIRTYHMDETCKE--DNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSEN--IQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENGSKS----VENCNKSHSELEKSLAFDFIYLRWVALKFPCLQILPLFPAYRN 1881
            SL+IS     + T    ++ +E  +   +  + Y  N  PPWYL + LG QH++    G     +I++  LC++D++  K +LIS+ F V GI + LQT +G +LPI+QG +F  + P++++L+ P+ +     +   +     S S T PE V   ++R + GAI+++S++++ + +SGL+ L+ K I PL++A   +++ L L +   Q     W I  + + L  +    LS+V +P+  +  + +W+  R+ +F++   +  +   W++C +LT      T+P  +GY ARTD   +A+  A     PYP QWG P +  S+++G+V  ++ S +ES+GDY   A +  AP  P+ AINRGI +EG+G  L+   GS    TSYS N+  + IT+ G+  + Q +  +M++ G+F  F A+FI+IP+PV+GG+  ++   +   GI+N QY+D  S+RN++I GFS   GL  P W  SN  +I+ G   LD++I +L T H+FI  +    LDN +PG           E G KS    V + N+ +   +      F       +KF   Q LP  P  R+
Sbjct:   23 SLKISDGSHTVMTDPRSDSLEEGLNQRPQGGLIYSINDRPPWYLCVLLGFQHYILAFGGILAIPLILAEPLCIKDNNAAKGQLISTIFFVSGICTLLQTTIGTRLPILQGGTFTFITPTLAILSLPKWRCPEMGQTAVLNTTAASASLTVPEEVWKVRMREIQGAILVASVVQVVLGLSGLVGLVLKFIGPLAIAPTISLIGLALFKEAGQKSGAHWGISALTVCLIFLFSQYLSKVNVPL-IAYKDKKWKVFRYPLFKLFSALFGMCGAWLVCFLLTYFNALPTSPDEYGYKARTDLNLEAVSSAAWFLMPYPGQWGLPTVSFSSVLGMVAGVLASTMESIGDYYACARLSGAPPPPRHAINRGIAVEGLGCILAALWGSGNGTTSYSQNVAALGITRVGSRLVLQTAGLLMVILGLFGKFSAVFITIPDPVIGGMFLVMFGMIAAVGISNLQYVDLNSSRNLLILGFSTFSGLVLPTWFHSNPDMINTGITELDQLIMVLFTTHMFIGGLFGFVLDNTIPGTD--------EERGIKSWREVVHSGNRVYFSDQSCYHLPFCMNFLQRIKF--FQKLPFLPQLRS 598          
BLAST of slc23a-2 vs. Ensembl Cavefish
Match: slc23a1 (solute carrier family 23 member 1 [Source:NCBI gene;Acc:103033096])

HSP 1 Score: 300.056 bits (767), Expect = 1.247e-92
Identity = 182/574 (31.71%), Postives = 303/574 (52.79%), Query Frame = 1
Query:  229 DMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQ-KMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENGSKSVENCNKSHSELEKSLAFDFIYLRWVALKFPCLQILPLFPAYRNLR---------EEQVLDLEDSR 1920
            DM Y     PPWYL + LG+QH+LT  +G      ++++ +C+    +  S+L+ + F  +GI++ +QT  G +LP+ Q ++F  ++P+ ++L     K C   E I     + +++T    +   +IR + GAI+ISSL+E+ +   GL  LL   I PL++    +++ L++ +   +     W + ++ + L V+    L     P PF          RF+IF+M PI+MA+ ++W++C ILT++ V   +P  +GY ARTD + + +  A   + PYPCQWG P +  + ++G+ +A +  I+ES+GDY   A +  AP  P  AINRGIF EG+   ++G LG+    TS S NIGV+ ITK G+ R+ Q  + IM L G    F A+F S+P+PV+GG+   +   +   G++N Q +D  S+RN+ + GFS+  GL  P +  ++   I  G   LD+I+ +LLT  +F+       LDN +PG       I    + S  +     +         ++F     +  +  CL+ LP+ P ++  +         EEQ  DL D  
Sbjct:   61 DMIYRIEDVPPWYLCVLLGLQHYLTCFSGTIAVPFLLADAMCVGRDQYTVSQLVGTIFTCVGITTLIQTTFGVRLPLFQASAFAFLIPAKAILGLERWK-CPPEEEIYGDWSLPLNTTH---IWYPRIREIQGAIIISSLVEVVIGFVGLPGLLLNSIGPLTVTPTVSLIGLSVFQTAGERAGSHWGLSLLCIFLIVLFAQYLRNWAFPFPFYSRQKGCHITRFQIFKMFPIIMAIMLVWLVCYILTLTDVLPNDPSQYGYKARTDARGEIMSQAPWFRMPYPCQWGLPTVTIAGVLGMFSATLAGIVESIGDYYACARLSGAPPPPVHAINRGIFTEGVCCIIAGLLGTGNGSTSSSPNIGVLGITKVGSRRVVQYGALIMFLLGTIGKFTALFASLPDPVLGGMFCTLFGMITAVGLSNLQSVDLNSSRNLFVLGFSMFSGLMLPNYLETHPGSIKTGVPELDQILTVLLTTEMFVGGFLGFILDNTIPGTAKERGLIEWKADSSSDIGGVTSN--------TYNFPVGMGLVRRLGCLRYLPICPTFQGFKPCCRRKSLCEEQ--DLRDGE 620          
BLAST of slc23a-2 vs. Ensembl Cavefish
Match: slc23a2 (solute carrier family 23 member 2 [Source:ZFIN;Acc:ZDB-GENE-090521-3])

HSP 1 Score: 297.36 bits (760), Expect = 9.008e-92
Identity = 183/561 (32.62%), Postives = 304/561 (54.19%), Query Frame = 1
Query:  196 ETCKEDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENGSKSVEN-CNKSHSELEKSLAFDFIYLRWVALKFPCLQILPLFPAY 1875
            ++ +  +    DM Y     PPWYL + LG+QH+LT  +G      ++S  +C+    +  S+LI + F  +GI++ LQT +GC+LP+ Q ++F  + P+ ++L+  + K CN +    +    +  T  E +   +IR + GAI++SSL+E+ +   GL  LL K I PL++     ++ L+  +   +   + W I ++ + L ++       V LP P  K+   W   R ++F+M PI+MA+ + W LC I T++ VF      +G+ ARTD +   +  A   K PYP QWG P +  + +IG+++A++ SIIES+GDY   A +  AP  P  AINRGIF+EG+   L G  G+    TS S NIGV+ ITK G+ R+ Q  + +M+L G    F A+F S+P+PV+G +   +   +   G++N Q++D  S+RN+ + GFS+ FGL  P++   N   +  G   +D+++++LLT  +F+    +  LDN +PG           E G + ++     S SELE   ++D  +           Q LP+ P +
Sbjct:   24 DSTESTDARRLDMIYTIEDTPPWYLCVFLGLQHYLTCFSGTIAVPFLLSEAMCVGFDQWATSQLIGTIFFCVGITTLLQTTIGCRLPLFQASAFAFLAPARAILSLEKWK-CNATAVPLVNSTELLHT--EHIWYPRIREIQGAIIVSSLVEVCIGALGLPGLLLKYIGPLTITPTVALIGLSGFQAAGERAGKHWGIAMLTIFLVLLFSQYARNVQLPFPVYKAKKGWTSYRLQLFKMFPIIMAILVSWFLCFIFTVTDVFPPERDKYGFYARTDARQGILAAAPWFKVPYPFQWGFPTVSAAGVIGMMSAVVSSIIESIGDYYACARLSAAPPPPVHAINRGIFVEGLSCVLDGLFGTGNGSTSSSPNIGVLGITKVGSRRVIQYGAVLMLLLGTVGKFSALFASLPDPVLGALFCTLFGMITAVGLSNLQFVDLNSSRNLFVLGFSIFFGLVLPSYLRGNP--LVTGIVEIDQVLNVLLTTAMFVGGSVAFILDNTIPGT--------PEERGIRKLKRGTGPSASELEGMRSYDLPFGMDFIRSHRIFQHLPISPTF 571          
BLAST of slc23a-2 vs. Ensembl Cavefish
Match: slc23a3 (solute carrier family 23 member 3 [Source:NCBI gene;Acc:103041004])

HSP 1 Score: 117.857 bits (294), Expect = 2.441e-27
Identity = 132/540 (24.44%), Postives = 238/540 (44.07%), Query Frame = 1
Query:  163 LVEVIRTYHMDETCKED--NVAENDMDYDFNT--PPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLT----SPEI--KSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTN--PKGWGYSAR---TDTKFQAIYDAKIVKF----------PYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNF 1707
            +V + R   MD   ++D  +V E +          PP+ L+IAL +QH L   +   +  ++V   +        +  +  S F   GI + LQ+  G +LP++Q  S   ++P++ LL+    +P +    C  S  I+        T P       +R   G  +++ L+++ +  SG+   L     PL L  +  +L  ++      + ++ W + ++ +VL V L   L    LP          +F +  IF M  +++++ ++W +   L   G  S +  P+    + R   + T+ ++I ++  + F          P P   G PLL   +I   V A + S I S   Y++ A + KAP  P  A NRG+ +EG+G  L+G +G+     S   N   + +++ G+    Q++  ++++ G+F     +  SIP  + G VL +      G GI   QY D  S RN+   GF+V   L    W       I+ G   LD  +   L + + +V V + FL++ + G  
Sbjct:    1 MVALDRQKRMDICGQQDSEDVGEANRLNRLRVLYSPPFLLNIALALQHVLVQAS---LCALVVGALV----EEAERERMAGSVFFYSGICTLLQSYFGTRLPLVQAPSLDFLVPALVLLSAQTGTPAVCRGQCEKSNEIE------GPTHP-------VREFQGMAVVAGLVQLLVGWSGVGGALLGCCGPLVLTPVLCMLGFSVYREAALLCSDHWGLALLTVVLLVFLSQHLRFCFLPACL-------KFPQCPIFSMLSVLLSVLLVWAVFLALFYYGHISPHSVPELLLENTRFNASQTEKRSILNSSRLLFTDSTTPWLILPVPGDLGLPLLSGRSIAAGVAAGLSSSISSQAVYVLAARLLKAPTPPAQACNRGLSVEGLGSVLAGLMGAPVGLCSSVANACTLGLSQCGSRGSVQLAGVMLLVLGVFLRLTQLLTSIPLAIHGAVLSVTYTVAAGTGITYLQYTDVDSGRNLFNTGFTVFMSLVLLHWFRIRPGFINTGVPGLDVFLQSCLMLPVLVVGVLAFFLEHTVSGTL 513          
BLAST of slc23a-2 vs. Ensembl Sea Lamprey
Match: zgc:110789 (zgc:110789 [Source:ZFIN;Acc:ZDB-GENE-050306-38])

HSP 1 Score: 249.21 bits (635), Expect = 8.114e-76
Identity = 149/436 (34.17%), Postives = 244/436 (55.96%), Query Frame = 1
Query:  448 KLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRL----------------LNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYP-CQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGN 1704
            +LPI+QG +F  V P+++LL+ PE K      NI         T+PE    +  R+                + GA++++S +EI +  SGL+  + + + PL +A   +++ L+L +         W I  M + L V+    +  + LPIP    N   + K F+ F++ P+++A+GI W+LC ILT+  VF ++P+ +G+ ARTD +  A+  +   +FPYP C+   P +  + ++G++  I+ SI+ESVGDY   A +  AP  P+ A+NRGI +EGIG  L+G  G+    TSYS NIG + ITK G+  +   + ++M+L G+    GA+F++IP PV+GG+  +    +   G++N Q++D  STRNI I+GFS   GL  P W   N  ++  G + LD+I+ +LLT  +F+     + LD  +PG 
Sbjct:   28 RLPILQGGTFAFVTPTVALLSLPEWKCPETPLNI---------TSPEHEENWHSRMRTSGYWHLSVRNGGGGVQGAVLVASTVEIVLGFSGLVGFVLRFVGPLCVAPTVSLIGLSLFKVASNDAGTHWGISAMTIFLIVLFSQYMKNLALPIP--TYNKGCRIKWFQAFKLLPVLLAMGISWLLCYILTVCDVFPSDPQAYGHVARTDVRAAALQKSPWFRFPYPECETAVPTVSAAGVLGILAGIVSSIVESVGDYYACARLVGAPPPPRHAVNRGIGMEGIGCLLAGAWGTGNGTTSYSENIGAIGITKVGSRMVIVTAGSMMLLLGMLGKVGAVFVTIPTPVIGGMFMVTFGIITAIGVSNLQFVDMNSTRNIFIFGFSTFAGLAVPGWLMDNPDILQTGVRELDQILQVLLTTSMFVGGFLGLLLDVTIPGT 452          
BLAST of slc23a-2 vs. Ensembl Sea Lamprey
Match: slc23a2 (solute carrier family 23 member 2 [Source:ZFIN;Acc:ZDB-GENE-090521-3])

HSP 1 Score: 153.68 bits (387), Expect = 3.491e-42
Identity = 90/276 (32.61%), Postives = 160/276 (57.97%), Query Frame = 1
Query:  430 QTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAP-EAVALFKIRL---LNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGI 1245
            Q  LG +LP+ Q ++F  + P+ ++L+  + K C  ++ +     + S+T P +   ++  R+   + GAI++S L+E+ + + G+  +L   I PL++A   +++ L++     +   + W I ++ +VL ++       V LP+   K    W   R ++F+M PI++A+ I W+LC +LT + VF +    +GY ARTD + + I  A   + PYPCQWG P +  + +IG+++A++ SI+ES+GDY   A +  AP  P  AINRGIF+EG+
Sbjct:   40 QRALGVRLPLFQASAFAFLAPAQAILSLDKWK-CPDTDAM----FANSTTQPLDTSEIWHPRMREKIQGAIIVSCLVEVVIGLLGVPGVLLAYIGPLTVAPTVSLIGLSVFPAAGERAGKHWGIAMLTIVLVILFSQYFRNVHLPLLGYKRGKGWTVYRVQVFKMFPIIIAIVIAWLLCYVLTETNVFPSELATYGYHARTDARGEVISIAPWFRIPYPCQWGMPTVTAAGVIGMMSAMLASIVESIGDYYACARLAGAPPPPIHAINRGIFMEGL 310          
BLAST of slc23a-2 vs. Ensembl Sea Lamprey
Match: slc23a1 (solute carrier family 23 member 1 [Source:ZFIN;Acc:ZDB-GENE-080804-2])

HSP 1 Score: 97.8265 bits (242), Expect = 8.256e-23
Identity = 60/217 (27.65%), Postives = 112/217 (51.61%), Query Frame = 1
Query:  229 DMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIP-FSKSNG 876
            DM Y     PPWYL + LG QH+LT  +G      +++  +C+       S+LI + F V+GI++ LQT  GC+LP+ Q ++F  ++P+ ++L   + K  + S         I  T+       +IR + G+I++S L+E+F+  +GL   +   I PL++    +++ L++ +         W I  M ++L ++    L   ++P+P + +  G
Sbjct:   75 DMIYKIEDVPPWYLCLLLGFQHYLTCFSGTIAVPFLLAEAMCVGKDQVAISQLIGTIFTVVGITTLLQTTFGCRLPLFQASAFAFLVPARAILALDKWKCPDASTIYPNGTNGILDTS--ETWHPRIREIQGSIIVSCLVEVFIGFAGLPGAMLSYIGPLTVTPTVSLIGLSVFQAAGDRAGRHWGISAMAILLIILFSQYLRNTSVPVPVYRRGQG 289          
BLAST of slc23a-2 vs. Ensembl Nematostella
Match: EDO49567 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGN5])

HSP 1 Score: 326.635 bits (836), Expect = 5.414e-104
Identity = 184/568 (32.39%), Postives = 314/568 (55.28%), Query Frame = 1
Query:  232 MDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIP-FSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENGSKSVENCNKSHSELEKSLAFDFIYLRWVALKFPCLQILPLFPAY----RNLREEQVLDLEDSR 1920
            M Y  +  PPWY  ++LG QH+LTM  G      I+S  +C  ++  + +E++S+ F V GIS+ LQT  G +LPIIQG +F  + P+ ++L+ P+ K    + N  + K              ++R + GAIM+SSL +IF+  SG++  L + I P+++A   T++ L+L     +     W +G M + L  +   +L+ + +PIP +S+  G +    + +F++ PI++A+ + W++C I+T +G F  +PK   + ARTD +   + ++   +FPYP QWGTP +  + + G++  ++ SIIESVGDY   A +C AP  P+ A+NRGI +EGIG  ++G  GS    TSYS NIG + ITK G++R+ Q +  I+++ G+    GA+F ++P+P+VGGV  ++   +   GI+N Q+I+  S+RN+ I G S+  G   P +   + + I  G + +D+I+ +LL   + +  ++ + LDN LPG       +   +  ++  +  N+  S     L F    L     KF   + LP  P Y     +  EE  + + + +
Sbjct:    1 MAYVVDENPPWYACLSLGFQHYLTMLGGTLSIPFILSGPMCFSNNPLVVAEVLSTIFFVSGISTLLQTTFGVRLPIIQGGTFSFLAPTFAILSLPQFKCPASTANATIDK--------SGDWRIRMREIQGAIMVSSLFQIFIGFSGVMGFLLRFIGPIAVAPTITLIGLSLFHVAAEHAGNHWGVGFMTVSLITIFSQVLTNIKVPIPAYSREKGYYT-AHYPVFRLFPIILAIFVSWVICAIITAAGGFPDDPKNPNFLARTDARTIVLRESNWFRFPYPGQWGTPTVSAAGVFGMLAGVLASIIESVGDYYACARLCGAPPPPKHAVNRGIGVEGIGCLITGLWGSGNGTTSYSENIGALGITKVGSLRVIQYAGLILVVMGVVGKIGALFTTVPDPIVGGVFMVMFGMVAAVGISNLQFINLNSSRNLFIIGVSLMLGFALPWFLNKHPEAIKTGSQGIDQIVTVLLKTSMAVGGITGLILDNALPGTPEERGILLWRKIVTEGGDESNQVASFHIYDLPFGLNRL----CKFKIAKYLPFVPYYPVSLHDESEEATVGMMEGK 555          
BLAST of slc23a-2 vs. Ensembl Nematostella
Match: EDO43651 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY77])

HSP 1 Score: 322.783 bits (826), Expect = 3.790e-102
Identity = 187/514 (36.38%), Postives = 298/514 (57.98%), Query Frame = 1
Query:  178 RTYHMDETCKEDNVAE---NDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLT-SPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFK-RFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGN 1704
            R     E  KE+  A+   ++++Y  +  PPWYL I LG+QH+LTM        +I++  +C  +    KSE+IS+ F V G+ + +QTILG +LPI+QGA+F  + P+ ++L    E  +  G  N+   +    S  P      ++R + GAIM++SL +I +  +G++  L + I PL++A   T++ L L           W I  M +VL ++    L  +  P+P S   G+  F  +  IF++ PI+MA+ I W++C I+T SG F ++P    Y ARTD +   +  AK  +FPYP QWGTP +  + + G++  ++ S+IES+GDY   A +  AP  P  A+NRGI +EGIG  L+G  GS    TSYS NIG + ITK  + R+ Q ++ +M++      FGA+F++IP+P+VGGV  ++   +   GI+N Q++D  S+RN+ ++GFS+  G+  P+W  SN  +I  GY+ LD+II +LL+ ++F+       LDN +PG 
Sbjct:    7 RDTKEAEEIKEEVSAKKELSELNYYIDETPPWYLCILLGLQHYLTMFGSTVAVPLILAAPMCYDNSPLAKSEIISTIFFVSGLCTLIQTILGNRLPIVQGATFAFLAPTGAILNLYGECPAQTG--NLTAAEYDEISWKP------RMREIQGAIMVASLFQILIGFTGMVGFLLRFIGPLTIAPTVTLVGLALFGAAANFSGVHWGISAMTIVLIIMFSQYLRNIEFPVP-SYERGRGCFAGKLAIFRLFPIIMAIVISWVVCVIITASGGFPSSPTNSQYMARTDARIDVLNKAKWFRFPYPGQWGTPTVSMAGVFGMLAGVLASMIESIGDYFACARLSGAPPPPTHAVNRGIGVEGIGCLLAGAWGSGNGTTSYSENIGAIGITKVASRRVVQAAAIVMLVLACLGKFGALFVTIPDPIVGGVFMVMFGMITAVGISNLQFVDMNSSRNLFVFGFSMMLGMALPSWMQSNSGVIQTGYRELDQIITVLLSTNMFVAGFVGCILDNTVPGT 511          
BLAST of slc23a-2 vs. Ensembl Nematostella
Match: EDO49565 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGN3])

HSP 1 Score: 320.087 bits (819), Expect = 8.199e-101
Identity = 181/573 (31.59%), Postives = 310/573 (54.10%), Query Frame = 1
Query:  187 HMDETCKEDNVAEND------MDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENGSKSVENCNKSHSELEKSLAFDFIYLRWVAL----KFPCLQILPLFPAY 1875
            H +E  + +++          + Y  +  PPWY  ++LG QH+LTM  G      I+S  +C  ++  + +E++S+ F V GIS+ LQT  G +LPI+QG +F  + P+ ++L+ P+ K    +    +   + ++T        ++R + GAIM+SSL +IF+  SG++  L + I P+++A   T++ L+L     +     W +  M + L  +   +L+ + +P+   +    +      IF++ PI++A+ + W++C I+T +G F  +PK   + ARTD +   + ++   +FPYP QWGTP +  + + G++  ++ SIIESVGDY   A +  AP  P+ AINRGI +EGIG  ++G  GS    TSYS NIG + ITK G++R+ Q +  I+++ G+    GA+F ++P+P+VGGV  ++   +   GI+N Q++D  S+RN+ I G S+  G   P +   + + I+ G + +D+II +LL   + +  ++ +FLDN +PG           E G            +   SLA  +IY     L    K P  + LP  P Y
Sbjct:   24 HSNEHPQNNDIETKKRRKALGLAYVVDENPPWYACLSLGFQHYLTMLGGTLSIPFILSGPMCFSNNPLVVAEVLSTIFFVSGISTLLQTTFGVRLPIVQGGTFSFLAPTFAILSLPQFKCPTDTVTDGLNITANATTDNSGDWRIRMREIQGAIMVSSLFQIFIGFSGVMGFLLRFIGPIAVAPTITLIGLSLFHVAAEHAGNHWGVAFMTVALITIFSQILTNIKVPLLGYRFKKGFFVVHCPIFKLFPIILAIFVSWVICAIVTAAGGFPDDPKHPNFLARTDARTIVLRESNWFRFPYPGQWGTPTVSAAGVFGMLAGVLASIIESVGDYYACARLSGAPPPPKHAINRGIGVEGIGCLITGLWGSGNGTTSYSENIGALGITKVGSLRVIQYAGLILVVMGVVGKIGALFTTVPDPIVGGVFMVMFGIVTAVGISNLQFVDLNSSRNLFIIGVSLMLGFALPWYLDKHPEAIATGLREIDQIITVLLKTSMAVAGITGLFLDNAIPGT--------PEERGIYRWRTIVTQEGDESGSLASIYIYDLPFGLNRLSKLPIARFLPFLPYY 588          
BLAST of slc23a-2 vs. Ensembl Nematostella
Match: EDO49566 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGN4])

HSP 1 Score: 307.375 bits (786), Expect = 5.932e-97
Identity = 181/554 (32.67%), Postives = 305/554 (55.05%), Query Frame = 1
Query:  232 MDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAE---QWAIGXXXXXXXXXXXXXXXXXTLPIP-FSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENG----SKSVENCNKSHSELEKSLAFDFIYLRWVALKFPCLQILPLFP 1869
            + Y  +  PPWY  ++LG QH+LTM  G      ++S  +C  ++  + +E++S+ F V GIS+ LQT  G +LPI+QG +F  + P+ ++L+ P+ K    + N  +        +   +    + L+ GAIM+SSL +IF+  SG++  L + I P+++A   T++ L+L      + AE   QW +  M + L  +   +L+ + +PIP +S+  G +      +F++ PI++A+ + W++C I+T +G F  NPK   + ARTD +   + ++   +FPYP QWGTP +  + + G++  ++ S+IESVGDY   A +  AP  P+ AINRGI +EGIG  ++G  GS    TSYS NIG + ITK G++R+ Q +  I+++ G+    GA+F  IP+P+VGGV  ++   +   GI+N Q+I+  S+RN+ I G S+  G   P +   + + I+ G + +D+I+ +LL   + +  ++ + LDN LPG           E G     K V       S++     +D  +      KF   + LP  P
Sbjct:    1 LAYVVDENPPWYACLSLGFQHYLTMLGGTLSIPFVLSGPMCFSNNPLVVAEVLSTIFFVSGISTLLQTTFGVRLPIVQGGTFTFLAPTFAILSLPQFKCPASTANATIHN------SGSFICFLFLVLIQGAIMVSSLFQIFIGFSGVMGFLLRFIGPITVAPTITLIGLSL----FHVAAERCCQWGVAFMTVALITIFSQVLTNIKVPIPAYSREKGYYN-AHCPVFRLFPIILAILVSWVICAIITAAGGFPDNPKHPNFFARTDARTIVLRESNWFRFPYPGQWGTPSVSAAGVFGMLAGVLASMIESVGDYYACARLSGAPPPPKHAINRGIGVEGIGCLITGLWGSGNGTTSYSQNIGAIGITKVGSLRVIQYAGLILVVLGVVGKIGALFTIIPDPIVGGVFMVMFGMVAAVGISNLQFINLNSSRNLFIIGVSLMLGFALPWYLNKHPETIATGSQGIDQIVTVLLKTSMAVGGITGLILDNALPGT--------PEERGILLWRKIVNEGGDESSQVASFHIYDLPFGLNRLCKFKIAKYLPFVP 535          
BLAST of slc23a-2 vs. Ensembl Nematostella
Match: EDO43780 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXI6])

HSP 1 Score: 306.99 bits (785), Expect = 1.613e-95
Identity = 189/554 (34.12%), Postives = 305/554 (55.05%), Query Frame = 1
Query:  238 YDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLN--GAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIP-FSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFP----AWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENGSKSVENCNKSHSELEKSLAFDF-IYLRWVALKFPCLQILPLFPAY 1875
            Y  N  PPWYL I LG QH+LTM   N    + +  Y+C + +    SE+I++ F   GI++ LQT  G +LPI+QG++F  + P+ ++LT  + K    S N     +  + TA +   ++K R+L   GAIM++SL ++ + V+GL+ +L + I P+++A   T++ L L E      A+QW + IM +VL  +    L  + +P P +SK  G      + +F++ PI++A+ + W++C I+T +          G + RTDTK   +  AK  + PYP QWG P +  + + G++  +I SI+ESVGDY   A +C AP  P  AINRGI IEG+G  ++G  G+ +  TSYS NIG + ITK G++R+ Q  + + ++ G+    GA+F +IP+P+VGGV  ++   +   GI+N QY+D  S RN+ I G S+  G+  P    A   ++  LI  G   +D+II +LLT ++ +  + ++FLDN +PG           + GS   E       ++     +D    L+ +  K P  + +P  P Y
Sbjct:   26 YMINETPPWYLCILLGFQHYLTMLGANLAVPLALRKYMCFETNDLALSEVIATVFFTSGIATLLQTTFGVRLPIVQGSTFTFIAPATAILTLDKFKCPEPSSN---ATLGANETAIDMNEIWKPRMLEIQGAIMVASLFQVLIGVTGLMGVLLRFIGPVAIAPTITLIGLALFEVAAYHSAKQWGVAIMTVVLIALFSQYLQNIKIPFPGYSKERG-CHMNFYPVFRLFPIILAICVSWMVCAIVTAADGLPV-----GNAGRTDTKVGTLQKAKWFRVPYPGQWGLPTVSVAGVFGMLAGVIASIVESVGDYYACARMCGAPPPPTHAINRGIGIEGLGCIITGAWGTGSGTTSYSENIGAIGITKVGSLRVIQFGALVALVMGVVGKVGALFTTIPDPIVGGVFLVMFGMITAVGISNLQYVDMTSARNMFIVGVSIVAGMAIPFSLKAMFEADKNLIQTGSMEVDQIIKVLLTTNIAVGGLIALFLDNTIPGTAKERGITAWRKRGSGK-EGGEDEDFQVAPIHVYDLPCCLKSLGYK-PFAKYVPFLPYY 568          
BLAST of slc23a-2 vs. Ensembl Medaka
Match: si:dkey-106n21.1 (solute carrier family 23 member 2-like [Source:NCBI gene;Acc:101175057])

HSP 1 Score: 326.25 bits (835), Expect = 6.962e-103
Identity = 196/583 (33.62%), Postives = 325/583 (55.75%), Query Frame = 1
Query:  190 MDETCKEDNVAENDMD------YDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISST------APEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENGSKSVENCNKSHSELEKSL---AFDFIYLRWVALKFPCLQILPLFPAYRNLREE 1893
            +D   + +NV E+ +D      Y  N  PPWYL I LG QH++    G     +I++  LC+QD++  KS+LIS+ F V G+ + LQT +G +LPI+QG +F  + P++++L  P+ +  +      +  ++ + T        + V + +IR + GAI++SSL++IF+ +SGL+  + K I PL++A    ++ L+L     +     W I  + + L ++    LS+V +P+   K   +W+  ++ +F++   +  +   W++C +LT+  V  +    +G++ARTD    A+ ++  +  PYP QWG P +  S+++G++  ++ S +ES+GDY   A +  AP  P  AINRGI +EGIG  L+   G+    TSYS NI  + ITK G+  + Q +  +MI+ GIF  FGA+FI+IP+PV+GG+  ++   +   GI+N QY+D  S+RN++I GFS   GL  P+W  SN  +I  G K LD++I +L T H+FI       LDN +PG           E G K+ +  +K   E+  S     +D  +   V  +  C Q LP  P+Y+N +E 
Sbjct:   27 VDMEPQTENVLEDPVDRGVDLVYSLNDRPPWYLCILLGFQHYILAFGGIIAVPLILAEPLCIQDNNGAKSQLISTIFFVSGLCTLLQTAVGTRLPILQGGTFSFITPTLAILALPKWQCPSPKSPAMLSVLTANDTRLLEVEESDEVWMSRIREIQGAILVSSLLQIFLGLSGLVGFVLKYIGPLAIAPTINLIGLSLFIEAGKKCGGHWGIAALTVCLILLFSQYLSKVNVPMIAYKEK-KWKVFQYPLFKLFSALFGMCGSWLVCFLLTVFDVLPSKSDQYGFAARTDISMDAVTNSPWINVPYPGQWGVPTVSLSSVLGMMAGVLASTMESIGDYYACARLSGAPPPPTHAINRGIAVEGIGCILAALWGTGNGTTSYSQNIAALGITKVGSRLVLQTTGILMIVLGIFGKFGAVFITIPDPVIGGMFLVMFGMIAAVGISNLQYVDLNSSRNLLILGFSTFSGLVLPSWFHSNPGIIDTGLKELDQVIVVLFTTHMFIGGFFGFILDNTIPGTD--------KERGIKNWQ--DKVQEEMNSSCDLSCYDIPFCHSVFKRLKCFQYLPFLPSYKNTKER 598          
BLAST of slc23a-2 vs. Ensembl Medaka
Match: zgc:110789 (solute carrier family 23 member 1 [Source:NCBI gene;Acc:101157211])

HSP 1 Score: 322.013 bits (824), Expect = 2.959e-101
Identity = 197/563 (34.99%), Postives = 305/563 (54.17%), Query Frame = 1
Query:  190 MDETCKEDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALF--KIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENGSKSVENCNKSHSELEKSLAFD-------FIYLRWVALKFPCLQ 1851
            +D +  EDN   N + Y     PPWYL I LG QH LT   G     +I+S  LCLQ     +S LIS+ F V GI + LQ   G +LPI+QG +F  + PS+++L+ PE      ++N  +    +++++ E + ++  ++R L G+I++ SL ++F+  SGL+ L  + I PL++A   +++ L+L ++        W I  M   L ++    L  +++P P    + +    R  +FQ+ P+++ +   W++C ILT   V   +P  +GY ARTD K   I  A  + FPYP QWG P +  + ++G++  +I S+IESVGDY   A +  AP  P+ AINRGI IEG+G  L+G  G+    TSYS N+G + ITK G+  +   S  +MI+ G+    GAIF +IP+PV+GG+  ++   +   G++N QY D  S+RNI I+GFS+  GL  P W   N K I+ G   LD+++ +LLT  +F+       LDN +PG         L  N +   +  N   S    SL F        F +LR++    P LQ
Sbjct:   31 LDSSIDEDN---NKLAYCVTDVPPWYLCILLGTQHCLTAFGGIIAIPLILSQGLCLQHDGLTQSHLISTIFFVSGICTLLQVTFGIRLPILQGGTFTLLAPSMAMLSMPEWTCPAWTQNASL----VNTSSVEFIEVWQSRMRALQGSIIVGSLFQVFVGFSGLIGLFVRFIGPLTIAPTISLIGLSLFDSAGSSAGNHWGISSMTTALIILFSQYLRHISVPFPTYNKHKKLHTSRIYLFQILPVLLGITFSWLICYILTTCNVLPADPDHYGYLARTDLKGNVIEQAPWLTFPYPGQWGIPTVSLAGVVGILAGVISSMIESVGDYHACARLSGAPPPPKHAINRGIGIEGLGCLLAGAWGTGNGTTSYSENVGALGITKVGSRVVIVASGVLMIVMGVLGKVGAIFTTIPSPVMGGMFMVMFGVICAAGVSNLQYTDMNSSRNIFIFGFSMFSGLVIPNWILKNPKAIATGVVELDQMLQVLLTTSMFVGGFFGFILDNTVPGTKQERGI--LAWNKAHEDDCSNTLESGEVYSLPFGISAYFSTFSWLRYIPFCPPGLQ 584          
BLAST of slc23a-2 vs. Ensembl Medaka
Match: ENSORLT00000012439.2 (solute carrier family 23 member 1 [Source:NCBI gene;Acc:101173186])

HSP 1 Score: 315.464 bits (807), Expect = 8.745e-99
Identity = 187/523 (35.76%), Postives = 290/523 (55.45%), Query Frame = 1
Query:  184 YHMDETCK--------------EDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALF--KIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGN 1704
            +HMDE                 ED V  N   Y     P WYL I L VQH+LT   G     +I+S  LCLQ  S  +S LI++ F V GI + LQ  LG +LPI+QG +F  V P++++LT P+ K    ++N  +    +++++PE V ++  ++R L G+IM++S++++ +  SGL+  L + I P+++A   +++ L+L E+        W I  M  VL ++    L  + +P+P    + +     F +FQ  PI++ L + W++C +LT+  V   +   +G+ ARTD K   + +A   + PYP QWG P +  +A+ G++  II S+ ESVGDY   A +  AP  P  AINRGI +EG+G  L+G  G+    TS+S N+  + ITK G+  +  +S   MIL G+    GA+F +IP PV+GG+  I+   +   GI+N QY+D  S+RNI ++GFS+   L  P W T N   +  G   LD+++ IL T H+FI      FLDN +PG 
Sbjct:   15 FHMDEQVIGQLSGQPKTNDVKCEDGVDRNKPTYCVTDVPSWYLCIFLAVQHYLTAFGGIISIPLILSEGLCLQHDSLTQSLLINTIFFVSGICTLLQVTLGVRLPILQGGTFALVTPAMAMLTMPDWKCPAWTQNASL----VNTSSPEFVEVWQSRLRTLQGSIMVASVLQVLVGFSGLIGFLMRFIGPMTIAPTVSLIGLSLYESAGDKAGSHWGISAMTAVLIILFSQYLRLIQVPLPAYSKSKKLHTSNFFMFQTMPILLGLAVSWLVCYLLTIYDVLPKDSAEYGHLARTDVKGNVVSEASWFRVPYPGQWGVPTVNLAAVFGMLAGIICSMAESVGDYHACARLSGAPPPPNHAINRGIGVEGVGSLLAGAFGTGNGTTSFSENVAALGITKVGSRTVILLSGIFMILMGVLGKIGAVFATIPTPVIGGMFIIMFGVITAAGISNLQYVDMNSSRNIFVFGFSLFSALVIPNWITKNPGYLQTGITELDQVLRILFTTHMFIGGFFGFFLDNTIPGT 533          
BLAST of slc23a-2 vs. Ensembl Medaka
Match: ENSORLT00000012440.2 (solute carrier family 23 member 1 [Source:NCBI gene;Acc:101173186])

HSP 1 Score: 315.464 bits (807), Expect = 8.745e-99
Identity = 187/523 (35.76%), Postives = 290/523 (55.45%), Query Frame = 1
Query:  184 YHMDETCK--------------EDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALF--KIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGN 1704
            +HMDE                 ED V  N   Y     P WYL I L VQH+LT   G     +I+S  LCLQ  S  +S LI++ F V GI + LQ  LG +LPI+QG +F  V P++++LT P+ K    ++N  +    +++++PE V ++  ++R L G+IM++S++++ +  SGL+  L + I P+++A   +++ L+L E+        W I  M  VL ++    L  + +P+P    + +     F +FQ  PI++ L + W++C +LT+  V   +   +G+ ARTD K   + +A   + PYP QWG P +  +A+ G++  II S+ ESVGDY   A +  AP  P  AINRGI +EG+G  L+G  G+    TS+S N+  + ITK G+  +  +S   MIL G+    GA+F +IP PV+GG+  I+   +   GI+N QY+D  S+RNI ++GFS+   L  P W T N   +  G   LD+++ IL T H+FI      FLDN +PG 
Sbjct:   15 FHMDEQVIGQLSGQPKTNDVKCEDGVDRNKPTYCVTDVPSWYLCIFLAVQHYLTAFGGIISIPLILSEGLCLQHDSLTQSLLINTIFFVSGICTLLQVTLGVRLPILQGGTFALVTPAMAMLTMPDWKCPAWTQNASL----VNTSSPEFVEVWQSRLRTLQGSIMVASVLQVLVGFSGLIGFLMRFIGPMTIAPTVSLIGLSLYESAGDKAGSHWGISAMTAVLIILFSQYLRLIQVPLPAYSKSKKLHTSNFFMFQTMPILLGLAVSWLVCYLLTIYDVLPKDSAEYGHLARTDVKGNVVSEASWFRVPYPGQWGVPTVNLAAVFGMLAGIICSMAESVGDYHACARLSGAPPPPNHAINRGIGVEGVGSLLAGAFGTGNGTTSFSENVAALGITKVGSRTVILLSGIFMILMGVLGKIGAVFATIPTPVIGGMFIIMFGVITAAGISNLQYVDMNSSRNIFVFGFSLFSALVIPNWITKNPGYLQTGITELDQVLRILFTTHMFIGGFFGFFLDNTIPGT 533          
BLAST of slc23a-2 vs. Ensembl Medaka
Match: slc23a2 (solute carrier family 23 member 2 [Source:NCBI gene;Acc:101156743])

HSP 1 Score: 303.908 bits (777), Expect = 3.393e-94
Identity = 187/578 (32.35%), Postives = 315/578 (54.50%), Query Frame = 1
Query:  190 MDETCKEDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENGSKSVENCNK-SHSELEKSLAFDFIYLRWVALKFPCLQILPLFPAYRNLREEQVLDLEDSR 1920
            +D T   D     DM Y     PPWYL + LG+QH+LT  +G      +++  +C+    +  S+LI + F  +GI++ LQT  GC+LP+ Q ++F  + P+ ++L+  + K CN +E   +    +  T  E +   +IR + GAI++S LIE+ + + GL  +L K I PL++     ++ L+  +   +   + W I ++ + L ++       V  P+P  K+   W   R ++F+M PI+MA+ + W+LC I T++ VF      +G+ ARTD +   +  A   K PYP QWG P +  + +IG+++A++ SIIES+GDY   A +  AP  P  AINRGIF+EGI   L G  G+    TS S NIGV+ ITK G+ R+ Q  +A+M+L G+   F A+F S+P+PV+G +   +   +   G++N Q++D  S+RN+ + GFS+ FGL  P++   N   +  G   +D+++++LLT  +F+    +  LDN +PG+        L E G + ++  +  S +ELE   ++D  +      +    + +P+ P +      +  D   SR
Sbjct:   41 LDSTGSTD-ARRMDMIYTIEDTPPWYLCVFLGLQHYLTCFSGTIAVPFLLAEAMCVGSDQWATSQLIGTIFFCVGITTLLQTTFGCRLPLFQASAFAFLAPAKAILSLDKWK-CNNTEFPGLNGTELLHT--EHIWHPRIREIQGAIIVSCLIEVCIGLLGLPGMLLKYIGPLTITPTVALIGLSGFQAAGERAGKHWGIAMLTIFLVLLFSQYARNVHFPLPIYKAKKGWTSYRLQVFKMFPIIMAILVSWLLCFIFTVTDVFPPEKDKYGFYARTDARQGILTAAPWFKVPYPLQWGMPTVTAAGVIGMMSAVVASIIESIGDYYACARLSCAPPPPIHAINRGIFVEGISCVLDGLFGTGNGSTSSSPNIGVLGITKVGSRRVIQYGAAMMLLLGLVGKFSALFASLPDPVLGALFCTLFGMITAVGLSNLQFVDLNSSRNLFVLGFSIFFGLMLPSYLKQNP--LVTGIVEIDQVLNVLLTTAMFVGGSVAFILDNTIPGS--------LEERGIRKLKRGSGLSAAELEGMNSYDLPFGMDFIRRHSIFKHIPISPTFTGYHWGRRKDSIKSR 604          
BLAST of slc23a-2 vs. Planmine SMEST
Match: SMESG000066904.1 (SMESG000066904.1)

HSP 1 Score: 726.087 bits (1873), Expect = 0.000e+0
Identity = 364/574 (63.41%), Postives = 469/574 (81.71%), Query Frame = 1
Query:  190 MDETCKEDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENGSKSVENCNKSHSELEKSLAFDFIYLRWVALKFPCLQILPLFPAYRNLREEQVLDLE 1911
            M+   K +   +NDMDYDFN PPPWY+S+ALG+QHFL+MCAGNA  T+I++NYLCL D+S IKSELISSSF VMGISSFLQTI GCKLPIIQGASF CVLP++SLL  P++KSCN S N   Q ++++S   E + L KIRL+NGAIM+SSL+EI ++VSGLL +LT+LISPLSLAAI+TVLSLN+SE+LL+M++EQW IGI+GM++SVV +V+LS V +PIP S+  G W+F + KIFQ+CPI+++LG LWI+C ILT S + S +PKGWGYSARTD KF+AIYD+KI K PYP QWG PLL+PSAI+G+   I++S IESVGDYMIT+  C+AP +PQFAINRGI +EG GVFLSG LG++T PTSYSGNIG+ K+TKAGN+ I Q+++ IM+LCGIFP+FGA+F+SIPN +VGGVLFIVCL +MGC INNFQYID  STRN+I++GFSVSFGLYFPAW TS++ +ISVGY+P+DEI+ ILL+IHLFIVAVS+I LDN+LPG++ GNK   +        ++ ++ +++LE+  AFD   ++W+A+   CLQILP+FPAYR  +  +  + E
Sbjct:    1 MNHPNKVNGTDKNDMDYDFNRPPPWYISMALGIQHFLSMCAGNAFATMIIANYLCLPDNSPIKSELISSSFFVMGISSFLQTICGCKLPIIQGASFACVLPTLSLLQMPDLKSCNISSNRMFQSLNLTSL--EDLPLMKIRLMNGAIMVSSLVEIIISVSGLLGILTRLISPLSLAAIYTVLSLNISESLLKMMSEQWVIGILGMIISVVSVVILSPVPIPIPVSRRGGNWKFIKVKIFQICPIIISLGSLWIVCAILTASNLLSKSPKGWGYSARTDIKFKAIYDSKIFKIPYPGQWGMPLLIPSAIVGLTAGILISTIESVGDYMITSMACRAPKIPQFAINRGILVEGSGVFLSGLLGAVTCPTSYSGNIGLFKLTKAGNVIIGQMTAFIMLLCGIFPVFGAVFVSIPNSIVGGVLFIVCLLVMGCAINNFQYIDINSTRNVIVFGFSVSFGLYFPAWITSHLHMISVGYEPVDEILRILLSIHLFIVAVSAIVLDNILPGHYSGNKKSEIVNESKDQTKDQDEEYTKLERFEAFDNKVMKWLAVNLECLQILPIFPAYRKFKGNRKNNFE 572          
BLAST of slc23a-2 vs. Planmine SMEST
Match: SMESG000066923.1 (SMESG000066923.1)

HSP 1 Score: 555.058 bits (1429), Expect = 0.000e+0
Identity = 302/303 (99.67%), Postives = 303/303 (100.00%), Query Frame = 1
Query:  190 MDETCKEDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLL 1098
            MDETCKEDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGIMGMVLSVVLIVMLSQVTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPL+
Sbjct:    1 MDETCKEDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGIMGMVLSVVLIVMLSQVTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLV 303          
BLAST of slc23a-2 vs. Planmine SMEST
Match: SMESG000066905.1 (SMESG000066905.1)

HSP 1 Score: 546.199 bits (1406), Expect = 0.000e+0
Identity = 298/303 (98.35%), Postives = 300/303 (99.01%), Query Frame = 1
Query:  190 MDETCKEDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIVSNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVLPSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGXXXXXXXXXXXXXXXXXTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLL 1098
            MDETCK+DNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAI TIIVSNYLCLQDHSFIKSELISSS LVMGISSFLQTILGCKLPIIQGASFVCVL SISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGIMGMVLSVVLIVMLSQVTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPL+
Sbjct:    1 MDETCKKDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAIMTIIVSNYLCLQDHSFIKSELISSSILVMGISSFLQTILGCKLPIIQGASFVCVLSSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMISSLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAIGIMGMVLSVVLIVMLSQVTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGILWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGTPLV 303          
BLAST of slc23a-2 vs. Planmine SMEST
Match: SMESG000066926.1 (SMESG000066926.1)

HSP 1 Score: 432.95 bits (1112), Expect = 6.850e-150
Identity = 220/252 (87.30%), Postives = 220/252 (87.30%), Query Frame = 1
Query: 1168 MITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVGYKPLDEXXXXXXXXXXXXVAVSSIFLDNVLPGNFYGNKCIHLTENGSKSVENCNKSHSELEKSLAFDFIYLRWVALKFPCLQILPLFPAYRNLREEQVLDLEDSRL 1923
            MITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISV                                GNFYGNKCIHLTENGSKSVENCNKSHSELEKSLAFDFIYLRWVALKFPCLQILPLFPAYRNLREEQVLDLEDSRL
Sbjct:    1 MITADVCKAPNMPQFAINRGIFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISV--------------------------------GNFYGNKCIHLTENGSKSVENCNKSHSELEKSLAFDFIYLRWVALKFPCLQILPLFPAYRNLREEQVLDLEDSRL 220          
BLAST of slc23a-2 vs. Planmine SMEST
Match: SMESG000066926.1 (SMESG000066926.1)

HSP 1 Score: 247.669 bits (631), Expect = 1.018e-78
Identity = 126/126 (100.00%), Postives = 126/126 (100.00%), Query Frame = 1
Query: 1228 IFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVG 1605
            IFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVG
Sbjct:   33 IFIEGIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIFPIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGFSVSFGLYFPAWCTSNIKLISVG 158          
The following BLAST results are available for this feature:
BLAST of slc23a-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC23A21.112e-9131.83solute carrier family 23 member 2 [Source:HGNC Sym... [more]
SLC23A21.112e-9131.83solute carrier family 23 member 2 [Source:HGNC Sym... [more]
SLC23A11.240e-9132.66solute carrier family 23 member 1 [Source:HGNC Sym... [more]
SLC23A11.218e-9032.05solute carrier family 23 member 1 [Source:HGNC Sym... [more]
SLC23A25.131e-5639.84solute carrier family 23 member 2 [Source:HGNC Sym... [more]
back to top
BLAST of slc23a-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C51E3.64.963e-5930.28pep chromosome:WBcel235:V:10164135:10166463:-1 gen... [more]
R11E3.21.456e-5427.19pep chromosome:WBcel235:IV:4772092:4775133:1 gene:... [more]
T07G12.22.037e-5327.10pep chromosome:WBcel235:IV:10530709:10532915:1 gen... [more]
T07G12.48.456e-4926.40pep chromosome:WBcel235:IV:10536736:10538684:-1 ge... [more]
T07G12.54.232e-4629.35pep chromosome:WBcel235:IV:10541495:10545091:-1 ge... [more]
back to top
BLAST of slc23a-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG62934.726e-8128.52gene:FBgn0037807 transcript:FBtr0337051[more]
CG62934.726e-8128.52gene:FBgn0037807 transcript:FBtr0082240[more]
back to top
BLAST of slc23a-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1107895.150e-10235.39zgc:110789 [Source:ZFIN;Acc:ZDB-GENE-050306-38][more]
zgc:1107895.150e-10235.39zgc:110789 [Source:ZFIN;Acc:ZDB-GENE-050306-38][more]
si:dkey-106n21.12.033e-9833.67si:dkey-106n21.1 [Source:ZFIN;Acc:ZDB-GENE-131120-... [more]
slc23a23.300e-9632.70solute carrier family 23 member 2 [Source:ZFIN;Acc... [more]
slc23a23.300e-9632.70solute carrier family 23 member 2 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc23a-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000048921.14.319e-10836.67solute carrier family 23 member 2-like [Source:NCB... [more]
ENSXETT00000048896.15.134e-10836.65solute carrier family 23 member 2-like [Source:NCB... [more]
ENSXETT00000048874.16.720e-10837.45solute carrier family 23 member 2-like [Source:NCB... [more]
ENSXETT00000048883.11.554e-10736.67solute carrier family 23 member 2-like [Source:NCB... [more]
ENSXETT00000048916.12.515e-10637.83solute carrier family 23 member 2-like [Source:NCB... [more]
back to top
BLAST of slc23a-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc23a44.073e-10434.15solute carrier family 23 member 4 [Source:MGI Symb... [more]
Slc23a29.411e-9432.70solute carrier family 23 (nucleobase transporters)... [more]
Slc23a15.402e-9231.43solute carrier family 23 (nucleobase transporters)... [more]
Slc23a44.077e-5439.91solute carrier family 23 member 4 [Source:MGI Symb... [more]
Slc23a42.172e-4735.55solute carrier family 23 member 4 [Source:MGI Symb... [more]
back to top
BLAST of slc23a-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B0JZG0|S23A2_XENTR4.617e-9333.04Solute carrier family 23 member 2 OS=Xenopus tropi... [more]
sp|Q9EPR4|S23A2_MOUSE6.583e-9332.70Solute carrier family 23 member 2 OS=Mus musculus ... [more]
sp|Q9WTW8|S23A2_RAT8.128e-9232.53Solute carrier family 23 member 2 OS=Rattus norveg... [more]
sp|Q9Z2J0|S23A1_MOUSE3.779e-9131.43Solute carrier family 23 member 1 OS=Mus musculus ... [more]
sp|Q9UGH3|S23A2_HUMAN5.341e-9131.83Solute carrier family 23 member 2 OS=Homo sapiens ... [more]
back to top
BLAST of slc23a-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJ480.000e+0100.00Slc23a-2 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YF360.000e+063.41Slc23a-1 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A402ERG21.282e-10534.60Uncharacterized protein OS=Paroedura picta OX=1436... [more]
A0A210R6931.901e-10535.70Solute carrier family 23 member 2 OS=Mizuhopecten ... [more]
G1KKW24.433e-10534.83Uncharacterized protein OS=Anolis carolinensis OX=... [more]
back to top
BLAST of slc23a-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1107897.034e-10335.51solute carrier family 23 member 1-like [Source:NCB... [more]
si:dkey-106n21.11.370e-9932.71solute carrier family 23 member 2-like [Source:NCB... [more]
slc23a11.247e-9231.71solute carrier family 23 member 1 [Source:NCBI gen... [more]
slc23a29.008e-9232.62solute carrier family 23 member 2 [Source:ZFIN;Acc... [more]
slc23a32.441e-2724.44solute carrier family 23 member 3 [Source:NCBI gen... [more]
back to top
BLAST of slc23a-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
zgc:1107898.114e-7634.17zgc:110789 [Source:ZFIN;Acc:ZDB-GENE-050306-38][more]
slc23a23.491e-4232.61solute carrier family 23 member 2 [Source:ZFIN;Acc... [more]
slc23a18.256e-2327.65solute carrier family 23 member 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc23a-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc23a-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO495675.414e-10432.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436513.790e-10236.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495658.199e-10131.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495665.932e-9732.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437801.613e-9534.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc23a-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-106n21.16.962e-10333.62solute carrier family 23 member 2-like [Source:NCB... [more]
zgc:1107892.959e-10134.99solute carrier family 23 member 1 [Source:NCBI gen... [more]
ENSORLT00000012439.28.745e-9935.76solute carrier family 23 member 1 [Source:NCBI gen... [more]
ENSORLT00000012440.28.745e-9935.76solute carrier family 23 member 1 [Source:NCBI gen... [more]
slc23a23.393e-9432.35solute carrier family 23 member 2 [Source:NCBI gen... [more]
back to top
BLAST of slc23a-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066904.10.000e+063.41SMESG000066904.1[more]
SMESG000066923.10.000e+099.67SMESG000066923.1[more]
SMESG000066905.10.000e+098.35SMESG000066905.1[more]
SMESG000066926.16.850e-15087.30SMESG000066926.1[more]
SMESG000066926.11.018e-78100.00SMESG000066926.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30014181
GenBankAKN21561.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014181 ID=SMED30014181|Name=slc23a-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1947bp
TCTAGTGAATTACTTAATTACTTAAAATAAAAATTTTTACTATTGAAATC
AGATTTATTTGTGACTTAAGGCTTAATTTATGTGAACTGTGTCAGAATGC
TATTGACATTGTCACTAACGCGTCTTATTTATAAATAATTAACAAGTTTA
CAAATATCAAAACTCGTTGAAGTTATTCGTACGTATCATATGGATGAAAC
TTGCAAAGAAGATAATGTCGCTGAGAATGATATGGACTATGACTTCAACA
CCCCTCCTCCATGGTATCTCAGTATCGCTTTGGGAGTTCAACATTTTCTA
ACCATGTGTGCTGGGAACGCAATTACGACAATTATTGTGTCAAATTACCT
ATGTTTACAAGACCACTCTTTTATTAAATCTGAATTGATCAGTTCGAGTT
TTTTAGTCATGGGAATATCAAGCTTTCTCCAAACCATTCTAGGGTGCAAA
CTTCCCATAATTCAAGGAGCTTCTTTCGTTTGTGTTTTGCCATCAATTTC
CCTCCTGACAAGTCCGGAAATCAAGTCATGCAACGGATCGGAAAATATTC
AAATGCAGAAAATGTCGATCAGCTCCACCGCTCCAGAGGCTGTTGCACTT
TTTAAAATTCGTTTACTGAATGGAGCTATAATGATAAGCTCATTAATAGA
AATCTTCATGGCAGTATCGGGACTACTGCAGTTATTAACCAAACTAATCA
GTCCACTTTCCTTGGCCGCGATATTTACAGTTCTTTCTTTAAACTTGTCC
GAGAACCTTTTGCAAATGATCGCTGAGCAATGGGCTATTGGAATAATGGG
AATGGTCTTATCAGTCGTGTTGATTGTAATGCTATCCCAGGTAACTTTGC
CCATACCATTTTCAAAGTCCAATGGACAATGGCAATTTAAACGTTTCAAA
ATCTTTCAAATGTGTCCCATAGTTATGGCGTTGGGAATATTGTGGATTTT
GTGTGGAATATTAACCATGTCCGGCGTATTTTCAACCAACCCAAAAGGAT
GGGGATATTCTGCGAGAACTGATACGAAATTCCAAGCAATTTATGACGCA
AAAATTGTTAAATTTCCATATCCTTGTCAGTGGGGGACACCTTTGCTGCT
GCCGAGCGCAATAATTGGAGTAGTGACGGCCATCATTTTGTCCATTATTG
AAAGTGTTGGTGACTATATGATTACGGCGGACGTTTGCAAAGCACCTAAT
ATGCCCCAATTCGCAATAAATAGAGGAATCTTCATTGAAGGAATCGGAGT
ATTTTTGTCCGGTTTCTTAGGCTCGATCACTCTTCCAACGTCCTATAGTG
GTAATATCGGTGTCATGAAGATTACAAAAGCAGGAAATATCAGAATTACT
CAGGTGAGCTCAGCTATAATGATTCTGTGTGGCATATTCCCAATTTTTGG
TGCCATTTTTATCAGCATTCCAAATCCGGTAGTTGGAGGTGTTCTATTCA
TTGTATGTTTGTTCCTCATGGGATGCGGCATCAACAATTTCCAGTACATA
GACTTTCTATCAACCAGAAATATCATTATCTACGGATTTTCGGTATCCTT
TGGATTGTATTTTCCTGCCTGGTGCACATCAAATATTAAGCTCATTTCTG
TTGGATACAAACCTTTAGATGAAATTATTCATATTCTTTTAACAATTCAT
CTATTTATCGTGGCGGTCTCCTCCATATTTCTTGACAATGTTTTGCCTGG
AAATTTCTATGGAAATAAATGTATTCATTTAACTGAAAACGGAAGTAAGT
CTGTTGAAAACTGCAATAAAAGCCATTCAGAACTTGAAAAGAGCCTAGCT
TTTGATTTTATATACTTGAGATGGGTAGCTCTCAAATTTCCGTGTTTACA
GATTTTACCATTGTTTCCGGCTTATAGAAATCTTAGAGAAGAGCAAGTTT
TGGACCTTGAAGATTCTAGATTATAATAAATTGCCTGTTAATTTTCA
back to top

protein sequence of SMED30014181-orf-1

>SMED30014181-orf-1 ID=SMED30014181-orf-1|Name=SMED30014181-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=579bp
MDETCKEDNVAENDMDYDFNTPPPWYLSIALGVQHFLTMCAGNAITTIIV
SNYLCLQDHSFIKSELISSSFLVMGISSFLQTILGCKLPIIQGASFVCVL
PSISLLTSPEIKSCNGSENIQMQKMSISSTAPEAVALFKIRLLNGAIMIS
SLIEIFMAVSGLLQLLTKLISPLSLAAIFTVLSLNLSENLLQMIAEQWAI
GIMGMVLSVVLIVMLSQVTLPIPFSKSNGQWQFKRFKIFQMCPIVMALGI
LWILCGILTMSGVFSTNPKGWGYSARTDTKFQAIYDAKIVKFPYPCQWGT
PLLLPSAIIGVVTAIILSIIESVGDYMITADVCKAPNMPQFAINRGIFIE
GIGVFLSGFLGSITLPTSYSGNIGVMKITKAGNIRITQVSSAIMILCGIF
PIFGAIFISIPNPVVGGVLFIVCLFLMGCGINNFQYIDFLSTRNIIIYGF
SVSFGLYFPAWCTSNIKLISVGYKPLDEIIHILLTIHLFIVAVSSIFLDN
VLPGNFYGNKCIHLTENGSKSVENCNKSHSELEKSLAFDFIYLRWVALKF
PCLQILPLFPAYRNLREEQVLDLEDSRL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0016714oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
GO:0005215transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000074oocyte
PLANA:0000087proximal tubule
PLANA:0000204ovary
PLANA:0000231vitelline gland
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR019774Aromatic-AA_hydroxylase_C
IPR006043Xant/urac/vitC
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0006810transport
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006043Xanthine/uracil/vitamin C permeasePFAMPF00860Xan_ur_permeasecoord: 29..461
e-value: 1.3E-62
score: 211.8
NoneNo IPR availablePANTHERPTHR11119XANTHINE-URACIL / VITAMIN C PERMEASE FAMILY MEMBERcoord: 13..530
NoneNo IPR availablePANTHERPTHR11119:SF91coord: 13..530
NoneNo IPR availableTMHMMTMhelixcoord: 415..437
NoneNo IPR availableTMHMMTMhelixcoord: 198..220
NoneNo IPR availableTMHMMTMhelixcoord: 347..369
NoneNo IPR availableTMHMMTMhelixcoord: 142..164
NoneNo IPR availableTMHMMTMhelixcoord: 476..498
NoneNo IPR availableTMHMMTMhelixcoord: 32..54
NoneNo IPR availableTMHMMTMhelixcoord: 298..320
NoneNo IPR availableTMHMMTMhelixcoord: 244..266
NoneNo IPR availableTMHMMTMhelixcoord: 389..411
NoneNo IPR availableTMHMMTMhelixcoord: 444..461
NoneNo IPR availableTMHMMTMhelixcoord: 169..191