Vesicular integral-membrane protein VIP36-like Protein

Overview
NameVesicular integral-membrane protein VIP36-like Protein
Smed IDSMED30014180
Length (bp)1132
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Vesicular integral-membrane protein VIP36-like Protein (SMED30014180) t-SNE clustered cells

Violin plots show distribution of expression levels for Vesicular integral-membrane protein VIP36-like Protein (SMED30014180) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Vesicular integral-membrane protein VIP36-like Protein (SMED30014180) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Vesicular integral-membrane protein VIP36-like Protein (SMED30014180) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014180

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30014180SMESG000046570.1 SMESG000010959.1 dd_Smed_v4_2066_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Human
Match: LMAN2 (lectin, mannose binding 2 [Source:HGNC Symbol;Acc:HGNC:16986])

HSP 1 Score: 271.166 bits (692), Expect = 6.049e-88
Identity = 132/272 (48.53%), Postives = 187/272 (68.75%), Query Frame = 3
Query:  120 LKKEYSLVKPYSGS-------WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHG-DTSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDA-DYYKIEPFAEIMESPRDHVDDDKPSF------AWKVF 890
            LK+E+SL+KPY G        WDF G++++T+ Y+RLT +++S+ G + N  P  ++DWE+H++FK+HG     L GDG+A WYT   L PGPVFG++D F GLAIFLDTY N +       PY+S MVNNG+L YDH  DG  T+L+GC+A FRN+ HDT LA+RY + +LTV  D+ +   WK C  +  V+LP GY+FGASA TG+LSDNHDIIS+K +++ V+H+ + ++ D+ KIEP    ++SP+D+VDD   +F       W+VF
Sbjct:   54 LKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPN-DETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVF 324          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Human
Match: LMAN2 (lectin, mannose binding 2 [Source:HGNC Symbol;Acc:HGNC:16986])

HSP 1 Score: 260.766 bits (665), Expect = 2.808e-84
Identity = 124/251 (49.40%), Postives = 176/251 (70.12%), Query Frame = 3
Query:  120 LKKEYSLVKPYSGS-------WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHG-DTSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDA-DYYKIEPFAEIMESPR 845
            LK+E+SL+KPY G        WDF G++++T+ Y+RLT +++S+ G + N  P  ++DWE+H++FK+HG     L GDG+A WYT   L PGPVFG++D F GLAIFLDTY N +       PY+S MVNNG+L YDH  DG  T+L+GC+A FRN+ HDT LA+RY + +LTV  D+ +   WK C  +  V+LP GY+FGASA TG+LSDNHDIIS+K +++ V+H+ + ++ D+ KIEP    ++SP+
Sbjct:   54 LKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPN-DETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDEESIDWTKIEPSVNFLKSPK 303          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Human
Match: LMAN2L (lectin, mannose binding 2 like [Source:HGNC Symbol;Acc:HGNC:19263])

HSP 1 Score: 251.906 bits (642), Expect = 1.644e-80
Identity = 127/296 (42.91%), Postives = 179/296 (60.47%), Query Frame = 3
Query:  117 FLKKEYSLVKPYSGS-------WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGD-TSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDADYYKI-EPFAEIMESPRDHVDDDKPSFAWKVFKWILYLIVFIILCAVVAVSYYIYKKNEEQ 977
            +LK+E+SL KPY G        W+  G +++   YIRLT + QS+ G + N  P  +RDWE+ ++FKIHG     L GDGLA WYT   +QPGPVFGN D F GL +F+DTY N         PY+SAMVNNG+L YDH+ DG  T+L GC+A  RN  +DT L IRYVK  LT+  DI+    W++C  V  V+LP GY+FG S+ TG+LSDNHD+IS+K +E+ V+ + E +  +  +  P  + M+ P +      P     +F  + + +VF +   V+ +   +Y K +EQ
Sbjct:   50 YLKREHSLSKPYQGVGTGSSSLWNLMGNAMVMTQYIRLTPDMQSKQGALWNRVPCFLRDWELQVHFKIHGQGKKNLHGDGLAIWYTKDRMQPGPVFGNMDKFVGLGVFVDTYPNEEKQQERVFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNLHYDTFLVIRYVKRHLTIMMDIDGKHEWRDCIEVPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTVERTPEEEKLHRDVFLPSVDNMKLP-EMTAPLPPLSGLALFLIVFFSLVFSVFAIVIGI--ILYNKWQEQ 342          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Human
Match: LMAN2L (lectin, mannose binding 2 like [Source:HGNC Symbol;Acc:HGNC:19263])

HSP 1 Score: 244.973 bits (624), Expect = 8.634e-78
Identity = 127/307 (41.37%), Postives = 180/307 (58.63%), Query Frame = 3
Query:  117 FLKKEYSLVKPYSGS-------WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGD-TSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEH-----------PYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDADYYKI-EPFAEIMESPRDHVDDDKPSFAWKVFKWILYLIVFIILCAVVAVSYYIYKKNEEQ 977
            +LK+E+SL KPY G        W+  G +++   YIRLT + QS+ G + N  P  +RDWE+ ++FKIHG     L GDGLA WYT   +QPGPVFGN D F GL +F+DTY N       +            PY+SAMVNNG+L YDH+ DG  T+L GC+A  RN  +DT L IRYVK  LT+  DI+    W++C  V  V+LP GY+FG S+ TG+LSDNHD+IS+K +E+ V+ + E +  +  +  P  + M+ P +      P     +F  + + +VF +   V+ +   +Y K +EQ
Sbjct:   50 YLKREHSLSKPYQGVGTGSSSLWNLMGNAMVMTQYIRLTPDMQSKQGALWNRVPCFLRDWELQVHFKIHGQGKKNLHGDGLAIWYTKDRMQPGPVFGNMDKFVGLGVFVDTYPNEEKQQEAQKRRYSPGVQRVFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNLHYDTFLVIRYVKRHLTIMMDIDGKHEWRDCIEVPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTVERTPEEEKLHRDVFLPSVDNMKLP-EMTAPLPPLSGLALFLIVFFSLVFSVFAIVIGI--ILYNKWQEQ 353          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Human
Match: LMAN2 (lectin, mannose binding 2 [Source:HGNC Symbol;Acc:HGNC:16986])

HSP 1 Score: 235.728 bits (600), Expect = 4.779e-75
Identity = 117/242 (48.35%), Postives = 164/242 (67.77%), Query Frame = 3
Query:  120 LKKEYSLVKPYSGS-------WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHG-DTSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDA-DYYKIEP 818
            LK+E+SL+KPY G        WDF G++++T+ Y+RLT +++S+ G + N  P  ++DWE+H++FK+HG     L GDG+A WYT   L P       D F GLAIFLDTY N +       PY+S MVNNG+L YDH  DG  T+L+GC+A FRN+ HDT LA+RY + +LTV  D+ +   WK C  +  V+LP GY+FGASA TG+LSDNHDIIS+K +++ V+H+ + ++ D+ KIEP
Sbjct:   54 LKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVP-------DNFHGLAIFLDTYPN-DETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDEESIDWTKIEP 287          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Celegans
Match: ile-2 (Intracellular LEctin [Source:UniProtKB/TrEMBL;Acc:Q22170])

HSP 1 Score: 302.368 bits (773), Expect = 1.109e-100
Identity = 140/263 (53.23%), Postives = 190/263 (72.24%), Query Frame = 3
Query:  117 FLKKEYSLVKPYSGS------WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGDTSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQL----SGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGE-GDADYYKIEPFAEIMESPRDHVDDDKPS 872
            + K+E+SL+KPY+GS      W+  G++ ++++ IRLT+++QS+ G + N  P   RDWE+ ++FK+ G T  LFGDG+A WYT +P   GPVFG +DYF+GLA+FLDTYSNHNG H H HP++SAMV++G+LHYDHD DGTHTQL    +GC+A+FRNK HDT + IRYV D L++  DI N G W  C +V+NV+LP GY+ G SAATG+LSD HD++S+K +E E  H    G+AD   + P A+   SPRDH DD +PS
Sbjct:   44 YYKREHSLIKPYTGSGADIPNWNIIGSTFVSSNQIRLTADEQSKAGALWNTQPVWSRDWELQVSFKVTGSTGDLFGDGMAIWYTSEPNILGPVFGGKDYFRGLAVFLDTYSNHNGPHQHGHPFISAMVSDGSLHYDHDKDGTHTQLGGENTGCTAKFRNKDHDTQVLIRYVGDTLSIFSDIENKGIWNLCMSVNNVQLPTGYYIGVSAATGDLSDAHDVVSLKMFEQEFAHVERVGEADRRNVVPHAQFTASPRDHTDDARPS 306          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Celegans
Match: ile-1 (ERGIC-53-like protein; Intracellular LEctin [Source:UniProtKB/TrEMBL;Acc:G5EDE8])

HSP 1 Score: 126.716 bits (317), Expect = 3.739e-32
Identity = 71/205 (34.63%), Postives = 111/205 (54.15%), Query Frame = 3
Query:  162 WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNV-MRDWEIHLNFKIHGDTSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGT--WKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEI 767
            W   G +I + + +RL  + +S+ G   N    +   ++++ +  KI G    +  DGL  WYT +    GPVFG  D++ G+ +FLD++ N        +P VS M+N+GT  YDH TDG+   LS C   FRNK +   + I Y+K+ LTV  D     T  ++ C   +N+ LP   +FG SAATG L+D+HD++    + +
Sbjct:   49 WIVSGDAIASGEQLRLAPSMRSRKGIAWNKRAFLESENFQVDIALKI-GGQGRVGADGLGIWYTSQLGALGPVFGGNDFWTGMGLFLDSFDNDG---QKNNPQVSLMLNDGTRSYDHHTDGSQQILSSCQRDFRNKPYPVRIRIEYLKNVLTVHIDDGMQPTPRYELCMRAENIFLPRNGYFGVSAATGGLADDHDVLDFSVFSL 249          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Celegans
Match: ile-1 (ERGIC-53-like protein; Intracellular LEctin [Source:UniProtKB/TrEMBL;Acc:G5EDE8])

HSP 1 Score: 126.716 bits (317), Expect = 3.739e-32
Identity = 71/205 (34.63%), Postives = 111/205 (54.15%), Query Frame = 3
Query:  162 WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNV-MRDWEIHLNFKIHGDTSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGT--WKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEI 767
            W   G +I + + +RL  + +S+ G   N    +   ++++ +  KI G    +  DGL  WYT +    GPVFG  D++ G+ +FLD++ N        +P VS M+N+GT  YDH TDG+   LS C   FRNK +   + I Y+K+ LTV  D     T  ++ C   +N+ LP   +FG SAATG L+D+HD++    + +
Sbjct:   49 WIVSGDAIASGEQLRLAPSMRSRKGIAWNKRAFLESENFQVDIALKI-GGQGRVGADGLGIWYTSQLGALGPVFGGNDFWTGMGLFLDSFDNDG---QKNNPQVSLMLNDGTRSYDHHTDGSQQILSSCQRDFRNKPYPVRIRIEYLKNVLTVHIDDGMQPTPRYELCMRAENIFLPRNGYFGVSAATGGLADDHDVLDFSVFSL 249          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Fly
Match: CG5510 (gene:FBgn0039160 transcript:FBtr0084576)

HSP 1 Score: 292.738 bits (748), Expect = 3.636e-97
Identity = 135/260 (51.92%), Postives = 188/260 (72.31%), Query Frame = 3
Query:  117 FLKKEYSLVKPYSG------SWDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGDTSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDADYYKIEPFAEIMESPRDHVDDDKPSFA 878
            ++K+E+SLV+P+ G       WDF G +++T++YIRLT + QS++G + N +P + R+WE+H+ FK+HG  + LFGDG A WYT + +Q GPVFG++D+F GLAI LDTYSNHNG H+H+HPY+SAMVNNG+  YDHD DGTHTQL+GC  +FRN  ++T+++IRY  D L+VS D+ N   WK CF V NV+LP GY FG SA TG+LSDNHDI S K Y+++++ + +       I P A+  E PR+H +D KP  +
Sbjct:   34 YMKREHSLVRPFQGVGVILPHWDFLGNTMVTSNYIRLTPDLQSKSGALWNYSPVMTRNWEVHVGFKVHGKGTELFGDGFAIWYTKERMQTGPVFGSKDHFSGLAIILDTYSNHNGPHNHQHPYLSAMVNNGSWSYDHDRDGTHTQLAGCEVRFRNVEYETLVSIRYENDILSVSTDLENRNEWKNCFVVANVELPTGYHFGMSATTGDLSDNHDIHSFKFYDLDLNVNHDEIIRRSNIIPNAKTFEPPREHKEDPKPGMS 293          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Fly
Match: ergic53 (gene:FBgn0035909 transcript:FBtr0076626)

HSP 1 Score: 140.969 bits (354), Expect = 4.721e-37
Identity = 94/277 (33.94%), Postives = 144/277 (51.99%), Query Frame = 3
Query:  129 EYSLVKPYSGS-------WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGDTSTLFGDGLAFWYT-DKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVS-HD--INNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEI----------EVDHSGEGDADY--YKIEPFAEIMESPRDHVDDDKPSFAWKVF 890
            +YS   PY          W++ G +I +++ +R+  + +SQ G +   +      W++ + F++ G    +  DGLAFWYT +K    GPVFG+ D + GLAI  D++ N N    H +PY+SA++N+GT  YDH  DGT   LSGC   FRNK   T   I Y  + LTV  H+   NN+  ++ C   D V LP   +FG SAATG L+D+HD+    T  +          +V++  +   +Y  Y+ +   +  E  +DH D+ K    W+ F
Sbjct:   38 KYSFKPPYLAQKDGTVPFWEYGGNAIASSESVRVAPSLRSQKGAIWTKSQTNFDWWDVEIVFRVTG-RGRIGADGLAFWYTTEKGDYNGPVFGSSDRWNGLAIMFDSFDNDN---KHNNPYISAVLNDGTKLYDHAEDGTTQLLSGCLRDFRNKPFPTRARIEYYNNVLTVMIHNGMSNNNDDYELCLRADGVNLPKNGYFGISAATGGLADDHDVFHFLTTSLHAAGQVQEQPKVENQEKLTQEYKEYQDKLEKQKQEYKKDHPDEHKDEEDWEEF 310          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Fly
Match: ergic53 (gene:FBgn0035909 transcript:FBtr0301629)

HSP 1 Score: 140.969 bits (354), Expect = 4.721e-37
Identity = 94/277 (33.94%), Postives = 144/277 (51.99%), Query Frame = 3
Query:  129 EYSLVKPYSGS-------WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGDTSTLFGDGLAFWYT-DKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVS-HD--INNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEI----------EVDHSGEGDADY--YKIEPFAEIMESPRDHVDDDKPSFAWKVF 890
            +YS   PY          W++ G +I +++ +R+  + +SQ G +   +      W++ + F++ G    +  DGLAFWYT +K    GPVFG+ D + GLAI  D++ N N    H +PY+SA++N+GT  YDH  DGT   LSGC   FRNK   T   I Y  + LTV  H+   NN+  ++ C   D V LP   +FG SAATG L+D+HD+    T  +          +V++  +   +Y  Y+ +   +  E  +DH D+ K    W+ F
Sbjct:   38 KYSFKPPYLAQKDGTVPFWEYGGNAIASSESVRVAPSLRSQKGAIWTKSQTNFDWWDVEIVFRVTG-RGRIGADGLAFWYTTEKGDYNGPVFGSSDRWNGLAIMFDSFDNDN---KHNNPYISAVLNDGTKLYDHAEDGTTQLLSGCLRDFRNKPFPTRARIEYYNNVLTVMIHNGMSNNNDDYELCLRADGVNLPKNGYFGISAATGGLADDHDVFHFLTTSLHAAGQVQEQPKVENQEKLTQEYKEYQDKLEKQKQEYKKDHPDEHKDEEDWEEF 310          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Zebrafish
Match: lman2 (lectin, mannose-binding 2 [Source:ZFIN;Acc:ZDB-GENE-070209-149])

HSP 1 Score: 288.115 bits (736), Expect = 6.843e-95
Identity = 139/272 (51.10%), Postives = 189/272 (69.49%), Query Frame = 3
Query:  120 LKKEYSLVKPYSG-------SWDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGD-TSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDA-DYYKIEPFAEIMESPRDHVDD------DKPSFAWKVF 890
            LK+E+SL+KPY G        WDF+G++++T+ Y+RLT +++S+ G + N  P  ++DWE+H+ FKIHG     L GDG A WYT + L PGPVFGNQD+F GLAIF+DT+ N         PY+SAMVNNG+L Y+H  DG  T+L GCS + RNK HDT LAIRY K +LT+  D+++   WKEC  +  V+LP GY+FGASAATG+LSDNHDIIS+K Y++ V+H+ E D+ D+ KIEP   +++SP+D++DD        P   WKVF
Sbjct:   51 LKREHSLIKPYQGVGSSPSSQWDFWGSTLVTSQYVRLTPDERSKQGSIWNTVPCYLKDWEMHVQFKIHGSGKKNLHGDGFAMWYTKERLHPGPVFGNQDHFVGLAIFVDTFRNDLQGMDRSFPYISAMVNNGSLPYEHGKDGRSTELGGCSVEVRNKEHDTYLAIRYSKGRLTIMVDVDDQNDWKECVDIGGVRLPTGYYFGASAATGDLSDNHDIISMKMYQLMVEHTLEEDSQDWTKIEPSVSLLKSPKDNIDDPTGNFRSSPLTGWKVF 322          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Zebrafish
Match: lman2lb (lectin, mannose-binding 2-like b [Source:ZFIN;Acc:ZDB-GENE-060929-256])

HSP 1 Score: 237.269 bits (604), Expect = 6.339e-75
Identity = 119/267 (44.57%), Postives = 166/267 (62.17%), Query Frame = 3
Query:  117 FLKKEYSLVKPYSG-------SWDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGD-TSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDADYYKIE-PFAEIMESPRDHVDDDKPSFAWKVF 890
            FLK+EYSL KPY G        W+F G +++  ++IRLT + QS+ G + +  P  +RDWE+ + FKIHG+    L GDGLA W T + +Q G VFG+ + F GL IF+DTY N +  H    P++SAMV NG++ YDHD DG  T L GC+A  RN  HDT + IRY++ +LT+  DI     WK+C  +  V+LP GY+FG S+ATG+LSDNHD++S K YE+ V+ S E + +  +I  P  +    P  HV+D+  S     F
Sbjct:   56 FLKREYSLSKPYQGLGSSSSSHWEFMGNTMVMPEHIRLTPDMQSRQGAVWSRIPCYLRDWELQVQFKIHGEGKKNLNGDGLAIWLTKERMQIGQVFGSANIFTGLGIFVDTYPNDDKQHERTFPFISAMVGNGSVAYDHDRDGRTTDLGGCTAHVRNVEHDTFVLIRYMRSRLTIMTDIEGKQEWKDCLDMPGVRLPQGYYFGVSSATGDLSDNHDLVSFKLYELTVERSPEEEEEQQEITLPSVDYRVDPNVHVEDEGRSIITTFF 322          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Zebrafish
Match: lman2la (lectin, mannose-binding 2-like a [Source:ZFIN;Acc:ZDB-GENE-040715-4])

HSP 1 Score: 171.785 bits (434), Expect = 5.089e-50
Identity = 101/274 (36.86%), Postives = 152/274 (55.47%), Query Frame = 3
Query:  111 EFFLKKEYSLVKPY-----SGS--WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGD-TSTLFGDGLAFWYTDKPLQPG--PVFGNQDYFKG-----------LAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDADYYKIEPFAEIMESPRDHVDDDKP 869
            E FLK+EY+L KPY     SGS  W+  G +++++DY+RLT +QQS+ G + +  P  + DWE+ ++F++HG     L GDGLA WYT + +Q G  P    Q+               L +F++      G        +S M  +    YD       T+L GC+A  RN+ H+T L IRYV+ +LTV  DI+    W++C  V  V+LP G++FGASA TG+LSDNHD+IS+K Y++ +  S + D      E   E++    D++D  +P
Sbjct:   25 EEFLKREYTLSKPYQDVGVSGSSHWELMGDALVSSDYVRLTPDQQSKQGAIWSRMPCHLSDWELQVHFRVHGQGKKNLNGDGLAVWYTKERMQRGQNPAELQQNTSVCVCVCVILVCVYLYVFMNIKRMSRGKSVMGS--LSIMGGSSGPPYDRAHVTGXTELGGCNAMVRNQKHETFLFIRYVRRRLTVMMDIDGQHEWRDCLDVPGVRLPQGFYFGASAVTGDLSDNHDLISMKLYQLTILRSKQED------EEQEEVLVPSVDNIDLLRP 290          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Zebrafish
Match: lman1 (lectin, mannose-binding, 1 [Source:ZFIN;Acc:ZDB-GENE-060201-4])

HSP 1 Score: 120.168 bits (300), Expect = 1.693e-29
Identity = 72/207 (34.78%), Postives = 109/207 (52.66%), Query Frame = 3
Query:  162 WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGDTSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGT-----WKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEI 767
            W   G +I ++D +R+T + +SQ G +   +P     WE  + F++ G    +  DGLA W+T      GPV+G  D + G+ IF D++ N    ++   P V  + NNG L +DH  DGT   L  C   FRNK +     I Y K  L+V   INN  T     ++ C  V+N+ +P   +FG SAATG L+D+HD++S   + +
Sbjct:   70 WIHTGNAIPSSDQVRITPSLRSQKGSVWTKSPVSFEHWEAEVAFRVSG-RGRMGADGLAIWFTAGQGLEGPVYGAADQWNGVGIFFDSFDNDGKKNN---PAVLVVGNNGKLVFDHQNDGTTQALGTCLRDFRNKPYPIRTKITYYKQTLSVF--INNGFTPDKDDYEFCTKVENMIIPGTGYFGISAATGGLADDHDVLSFLLFRL 270          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Zebrafish
Match: lman1 (lectin, mannose-binding, 1 [Source:ZFIN;Acc:ZDB-GENE-060201-4])

HSP 1 Score: 120.168 bits (300), Expect = 2.535e-29
Identity = 72/207 (34.78%), Postives = 109/207 (52.66%), Query Frame = 3
Query:  162 WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGDTSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGT-----WKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEI 767
            W   G +I ++D +R+T + +SQ G +   +P     WE  + F++ G    +  DGLA W+T      GPV+G  D + G+ IF D++ N    ++   P V  + NNG L +DH  DGT   L  C   FRNK +     I Y K  L+V   INN  T     ++ C  V+N+ +P   +FG SAATG L+D+HD++S   + +
Sbjct:  133 WIHTGNAIPSSDQVRITPSLRSQKGSVWTKSPVSFEHWEAEVAFRVSG-RGRMGADGLAIWFTAGQGLEGPVYGAADQWNGVGIFFDSFDNDGKKNN---PAVLVVGNNGKLVFDHQNDGTTQALGTCLRDFRNKPYPIRTKITYYKQTLSVF--INNGFTPDKDDYEFCTKVENMIIPGTGYFGISAATGGLADDHDVLSFLLFRL 333          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Xenopus
Match: cep57l1 (centrosomal protein 57kDa-like 1 [Source:Xenbase;Acc:XB-GENE-5897356])

HSP 1 Score: 291.967 bits (746), Expect = 2.958e-96
Identity = 146/302 (48.34%), Postives = 200/302 (66.23%), Query Frame = 3
Query:  117 FLKKEYSLVKPYSG-------SWDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGD-TSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGD-ADYYKIEPFAEIMESPRDHVDDDK------PSFAWKVFKWILYLIVFIILCAVVAVSYYIYKKNEEQ 977
            +LK+E+SL+KPY G        WDF G++++T+ Y+RLT++++S+ G + N  P  ++DWE+H+ F+IHG     L GDG A WY    LQPGPVFGN D F GLA+FLDTY N +       PY+S MVNNG+L YDH  DG   +L+GC+   RNK HDT LAIRY + +LTV  DI +   WK C  +  V+LP GY+FGASAATG+LSDNHDIIS+K Y++ VDHS + +  D+ KIEP   ++ SP+D+VDD        P   WKVF  +L  ++ II+CAVV     +++K +E+
Sbjct:   41 YLKREHSLIKPYQGVGSSSMPMWDFSGSTMLTSQYVRLTTDERSKEGSIWNRLPCFLKDWELHVQFRIHGSGKKNLHGDGFALWYAKDRLQPGPVFGNHDKFHGLAVFLDTYPN-DETTERVFPYISVMVNNGSLEYDHSKDGRTVELAGCTVDVRNKNHDTFLAIRYSQGRLTVMTDIEDKNEWKNCLDISGVRLPTGYYFGASAATGDLSDNHDIISMKLYQLMVDHSSDDENIDWTKIEPSVSLLRSPKDNVDDPTGNYRGGPLTGWKVFLLLLAALLGIIVCAVVGA--VVFQKRQER 339          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Xenopus
Match: cep57l1 (centrosomal protein 57kDa-like 1 [Source:Xenbase;Acc:XB-GENE-5897356])

HSP 1 Score: 290.812 bits (743), Expect = 7.457e-96
Identity = 146/302 (48.34%), Postives = 200/302 (66.23%), Query Frame = 3
Query:  117 FLKKEYSLVKPYSG-------SWDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGD-TSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGD-ADYYKIEPFAEIMESPRDHVDDDK------PSFAWKVFKWILYLIVFIILCAVVAVSYYIYKKNEEQ 977
            +LK+E+SL+KPY G        WDF G++++T+ Y+RLT++++S+ G + N  P  ++DWE+H+ F+IHG     L GDG A WY    LQPGPVFGN D F GLA+FLDTY N +       PY+S MVNNG+L YDH  DG   +L+GC+   RNK HDT LAIRY + +LTV  DI +   WK C  +  V+LP GY+FGASAATG+LSDNHDIIS+K Y++ VDHS + +  D+ KIEP   ++ SP+D+VDD        P   WKVF  +L  ++ II+CAVV     +++K +E+
Sbjct:   37 YLKREHSLIKPYQGVGSSSMPMWDFSGSTMLTSQYVRLTTDERSKEGSIWNRLPCFLKDWELHVQFRIHGSGKKNLHGDGFALWYAKDRLQPGPVFGNHDKFHGLAVFLDTYPN-DETTERVFPYISVMVNNGSLEYDHSKDGRTVELAGCTVDVRNKNHDTFLAIRYSQGRLTVMTDIEDKNEWKNCLDISGVRLPTGYYFGASAATGDLSDNHDIISMKLYQLMVDHSSDDENIDWTKIEPSVSLLRSPKDNVDDPTGNYRGGPLTGWKVFLLLLAALLGIIVCAVVGA--VVFQKRQER 335          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Xenopus
Match: lman2l (lectin, mannose-binding 2-like [Source:NCBI gene;Acc:496820])

HSP 1 Score: 256.144 bits (653), Expect = 2.305e-82
Identity = 133/301 (44.19%), Postives = 182/301 (60.47%), Query Frame = 3
Query:  111 EFFLKKEYSLVKPYSGS-------WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGD-TSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDA-DYYKIEPFAEIMESPRDHVDDDKPSFAWKVFKWILYLIVFIILCAVV---AVSYYIYKKNEEQ 977
            E +LK+E+SL KPY G        WD  G S++T  Y+RLT + QS+ G + N  P  +RDWE+ ++FKIHG     L GDG A WYT   +Q GPVFG++D F GL +F+DTY N    H    PY+SAMV+NG++ YDH  DG  T+L GC+A  RN  HDT L IRYVK +LT+  DI+    WK+C  V  V+LP GYFFGASA TG+LSDNHD+IS+K Y++ V+ + E +  D     P  + ++ P +   +    FA       ++LIVF  L  +V    +   +Y K +E+
Sbjct:   43 EEYLKREHSLSKPYQGVGSSTSSLWDLLGNSLVTPQYVRLTPDLQSKQGAVWNRVPCYLRDWEMQVHFKIHGQGKKNLNGDGFAIWYTKDRMQAGPVFGSKDNFVGLGLFVDTYPNEEKQHERVFPYISAMVSNGSITYDHSRDGRTTELGGCTAMVRNLNHDTFLVIRYVKRRLTIMVDIDGKQEWKDCVDVPGVRLPRGYFFGASAVTGDLSDNHDVISLKLYQLSVERTPEEEKMDKEVFIPSVDHLKLPGETSSESMSGFA-------IFLIVFFSLLGLVFTGVILLIVYSKWQER 336          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Xenopus
Match: lman2l (lectin, mannose-binding 2-like [Source:NCBI gene;Acc:496820])

HSP 1 Score: 250.366 bits (638), Expect = 7.050e-80
Identity = 133/312 (42.63%), Postives = 183/312 (58.65%), Query Frame = 3
Query:  111 EFFLKKEYSLVKPYSGS-------WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGD-TSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEH-----------PYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDA-DYYKIEPFAEIMESPRDHVDDDKPSFAWKVFKWILYLIVFIILCAVV---AVSYYIYKKNEEQ 977
            E +LK+E+SL KPY G        WD  G S++T  Y+RLT + QS+ G + N  P  +RDWE+ ++FKIHG     L GDG A WYT   +Q GPVFG++D F GL +F+DTY N    H  +            PY+SAMV+NG++ YDH  DG  T+L GC+A  RN  HDT L IRYVK +LT+  DI+    WK+C  V  V+LP GYFFGASA TG+LSDNHD+IS+K Y++ V+ + E +  D     P  + ++ P +   +    FA       ++LIVF  L  +V    +   +Y K +E+
Sbjct:   43 EEYLKREHSLSKPYQGVGSSTSSLWDLLGNSLVTPQYVRLTPDLQSKQGAVWNRVPCYLRDWEMQVHFKIHGQGKKNLNGDGFAIWYTKDRMQAGPVFGSKDNFVGLGLFVDTYPNEEKQHESQRKRYSPSMQRVFPYISAMVSNGSITYDHSRDGRTTELGGCTAMVRNLNHDTFLVIRYVKRRLTIMVDIDGKQEWKDCVDVPGVRLPRGYFFGASAVTGDLSDNHDVISLKLYQLSVERTPEEEKMDKEVFIPSVDHLKLPGETSSESMSGFA-------IFLIVFFSLLGLVFTGVILLIVYSKWQER 347          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Xenopus
Match: lman1 (lectin, mannose binding 1 [Source:NCBI gene;Acc:100494337])

HSP 1 Score: 128.257 bits (321), Expect = 3.281e-32
Identity = 85/264 (32.20%), Postives = 133/264 (50.38%), Query Frame = 3
Query:   99 TFCGEFFLKKEYSLVKPYSGSWDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGDTSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGT-----WKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDADYYKIEPFAEIMESPRDHVDDDKPSF 875
            +F G + ++ + S+  P+   W   G +I + D IR+T + +SQ G +        ++WE+ + F+I G    +  DGLA WYT      G V+G  D + G+ IF D++ N    ++   P + A+ NNG L YDH  DG    L+ C   FRNK +     I Y K  LT+   INN  T     ++ C  V+N+ LP   +FG SAATG L+D+HD++S  T+++               EP  E ++ P++  D  +  F
Sbjct:   57 SFKGPYLVQSDGSV--PF---WSHTGNAIPSADQIRITPSLKSQKGSVWTKAIANFQNWELEVTFRITG-RGRIGADGLAIWYTAAQGLEGDVYGAADSWNGVGIFFDSFDNDGKKNN---PAILAVGNNGKLQYDHQNDGATQALASCLRDFRNKPYPVRAKITYYKKILTIM--INNGFTPDKEDYEFCAKVENMILPSQGYFGISAATGGLADDHDVLSFLTFQL--------------TEPGKEAVKIPKEEKDKYQEEF 295          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Mouse
Match: Lman2 (lectin, mannose-binding 2 [Source:MGI Symbol;Acc:MGI:1914140])

HSP 1 Score: 268.085 bits (684), Expect = 7.123e-87
Identity = 129/261 (49.43%), Postives = 182/261 (69.73%), Query Frame = 3
Query:  120 LKKEYSLVKPYSGS-------WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHG-DTSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDA-DYYKIEPFAEIMESPRDHVDDDKPSF 875
            LK+E+SL+KPY G        WDF G++++T+ Y+RLT +++S+ G + N  P  ++DWE+H++FK+HG     L GDG+A WYT   L PGPVFG++D F GLAIFLDTY N +       PY+S MVNNG+L YDH  DG  ++L+GC+A FRN+ HDT LA+RY + +LTV  D+ +   WK C  +  V+LP GY+FGASA TG+LSDNHDIISIK +++ V+ + E ++ D+ KIEP    ++SP+D+VDD   +F
Sbjct:   56 LKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPN-DETTERVFPYISVMVNNGSLSYDHSKDGRWSELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISIKLFQLTVERTPEEESIDWTKIEPGVNFLKSPKDNVDDPTGNF 315          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Mouse
Match: Lman2l (lectin, mannose-binding 2-like [Source:MGI Symbol;Acc:MGI:2443010])

HSP 1 Score: 245.358 bits (625), Expect = 3.683e-78
Identity = 122/288 (42.36%), Postives = 173/288 (60.07%), Query Frame = 3
Query:  117 FLKKEYSLVKPYSGS-------WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGD-TSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDADYYKI-EPFAEIMESPRDHVDDDKPSFAWKVFKWILYLIVFIILCAVVAVSYY 953
            +LK+E+SL KPY G        W+  G +++   YIRLT + QS+ G + N  P  ++DWE+ ++FKIHG     L GDGLA WYT   +QPGPVFGN D F GL +F+DTY N    H    PY+SAMVNNG+L YDH+ DG  T+L GC+A  RN  +DT L IRYVK  LT+  DI+    W++C  +  V+LP GY+FG S+ TG+LSDNHD+IS+K +E+    + E +  +  +  P  + ++ P   V    P     +F  + + +VF +   V+ +  Y
Sbjct:   49 YLKREHSLSKPYQGVGTSSSSLWNLMGNAMVMTQYIRLTPDMQSKQGALWNRVPCFLKDWELQVHFKIHGQGKKNLHGDGLAIWYTKDRMQPGPVFGNMDKFVGLGVFVDTYPNEEKQHERVFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNIRYDTFLVIRYVKRHLTIMMDIDGKHEWRDCIEMPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTGVRTPEEEKLHRDVFLPSVDNLKLPEMTV-PPTPLSGLALFLIVFFSLVFSVFAIVIGIILY 335          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Mouse
Match: Lman2l (lectin, mannose-binding 2-like [Source:MGI Symbol;Acc:MGI:2443010])

HSP 1 Score: 238.424 bits (607), Expect = 2.001e-75
Identity = 122/299 (40.80%), Postives = 174/299 (58.19%), Query Frame = 3
Query:  117 FLKKEYSLVKPYSGS-------WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGD-TSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEH-----------PYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDADYYKI-EPFAEIMESPRDHVDDDKPSFAWKVFKWILYLIVFIILCAVVAVSYY 953
            +LK+E+SL KPY G        W+  G +++   YIRLT + QS+ G + N  P  ++DWE+ ++FKIHG     L GDGLA WYT   +QPGPVFGN D F GL +F+DTY N    H  +            PY+SAMVNNG+L YDH+ DG  T+L GC+A  RN  +DT L IRYVK  LT+  DI+    W++C  +  V+LP GY+FG S+ TG+LSDNHD+IS+K +E+    + E +  +  +  P  + ++ P   V    P     +F  + + +VF +   V+ +  Y
Sbjct:   49 YLKREHSLSKPYQGVGTSSSSLWNLMGNAMVMTQYIRLTPDMQSKQGALWNRVPCFLKDWELQVHFKIHGQGKKNLHGDGLAIWYTKDRMQPGPVFGNMDKFVGLGVFVDTYPNEEKQHEAQKRRYSPGVQRVFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNIRYDTFLVIRYVKRHLTIMMDIDGKHEWRDCIEMPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTGVRTPEEEKLHRDVFLPSVDNLKLPEMTV-PPTPLSGLALFLIVFFSLVFSVFAIVIGIILY 346          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Mouse
Match: Lman2l (lectin, mannose-binding 2-like [Source:MGI Symbol;Acc:MGI:2443010])

HSP 1 Score: 184.111 bits (466), Expect = 2.662e-56
Identity = 83/150 (55.33%), Postives = 105/150 (70.00%), Query Frame = 3
Query:  318 LFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEI 767
            L GDGLA WYT   +QPGPVFGN D F GL +F+DTY N    H    PY+SAMVNNG+L YDH+ DG  T+L GC+A  RN  +DT L IRYVK  LT+  DI+    W++C  +  V+LP GY+FG S+ TG+LSDNHD+IS+K +E+
Sbjct:    4 LHGDGLAIWYTKDRMQPGPVFGNMDKFVGLGVFVDTYPNEEKQHERVFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNIRYDTFLVIRYVKRHLTIMMDIDGKHEWRDCIEMPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFEL 153          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Mouse
Match: Lman1 (lectin, mannose-binding, 1 [Source:MGI Symbol;Acc:MGI:1917611])

HSP 1 Score: 126.716 bits (317), Expect = 2.289e-33
Identity = 72/212 (33.96%), Postives = 113/212 (53.30%), Query Frame = 3
Query:  147 PYSGSWDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGDTSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGT-----WKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEI 767
            P++G  +    +I + D IR+  + +SQ G +         +WE+ + F++ G    +  DGLA WYT+     GPVFG+ D + G+ IF D++ N        +P +  + NNG ++YDH  DG    L+ C   FRNK +     I Y +  LTV   INN  T     ++ C  V+N+ +P    FG SAATG L+D+HD++S  T+++
Sbjct:   54 PHTGKHEVQQDAIPSADQIRIAPSLKSQRGSVWTKAKAAFENWEVEVTFRVTG-RGRIGADGLAIWYTENQGLDGPVFGSADTWNGVGIFFDSFDNDG---KKNNPAIVVIGNNGQINYDHQNDGATQALASCQRDFRNKPYPVRAKITYYQKTLTVM--INNGFTPDKNDYEFCAKVENMVIPTQGHFGISAATGGLADDHDVLSFLTFQL 259          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. UniProt/SwissProt
Match: sp|P49256|LMAN2_CANLF (Vesicular integral-membrane protein VIP36 OS=Canis lupus familiaris OX=9615 GN=LMAN2 PE=1 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 2.939e-92
Identity = 143/301 (47.51%), Postives = 204/301 (67.77%), Query Frame = 3
Query:  120 LKKEYSLVKPYSGS-------WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHG-DTSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHS-GEGDADYYKIEPFAEIMESPRDHVDDDKPSF------AWKVFKWILYLIVFIILCAVVAVSYYIYKKNEEQ 977
            LK+E+SL+KPY G        WDF G++I+T+ Y+RLT +++S+ G + N  P  ++DWE+H++FK+HG     L GDG+A WYT   L PGPVFG++D F GLAIFLDTY N +       PY+S MVNNG+L YDH  DG  T+L+GC+A FRN+ HDT LA+RY + +LTV  D+ +   WK C  +  V+LP GY+FGASA TG+LSDNHDIIS+K +++ V+H+  E + D+ KIEP    ++SP+D+VDD   +F       W+VF  +L  ++ II+CAVV     +++K +E+
Sbjct:   54 LKREHSLIKPYQGVGSSSMPLWDFQGSTILTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPN-DETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDEENIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVFLLLLCALLGIIVCAVVGA--VVFQKRQER 351          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. UniProt/SwissProt
Match: sp|Q12907|LMAN2_HUMAN (Vesicular integral-membrane protein VIP36 OS=Homo sapiens OX=9606 GN=LMAN2 PE=1 SV=1)

HSP 1 Score: 271.166 bits (692), Expect = 2.905e-87
Identity = 132/272 (48.53%), Postives = 187/272 (68.75%), Query Frame = 3
Query:  120 LKKEYSLVKPYSGS-------WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHG-DTSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDA-DYYKIEPFAEIMESPRDHVDDDKPSF------AWKVF 890
            LK+E+SL+KPY G        WDF G++++T+ Y+RLT +++S+ G + N  P  ++DWE+H++FK+HG     L GDG+A WYT   L PGPVFG++D F GLAIFLDTY N +       PY+S MVNNG+L YDH  DG  T+L+GC+A FRN+ HDT LA+RY + +LTV  D+ +   WK C  +  V+LP GY+FGASA TG+LSDNHDIIS+K +++ V+H+ + ++ D+ KIEP    ++SP+D+VDD   +F       W+VF
Sbjct:   54 LKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPN-DETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVF 324          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. UniProt/SwissProt
Match: sp|Q9DBH5|LMAN2_MOUSE (Vesicular integral-membrane protein VIP36 OS=Mus musculus OX=10090 GN=Lman2 PE=1 SV=2)

HSP 1 Score: 268.085 bits (684), Expect = 4.982e-86
Identity = 129/261 (49.43%), Postives = 182/261 (69.73%), Query Frame = 3
Query:  120 LKKEYSLVKPYSGS-------WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHG-DTSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDA-DYYKIEPFAEIMESPRDHVDDDKPSF 875
            LK+E+SL+KPY G        WDF G++++T+ Y+RLT +++S+ G + N  P  ++DWE+H++FK+HG     L GDG+A WYT   L PGPVFG++D F GLAIFLDTY N +       PY+S MVNNG+L YDH  DG  ++L+GC+A FRN+ HDT LA+RY + +LTV  D+ +   WK C  +  V+LP GY+FGASA TG+LSDNHDIISIK +++ V+ + E ++ D+ KIEP    ++SP+D+VDD   +F
Sbjct:   56 LKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPN-DETTERVFPYISVMVNNGSLSYDHSKDGRWSELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISIKLFQLTVERTPEEESIDWTKIEPGVNFLKSPKDNVDDPTGNF 315          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. UniProt/SwissProt
Match: sp|Q9H0V9|LMA2L_HUMAN (VIP36-like protein OS=Homo sapiens OX=9606 GN=LMAN2L PE=1 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 7.895e-80
Identity = 127/296 (42.91%), Postives = 179/296 (60.47%), Query Frame = 3
Query:  117 FLKKEYSLVKPYSGS-------WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGD-TSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDADYYKI-EPFAEIMESPRDHVDDDKPSFAWKVFKWILYLIVFIILCAVVAVSYYIYKKNEEQ 977
            +LK+E+SL KPY G        W+  G +++   YIRLT + QS+ G + N  P  +RDWE+ ++FKIHG     L GDGLA WYT   +QPGPVFGN D F GL +F+DTY N         PY+SAMVNNG+L YDH+ DG  T+L GC+A  RN  +DT L IRYVK  LT+  DI+    W++C  V  V+LP GY+FG S+ TG+LSDNHD+IS+K +E+ V+ + E +  +  +  P  + M+ P +      P     +F  + + +VF +   V+ +   +Y K +EQ
Sbjct:   50 YLKREHSLSKPYQGVGTGSSSLWNLMGNAMVMTQYIRLTPDMQSKQGALWNRVPCFLRDWELQVHFKIHGQGKKNLHGDGLAIWYTKDRMQPGPVFGNMDKFVGLGVFVDTYPNEEKQQERVFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNLHYDTFLVIRYVKRHLTIMMDIDGKHEWRDCIEVPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTVERTPEEEKLHRDVFLPSVDNMKLP-EMTAPLPPLSGLALFLIVFFSLVFSVFAIVIGI--ILYNKWQEQ 342          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. UniProt/SwissProt
Match: sp|Q2HJD1|LMA2L_BOVIN (VIP36-like protein OS=Bos taurus OX=9913 GN=LMAN2L PE=2 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 4.792e-79
Identity = 123/288 (42.71%), Postives = 174/288 (60.42%), Query Frame = 3
Query:  117 FLKKEYSLVKPYSGS-------WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGD-TSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDADYYKI-EPFAEIMESPRDHVDDDKPSFAWKVFKWILYLIVFIILCAVVAVSYY 953
            +LK+E+SL KPY G        W+  G +++   YIRLT + QS+ G + N  P  +RDWE+ ++F+IHG     L GDGLA WYT   +QPGPVFGN D F GL +F+DTY N         PY+SAMVNNG+L YDH+ DG  T+L GC+A  RN  +DT L IRYVK  LT+  DI+    W++C  V  V+LP GY+FG S+ TG+LSDNHD+IS+K +E+ V+ + E +  +  +  P  + M+ P +      P     +F  + + +VF +   V+ +  Y
Sbjct:   50 YLKREHSLSKPYQGVGTSSSSLWNLMGNAMVMTQYIRLTPDMQSKQGALWNRVPCFLRDWELQVHFRIHGQGKKNLHGDGLAIWYTKDRMQPGPVFGNMDKFVGLGVFVDTYPNEEKQQERVFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNLHYDTFLVIRYVKRHLTIMMDIDGKHEWRDCIEVPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTVERTPEEEKLHRDVFLPSVDNMKLP-EMTAPLPPLSGLALFLIVFFSLVFSVFAIVIGIILY 336          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. TrEMBL
Match: K7J8S0 (L-type lectin-like domain-containing protein OS=Nasonia vitripennis OX=7425 GN=100119012 PE=4 SV=1)

HSP 1 Score: 342.813 bits (878), Expect = 2.451e-113
Identity = 156/292 (53.42%), Postives = 214/292 (73.29%), Query Frame = 3
Query:  117 FLKKEYSLVKPYSGS------WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGDTSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDADYYKIEPFAEIMESPRDHVDDDKPSFAWKVFKWILYLIVFIILCAVVAVSYYIYKKNEE 974
            ++K+E+SL++PY GS      WDF G++++TN+YIRLT + QSQ G + N  P  +R+WE+ ++FK+HG    LFGDGLA WY+ + +QPGPVFG++DYF GLA+ LDTYSNHNG H+H+HPY+SAM+NNG+LHYDHD DGTHTQL+GC A+FRN  HDT + IRY +D LTVS +I N G WKECF+V  +KLP GY+FG +A TG+LSDNH+I+S++ +E+++    +   D  KI P A   ESPRDHV+D KPS    V  ++L L+  + L A V +    Y+K++E
Sbjct:   28 YMKREHSLIRPYQGSGMTIPYWDFMGSTMVTNNYIRLTPDAQSQQGAIWNTVPCNVRNWELQVHFKVHGKGRDLFGDGLAIWYSKERMQPGPVFGSKDYFNGLAVILDTYSNHNGPHNHQHPYISAMINNGSLHYDHDRDGTHTQLAGCEAKFRNLEHDTHITIRYERDTLTVSTNIANKGAWKECFSVKEIKLPTGYYFGITATTGDLSDNHEILSVRLFELDLPDDPKDQEDRSKIIPSAAYFESPRDHVEDPKPSSLSGVKIFLLMLVGALALIACVVIGIMFYQKHQE 319          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. TrEMBL
Match: A0A0P4ZPL0 (Vesicular integral-membrane protein VIP36 OS=Daphnia magna OX=35525 GN=APZ42_028784 PE=4 SV=1)

HSP 1 Score: 335.88 bits (860), Expect = 1.240e-110
Identity = 159/293 (54.27%), Postives = 212/293 (72.35%), Query Frame = 3
Query:  117 FLKKEYSLVKPYSGS------WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGDTSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDADYYKIEPFAEIMESPRDHVDDDKPSFAWKVFKWILYLIVFIILCAVVAVSYYIYKKNEEQ 977
            +LK+E+SL+KPY+GS      WDF G++++T++YIRLTS+ QS++G + N+ P   ++WE+ + FK+HG    LFGDGLA WY    +  GPVFG++DYF GLAI LDTYSNHNG H+H HPY+SAMVNNGTL+YDHD DGTHTQL+GC A+FRN  +DT LAIRY  DKLTVS DI+N   WK CFTVD V+LP GY+FG SA TG+LSDNHDIIS+K YE++   +     D   I+P A+  E PR+HVDD KP+    V  ++L L+  + + A + V   +Y++ +E+
Sbjct:   23 YLKREHSLMKPYTGSGLSMPFWDFLGSTVVTSNYIRLTSDLQSKSGAIWNIVPCKSKNWELQVQFKVHGHGKDLFGDGLALWYARDRMVKGPVFGSKDYFYGLAIILDTYSNHNGPHNHAHPYISAMVNNGTLYYDHDRDGTHTQLAGCEARFRNVDYDTYLAIRYENDKLTVSTDIDNKSGWKPCFTVDGVRLPTGYYFGMSATTGDLSDNHDIISVKLYELDDTSTDSVAEDRSNIQPAAQSFEPPREHVDDPKPTSMGGVKLFLLMLVGVLGVFACIVVGIILYQRQQEK 315          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. TrEMBL
Match: A0A1S3H4T5 (vesicular integral-membrane protein VIP36 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106152075 PE=4 SV=1)

HSP 1 Score: 335.109 bits (858), Expect = 3.077e-110
Identity = 166/293 (56.66%), Postives = 218/293 (74.40%), Query Frame = 3
Query:  117 FLKKEYSLVKPYSGS-WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGDTSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDADYYKIEPFAEIMESPRDHVDDDKPSF------AWKVFKWILYLIVFIILCAVVAVSYYIYKKNEE 974
            ++KKE+SLVKPY G+ WDF G++++TN+YIRLTS+ QS  GG+ N +P ++RDWE+H+ FK+HG  + LFGDG A WYT + L  G VFG++++F GLAIF+DTYSNHNG H+H HPY+SAMV+NGT+ YDHD DGTHT+L+GC A FRN  +DT +A+RY  D LTVS DINN G WKECFTV  V LP GY+ G SAATG+L+DNHDIIS K YE+E +   +G  DY KIEP A+   SPRDHVDD K +F       WK+   I+ +I+ I +C  + V + I++K++E
Sbjct:   30 YMKKEHSLVKPYVGTPWDFVGSTMLTNNYIRLTSDHQSMKGGLWNQHPVLVRDWELHIQFKVHGKGTNLFGDGFAIWYTKERLTMGDVFGSKNFFHGLAIFMDTYSNHNGPHNHLHPYISAMVDNGTMGYDHDADGTHTELAGCEALFRNLAYDTYVAVRYSDDTLTVSTDINNKGGWKECFTVKGVHLPTGYYLGFSAATGQLADNHDIISAKFYELETERKDDG-VDYSKIEPSAQFFASPRDHVDDAKGAFMLNSLSGWKLLVVIILIIIGIGVC--LMVGFIIFQKSQE 319          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. TrEMBL
Match: A0A267E011 (L-type lectin-like domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025354g1 PE=4 SV=1)

HSP 1 Score: 334.339 bits (856), Expect = 1.275e-109
Identity = 162/294 (55.10%), Postives = 205/294 (69.73%), Query Frame = 3
Query:  111 EFFLKKEYSLVKPYSGSWDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGDTSTLFGDGLAFWYTDKPLQ-PGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEG----DADYYKIEPFAEIMESPRDHVDDDKPSFAWKVFK-WILYLIVFIILCAVVAVSYYIYKKNEE 974
             FFLKKEYSL KPY GSWDF GT+++T++Y+RLTS+  SQ+G +    P  MR+WE HL+F++HG  S LFGDG AFWY D   +  GPVFGNQD F+GL +F DTYSNHNG H H+HPY+SAMV+NG+  YDHD DGTH+QL+GC+A+FRN+ HDT+ AI YV + LTVS DI+N G W+ C  V NV+LP  + FGASA TG+LSDNHD++SIK YE++             DY  IEP AE  E  R+HVD   PS  W  F+ ++L L   I + AV+   Y+ Y K EE
Sbjct:   58 SFFLKKEYSLSKPYHGSWDFGGTTLITSEYVRLTSDTASQSGSVWCTTPVTMRNWEAHLHFRVHGSASNLFGDGFAFWYVDPSNRFAGPVFGNQDQFRGLGVFFDTYSNHNGPHSHDHPYISAMVSNGSHSYDHDRDGTHSQLAGCTAKFRNRDHDTLAAISYVDNVLTVSTDIDNKGMWQRCLRVTNVRLPTHFIFGASAMTGDLSDNHDLLSIKIYEVDYPKRSSDIRDLTTDYRNIEPSAEASEPEREHVDQPVPS-RWTGFRIFLLILFSLIAIAAVIVGLYFYYTKQEE 350          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. TrEMBL
Match: A0A1I8H1N2 (L-type lectin-like domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002607g1 PE=4 SV=1)

HSP 1 Score: 334.339 bits (856), Expect = 1.534e-109
Identity = 162/294 (55.10%), Postives = 205/294 (69.73%), Query Frame = 3
Query:  111 EFFLKKEYSLVKPYSGSWDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGDTSTLFGDGLAFWYTDKPLQ-PGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEG----DADYYKIEPFAEIMESPRDHVDDDKPSFAWKVFK-WILYLIVFIILCAVVAVSYYIYKKNEE 974
             FFLKKEYSL KPY GSWDF GT+++T++Y+RLTS+  SQ+G +    P  MR+WE HL+F++HG  S LFGDG AFWY D   +  GPVFGNQD F+GL +F DTYSNHNG H H+HPY+SAMV+NG+  YDHD DGTH+QL+GC+A+FRN+ HDT+ AI YV + LTVS DI+N G W+ C  V NV+LP  + FGASA TG+LSDNHD++SIK YE++             DY  IEP AE  E  R+HVD   PS  W  F+ ++L L   I + AV+   Y+ Y K EE
Sbjct:   58 SFFLKKEYSLSKPYHGSWDFGGTTLITSEYVRLTSDTASQSGSVWCTTPVTMRNWEAHLHFRVHGSASNLFGDGFAFWYVDPSNRFAGPVFGNQDQFRGLGVFFDTYSNHNGPHSHDHPYISAMVSNGSHSYDHDRDGTHSQLAGCTAKFRNRDHDTLAAISYVDNVLTVSTDIDNKGMWQRCLRVTNVRLPTHFIFGASAMTGDLSDNHDLLSIKIYEVDYPKRSSDIRDLTTDYRNIEPSAEASEPEREHVDQPVPS-RWTGFRIFLLILFSLIAIAAVIVGLYFYYTKQEE 350          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Cavefish
Match: lman2 (lectin, mannose binding 2 [Source:NCBI gene;Acc:103030753])

HSP 1 Score: 287.345 bits (734), Expect = 1.149e-94
Identity = 139/272 (51.10%), Postives = 189/272 (69.49%), Query Frame = 3
Query:  120 LKKEYSLVKPYSG-------SWDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGD-TSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDA-DYYKIEPFAEIMESPRDHVDD------DKPSFAWKVF 890
            LK+E+SL+KPY G        WDF G++++T+ YIRLT +++S+ G + N  P  ++DWE+H+ FK+HG     L GDG+A WYT + L PGPVFGNQD+F GLAIF+DT+ N         PY+SAMV+NG+L YDH  DG  T+L GCSA+ RN+ HDT LAIRY K +LT+  D+++   WKEC  +  V+LP GY FGASAATG+LSDNHDIIS+K Y++ V+H+ E D+ D+ KIEP   +++SP+D++DD        P   WKVF
Sbjct:   50 LKREHSLIKPYQGVGTSPSSQWDFKGSTLVTSQYIRLTPDERSKQGSIWNTVPCYLKDWEMHVQFKVHGSGKKNLHGDGIAIWYTKQQLHPGPVFGNQDHFIGLAIFVDTFRNDLHGMDRSFPYISAMVSNGSLAYDHGKDGRSTELGGCSAEIRNRDHDTYLAIRYSKGRLTIMVDVDDRNEWKECIDIGGVRLPTGYHFGASAATGDLSDNHDIISMKMYQLMVEHTPEEDSQDWTKIEPSVSLLKSPKDNIDDPTGNFRSSPLTGWKVF 321          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Cavefish
Match: lman2 (lectin, mannose binding 2 [Source:NCBI gene;Acc:103030753])

HSP 1 Score: 273.863 bits (699), Expect = 9.277e-90
Identity = 137/272 (50.37%), Postives = 187/272 (68.75%), Query Frame = 3
Query:  120 LKKEYSLVKPYSG-------SWDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGD-TSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDA-DYYKIEPFAEIMESPRDHVDD------DKPSFAWKVF 890
            LK+E+SL+KPY G        WDF G++++T+ YIRLT +++S+ G + N  P  ++DWE+H+ FK+HG     L GDG+A WYT + L PGP  G+ D F GLAIF+DTY N + A     PY+SAMV+NG+L YDH  DG  T+L GCSA+ RN+ HDT LAIRY K +LT+  D+++   WKEC  +  V+LP GY FGASAATG+LSDNHDIIS+K Y++ V+H+ E D+ D+ KIEP   +++SP+D++DD        P   WKVF
Sbjct:   26 LKREHSLIKPYQGVGTSPSSQWDFKGSTLVTSQYIRLTPDERSKQGSIWNTVPCYLKDWEMHVQFKVHGSGKKNLHGDGIAIWYTKQQLHPGP--GSNDNFHGLAIFIDTYPN-DEASDRSFPYISAMVSNGSLAYDHGKDGRSTELGGCSAEIRNRDHDTYLAIRYSKGRLTIMVDVDDRNEWKECIDIGGVRLPTGYHFGASAATGDLSDNHDIISMKMYQLMVEHTPEEDSQDWTKIEPSVSLLKSPKDNIDDPTGNFRSSPLTGWKVF 294          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Cavefish
Match: lman2la (lectin, mannose binding 2 like [Source:NCBI gene;Acc:103035036])

HSP 1 Score: 239.965 bits (611), Expect = 1.394e-76
Identity = 118/234 (50.43%), Postives = 158/234 (67.52%), Query Frame = 3
Query:  111 EFFLKKEYSLVKPY-----SGS--WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGD-TSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGE 788
            E FLK+EYSL KPY     SGS  W+  G +++T D++RLT + QS+ G + +  P  ++DWE+ ++FKIHG     L GDGLA WYT + +Q GPVFGN+D+F GL +F+DTY N         PYV AMV NGT+ YDH+ DG  T+L GC+A  RN  HDT L IRYV+ +LTV  DI+    W++C  +  V+LP GY+FGASA TG+LSDNHD+IS+K Y++ V  S +
Sbjct:   28 EEFLKREYSLSKPYQAIGVSGSSHWELMGDTMVTTDHVRLTPDVQSKQGAVWSRIPCNLKDWELQVHFKIHGQGKKNLNGDGLAVWYTKERMQKGPVFGNKDFFTGLGVFVDTYPNEEKHIERIFPYVLAMVGNGTIGYDHERDGRPTELGGCNAMVRNLKHDTFLFIRYVRRRLTVMIDIDGQHEWRDCLDIPGVRLPQGYYFGASAITGDLSDNHDLISMKLYQLTVLRSKQ 261          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Cavefish
Match: lman2la (lectin, mannose binding 2 like [Source:NCBI gene;Acc:103035036])

HSP 1 Score: 238.424 bits (607), Expect = 9.771e-76
Identity = 131/301 (43.52%), Postives = 187/301 (62.13%), Query Frame = 3
Query:  111 EFFLKKEYSLVKPY-----SGS--WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGD-TSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSN---HNGAHHHEH--------PYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDADYYKIE-PFAEIMESPRDHVDDDKPSFAWKVFKWILYLIVFIILCAVVAVSYY 953
            E FLK+EYSL KPY     SGS  W+  G +++T D++RLT + QS+ G + +  P  ++DWE+ ++FKIHG     L GDGLA WYT + +Q GPVFGN+D+F GL +F+DTY N   H  A    +        PYV AMV NGT+ YDH+ DG  T+L GC+A  RN  HDT L IRYV+ +LTV  DI+    W++C  +  V+LP GY+FGASA TG+LSDNHD+IS+K Y++ V  S + + +  ++  P  + ME    + D +  S +  +F  +L+ ++ + L  VV +  Y
Sbjct:   28 EEFLKREYSLSKPYQAIGVSGSSHWELMGDTMVTTDHVRLTPDVQSKQGAVWSRIPCNLKDWELQVHFKIHGQGKKNLNGDGLAVWYTKERMQKGPVFGNKDFFTGLGVFVDTYPNEEKHIEAQKKRYTPRTQRIFPYVLAMVGNGTIGYDHERDGRPTELGGCNAMVRNLKHDTFLFIRYVRRRLTVMIDIDGQHEWRDCLDIPGVRLPQGYYFGASAITGDLSDNHDLISMKLYQLTVLRSKQEEDEEDEVTIPSVDNMELLIKYYDGEGMS-SIAIFFTVLFSMLGLFLLIVVGLVVY 327          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Cavefish
Match: lman2lb (lectin, mannose-binding 2-like b [Source:ZFIN;Acc:ZDB-GENE-060929-256])

HSP 1 Score: 233.032 bits (593), Expect = 1.258e-73
Identity = 111/229 (48.47%), Postives = 149/229 (65.07%), Query Frame = 3
Query:  111 EFFLKKEYSLVKPYSG-------SWDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGD-TSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEV 773
            E FLK+EYSL KPY G        W+  G +++  +++RLT + QS+ G + +  P  +RDWEI ++FKIHG     L GDGLA W T + +Q GPVFGN +YF GL IF+DTY N +       P++SAMV NG++ YDHD DG +  L GCSA  RN  +DT L IRY+++ LT+  D+     WK+C  V  V +P GYFFGAS+ TG+LSDNHD+IS K +E+ V
Sbjct:   37 EEFLKREYSLTKPYQGLGSSTTSHWELMGNAMIMPEHVRLTPDLQSRQGAVWSRLPFYVRDWEIQVHFKIHGQGKKNLNGDGLALWLTKERMQIGPVFGNINYFTGLGIFVDTYPNEDKHQERSFPFISAMVGNGSVAYDHDRDGRNVDLGGCSASVRNVDYDTFLLIRYIRNTLTIMMDVEGKQEWKDCLEVPGVHMPQGYFFGASSVTGDLSDNHDLISFKLFELAV 265          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Sea Lamprey
Match: LMAN2L (lectin, mannose binding 2 like [Source:HGNC Symbol;Acc:HGNC:19263])

HSP 1 Score: 253.062 bits (645), Expect = 9.512e-83
Identity = 120/260 (46.15%), Postives = 172/260 (66.15%), Query Frame = 3
Query:  162 WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHG-DTSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHS-GEGDADYYKIEPFAEIMESPRDHVDDDKPSFAWKVFKWI-LYLIVFIILCA 932
            WD  G++++T+ Y+RLT +QQS+ G + N  P  + DWE+H+ FK+HG     L GDGLA WYT   +Q G VFGN++ F+GL IFLDTY N    H    PY+S MVNNG+L Y+H+ DG+ T+++GC+A  RN  HDT L++RY   +LT+  D+++ G W++C  V  V+LP GY+FGAS+ATG+LSDNHDI+S+K YE+ V+H+  E   D+  +EP AE     R     D+PS+  +    I ++L+VF  L  
Sbjct:   12 WDMAGSTMVTSQYVRLTPDQQSKQGALWNRVPCYLLDWELHVQFKVHGHGKKNLHGDGLALWYTMDRMQLGSVFGNKENFRGLGIFLDTYYNEGKKHERVFPYISVMVNNGSLRYEHEKDGSSTEVAGCAAALRNVNHDTFLSVRYSAQRLTIKVDVDDKGEWRDCVDVPGVRLPTGYYFGASSATGDLSDNHDIVSMKVYELSVEHTLEEMQFDWSSVEPSAEFPHHARTSGLSDEPSYRNEPLSGIKVFLLVFFGLIG 271          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007107.1 (pep scaffold:Pmarinus_7.0:GL482611:8915:17191:1 gene:ENSPMAG00000006428.1 transcript:ENSPMAT00000007107.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.079 bits (279), Expect = 5.242e-30
Identity = 54/114 (47.37%), Postives = 74/114 (64.91%), Query Frame = 3
Query:  117 FLKKEYSLVKPYSG-------SWDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGD-TSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSN 434
            F+K+E+SL+KPY G        WD  G +++    +RLT++QQS+ G M N  P  + DWE+H++FK+HG     L GDG A WYT   +Q G VFG++D F GLAIF+DTY N
Sbjct:   49 FIKREHSLMKPYQGVGSSPGAQWDITGNTVVIGHAVRLTADQQSKLGAMWNTVPCHVTDWELHVHFKVHGQGKKNLHGDGFAVWYTKDKMQLGSVFGSRDPFHGLAIFVDTYRN 162          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009163.1 (pep scaffold:Pmarinus_7.0:GL478385:152536:161254:1 gene:ENSPMAG00000008277.1 transcript:ENSPMAT00000009163.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.842 bits (268), Expect = 1.649e-26
Identity = 58/149 (38.93%), Postives = 84/149 (56.38%), Query Frame = 3
Query:  336 AFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGT-----WKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEI 767
            A WYT      GPVFG  D + GL +FLD++ N        +P V A+VN+GT +Y+H TDG       C   FRNK +   + + Y +  LTV   +N+  T     ++ C  V+NV LP   +FG SAATG L+D+HD++S++ Y +
Sbjct:    1 ALWYTANQGSEGPVFGAADRWNGLGVFLDSFDNDG---MRNNPMVLALVNDGTQNYNHQTDGITQAQGNCVRDFRNKPYPVRVKVSYYRSALTVM--VNSGLTPDTEDYEPCVAVNNVVLPPQGYFGISAATGGLADDHDVLSVQLYSL 144          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Yeast
Match: UIP5 (Protein of unknown function that interacts with Ulp1p; a Ubl (ubiquitin-like protein)-specific protease for Smt3p protein conjugates [Source:SGD;Acc:S000001752])

HSP 1 Score: 54.6842 bits (130), Expect = 1.136e-8
Identity = 77/292 (26.37%), Postives = 120/292 (41.10%), Query Frame = 3
Query:  174 GTSIMTNDYIRLTSNQQSQTGGMI---NLNPNVMRDWEIHLNFKI-HGDTSTLFGDGLAFWYT------DKPLQP------------GPVFGNQDY------FKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLH--YDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDIN---------NDGT-WKECF-TVDNVKLPLGY-----FFGASAATGELSDNHDIISIKTYEI---EVDHSGEGDADYYKIEPFAEI-MESPRDHVDDDKPS--FAWKVFK 893
             T I     I+LT ++     G++    +  N + D+EI   F+I H  T+ L GDG+ F  T       + LQ             G +  N D         GL I LDTY N  G  H E P++   +N       YD ++DG  +     +++   K+    L  R  K ++     I+          +G  W E F T +N+ LP        + G SA  G+L++  +++ + T E    ++D S E   DY K    AE+ +E     V D +P     WK+ K
Sbjct:   78 ATQIRNIQSIKLTQDRDQDKHGLVLSNGIGDNTINDFEIVFTFRISHDPTTQLTGDGMCFAITPENGFLTQNLQSSYAKKQYMMNSQGVIADNTDLMGFPKNLPGLFIVLDTYRNQ-GHDHKEVPFMDVFINVAPESDWYDINSDGELSTSLRLNSRGHIKLKKNALWNRVTKLRIIYLESISFLKIDVQYAKEGNYWIELFQTTENLYLPKNMHTGQRYIGCSALNGQLTETVELLDVSTSEFHWNDMDASIEDTYDYAK---EAELFLEQEFGEVLDREPDEFTKWKMIK 365          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Nematostella
Match: EDO48712 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RII2])

HSP 1 Score: 300.442 bits (768), Expect = 1.739e-100
Identity = 149/303 (49.17%), Postives = 205/303 (67.66%), Query Frame = 3
Query:  117 FLKKEYSLVKPYSGS------WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGDTSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRY--VKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEI---EVDHSGEGDA---DYYKIEPFAEIMESPRDHVDDDKPSFAWKV---FKWILYLIVFIILCAVVAVSYYIYKKNEE 974
            +L++E+SL++PY GS      WDF G++ ++++YIRLT + QS+ G + N  PN +++WE+ L+F +HG  +TLFGDG AFWYT      GP FG+   F GL +F DTYSNHNG H HEHPY+SAMV NGTL YDHD DGTH+Q+ GCSAQFR   HDT   IRY   +++LT+  D++    W+ECF V  VKLP G ++G SAATG+L+DNHDIIS+K YE+   EV  + E +    DY +I P A+  ES RDHVDD K SF+ +V   F W+ ++   +I C  + ++ ++Y K +E
Sbjct:   25 YLRREHSLMRPYQGSGMTIPNWDFHGSTFVSSNYIRLTPDHQSKQGSLWNNVPNYLKEWEMVLHFAVHGQGTTLFGDGFAFWYTRDRSLEGPAFGSSANFYGLGVFFDTYSNHNGEHSHEHPYISAMVGNGTLPYDHDRDGTHSQVEGCSAQFRGLTHDTFALIRYSTSQERLTLLVDVDGKNEWRECFDVGGVKLPTGLYWGVSAATGQLADNHDIISMKLYEVDIPEVVRTTETNGKQIDYTQIVPHADGAESYRDHVDDVKGSFSPRVARIFTWVFWIA--LIACVCIGIAIFMYHKQQE 325          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Nematostella
Match: EDO33405 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS96])

HSP 1 Score: 145.591 bits (366), Expect = 1.876e-39
Identity = 82/227 (36.12%), Postives = 131/227 (57.71%), Query Frame = 3
Query:   99 TFCGEFFLKKEYSLVKPYSGSWDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGDTSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTV---SHDINNDGTWKECFTVDNVKLPL-GYFFGASAATGELSDNHDIISIKTYEI 767
            +F G   + K+ S+  P+   W+F G+++ +N+ +RLT + + + G M   N      WEI ++F++ G    +  DGLA W+T+KP + GPVFG+ D + GL +  D++ N        +P+VS MVN+GT +Y+H  DG +  L GC   FRN+ H   + +RY ++ LT+   S    ++  ++ C  V+NV LP  G +FG SAATG L+D+HD  S  T  +
Sbjct:   13 SFKGPHLVNKQGSI--PF---WNFGGSAMPSNEQVRLTPSLRDKKGFMWTANKFTSEWWEIEVSFRVTG-RGRVGADGLAIWFTEKPGEEGPVFGSSDKWTGLGVLCDSFDNDG---QQNNPFVSVMVNDGTKNYEHYNDGKNQHLGGCLRDFRNRPHPVRVRVRYYQNVLTLWFHSGMSTSNEEFELCTRVENVNLPKEGGYFGLSAATGGLADDHDAFSFSTLTL 230          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Nematostella
Match: EDO40971 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5V2])

HSP 1 Score: 45.8246 bits (107), Expect = 9.664e-7
Identity = 20/54 (37.04%), Postives = 36/54 (66.67%), Query Frame = 3
Query:  117 FLKKEYSLVKPYSG----------SWDFFGTSIMTNDYIRLTSNQQSQTGGMIN 248
            +L++E+SL++PY G          +WDF G++ ++++YIRLT + QS+ G + N
Sbjct:   25 YLRREHSLMRPYQGKPHGFGMTIPNWDFHGSTFVSSNYIRLTPDHQSKQGSLWN 78          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Medaka
Match: lman2 (lectin, mannose binding 2 [Source:NCBI gene;Acc:101170355])

HSP 1 Score: 282.722 bits (722), Expect = 5.323e-93
Identity = 137/272 (50.37%), Postives = 186/272 (68.38%), Query Frame = 3
Query:  120 LKKEYSLVKPYSG-------SWDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGD-TSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGD-ADYYKIEPFAEIMESPRDHVDDDKPSF------AWKVF 890
            LK+E+SL+KPY G        WDF G++++T+ Y+RLT +++S+ G + N  P  ++DWE+H+ FKIHG     L GDG+A WYT   L PGPVFG+QD F GLAIFLDT+ N         PY+SAMVNNGT+ YDH  DG  ++L GCSA+ RN+ HDT LAIRY K +LT+  D+ +   WKEC  +  V+LP GYFFGASA TG+LSDNHDIIS+K Y++ V+H+ E +  D+ KIEP   +++SP+D++DD   +F       WK+F
Sbjct:   34 LKREHSLIKPYQGVGSSPSSQWDFSGSTLVTSSYVRLTPDERSKQGSVWNTVPCHLKDWEMHVQFKIHGSGKKNLHGDGIAVWYTKDRLHPGPVFGSQDQFFGLAIFLDTFRNDLHGMDRSFPYISAMVNNGTVTYDHGKDGRSSELGGCSAEIRNREHDTYLAIRYSKGRLTIMVDVEDKNEWKECIDIGGVRLPTGYFFGASAVTGDLSDNHDIISMKLYQLMVEHTAEEENLDWTKIEPSVSLLKSPKDNIDDPTGNFRGTPLTGWKIF 305          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Medaka
Match: lman2 (lectin, mannose binding 2 [Source:NCBI gene;Acc:101170355])

HSP 1 Score: 279.641 bits (714), Expect = 7.756e-92
Identity = 136/272 (50.00%), Postives = 187/272 (68.75%), Query Frame = 3
Query:  120 LKKEYSLVKPYSG-------SWDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGD-TSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGD-ADYYKIEPFAEIMESPRDHVDDDKPSF------AWKVF 890
            LK+E+SL+KPY G        WDF G++++T+ Y+RLT +++S+ G + N  P  ++DWE+H+ FKIHG     L GDG+A WYT   L PGPVF N  +F GLA+F+DTYSN + A     PY+SAMVNNGT+ YDH  DG  ++L GCSA+ RN+ HDT LAIRY K +LT+  D+ +   WKEC  +  V+LP GYFFGASA TG+LSDNHDIIS+K Y++ V+H+ E +  D+ KIEP   +++SP+D++DD   +F       WK+F
Sbjct:   34 LKREHSLIKPYQGVGSSPSSQWDFSGSTLVTSSYVRLTPDERSKQGSVWNTVPCHLKDWEMHVQFKIHGSGKKNLHGDGIAVWYTKDRLHPGPVFSNNAHFHGLAVFIDTYSNDD-ATDRSFPYISAMVNNGTVTYDHGKDGRSSELGGCSAEIRNREHDTYLAIRYSKGRLTIMVDVEDKNEWKECIDIGGVRLPTGYFFGASAVTGDLSDNHDIISMKLYQLMVEHTAEEENLDWTKIEPSVSLLKSPKDNIDDPTGNFRGTPLTGWKIF 304          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Medaka
Match: lman2lb (VIP36-like protein [Source:NCBI gene;Acc:101165400])

HSP 1 Score: 250.366 bits (638), Expect = 3.709e-80
Identity = 128/297 (43.10%), Postives = 187/297 (62.96%), Query Frame = 3
Query:  117 FLKKEYSLVKPYSG-------SWDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGD-TSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDADYYKIE-PFAEIMESPRDHVDDDKPSFAWKVFKWILYLIVFIILCAVVA-VSYYIYKKNEEQ 977
            F KKEYSL KPYSG        WD  GT+++T D+IRLT + QS+ G + +  P +++DWE+ ++FKIHG     L GDGLA W T   +  G VFGN + F GL +FLDTY N   +H    PYVS M+ NG+L YDHD DG  T+L GCSA  RN +HDT L +RY  ++L+V  D++  G W+ C  +  ++LP+GY+FGAS+ATGELSDNHDIIS+K Y++  + + E   +  ++  P  + ME  +  V++       ++F  +L+ I+ + +  VVA + Y  +K+N+ +
Sbjct:   53 FFKKEYSLAKPYSGLGFSSFSQWDLMGTAMVTPDHIRLTPDLQSRQGAVWSRVPLILKDWELKVHFKIHGQGKKNLNGDGLAIWLTKDRMNNGAVFGNMNQFTGLGVFLDTYPNAEKSHDRSFPYVSVMLGNGSLLYDHDQDGRPTELGGCSAAVRNSVHDTFLLVRYSTNRLSVMVDVDGKGEWRACADITGLRLPIGYYFGASSATGELSDNHDIISMKLYQLTNEPTSEEAEEEEEVTIPRVDNMEQFQVKVEEGGGMSGLQLFFTLLFSILGLGVLGVVALIVYSRWKENKRK 349          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Medaka
Match: lman2la (lectin, mannose binding 2 like [Source:NCBI gene;Acc:101154794])

HSP 1 Score: 233.802 bits (595), Expect = 7.953e-74
Identity = 112/232 (48.28%), Postives = 153/232 (65.95%), Query Frame = 3
Query:  111 EFFLKKEYSLVKPYSGS-------WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGD-TSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHS 782
            E FLK+EYSL KPY G        W+  G +++T DYIRLT + QS+ G + +  P  ++DWE+ ++FKIHG     L GDGLA W+T + +Q GPVFGN D F GL +F+DTY N         P+V AMV NG++ Y+H+ DG  T+L GC+A  RN  HD+ L IRY++ +LTV  DI+    W++C  +  V+LP GY+FGA+A TG+LSDNHDIIS+K Y++ V  S
Sbjct:   49 EEFLKREYSLSKPYQGVGSSSSSHWELMGDAMVTTDYIRLTPDSQSRQGAVWSRIPCNLKDWEMQVHFKIHGQGKKNLNGDGLAIWFTKERMQKGPVFGNMDNFTGLGVFVDTYPNEEKHIERIFPFVLAMVGNGSISYNHERDGRPTELGGCNAMVRNLKHDSFLFIRYIRRRLTVMIDIDGQHEWRDCLDIPGVRLPQGYYFGATAITGDLSDNHDIISLKLYQLTVIRS 280          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Medaka
Match: lman2la (lectin, mannose binding 2 like [Source:NCBI gene;Acc:101154794])

HSP 1 Score: 228.794 bits (582), Expect = 1.165e-71
Identity = 114/243 (46.91%), Postives = 156/243 (64.20%), Query Frame = 3
Query:  111 EFFLKKEYSLVKPYSGS-------WDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGD-TSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSN---HNGAHHHEH--------PYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHS 782
            E FLK+EYSL KPY G        W+  G +++T DYIRLT + QS+ G + +  P  ++DWE+ ++FKIHG     L GDGLA W+T + +Q GPVFGN D F GL +F+DTY N   H  A    +        P+V AMV NG++ Y+H+ DG  T+L GC+A  RN  HD+ L IRY++ +LTV  DI+    W++C  +  V+LP GY+FGA+A TG+LSDNHDIIS+K Y++ V  S
Sbjct:   49 EEFLKREYSLSKPYQGVGSSSSSHWELMGDAMVTTDYIRLTPDSQSRQGAVWSRIPCNLKDWEMQVHFKIHGQGKKNLNGDGLAIWFTKERMQKGPVFGNMDNFTGLGVFVDTYPNEEKHIEAQKKRYTPRTQRIFPFVLAMVGNGSISYNHERDGRPTELGGCNAMVRNLKHDSFLFIRYIRRRLTVMIDIDGQHEWRDCLDIPGVRLPQGYYFGATAITGDLSDNHDIISLKLYQLTVIRS 291          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Planmine SMEST
Match: SMESG000046570.1 (SMESG000046570.1)

HSP 1 Score: 613.609 bits (1581), Expect = 0.000e+0
Identity = 293/293 (100.00%), Postives = 293/293 (100.00%), Query Frame = 3
Query:   99 TFCGEFFLKKEYSLVKPYSGSWDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGDTSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDADYYKIEPFAEIMESPRDHVDDDKPSFAWKVFKWILYLIVFIILCAVVAVSYYIYKKNEEQ 977
            TFCGEFFLKKEYSLVKPYSGSWDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGDTSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDADYYKIEPFAEIMESPRDHVDDDKPSFAWKVFKWILYLIVFIILCAVVAVSYYIYKKNEEQ
Sbjct:   14 TFCGEFFLKKEYSLVKPYSGSWDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGDTSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDADYYKIEPFAEIMESPRDHVDDDKPSFAWKVFKWILYLIVFIILCAVVAVSYYIYKKNEEQ 306          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Planmine SMEST
Match: SMESG000010959.1 (SMESG000010959.1)

HSP 1 Score: 611.683 bits (1576), Expect = 0.000e+0
Identity = 292/293 (99.66%), Postives = 292/293 (99.66%), Query Frame = 3
Query:   99 TFCGEFFLKKEYSLVKPYSGSWDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGDTSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDADYYKIEPFAEIMESPRDHVDDDKPSFAWKVFKWILYLIVFIILCAVVAVSYYIYKKNEEQ 977
            TFCGEFFLKKEYSLVKPYSGSWDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGDTSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDADYYKIEPFAEIME PRDHVDDDKPSFAWKVFKWILYLIVFIILCAVVAVSYYIYKKNEEQ
Sbjct:   14 TFCGEFFLKKEYSLVKPYSGSWDFFGTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGDTSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDADYYKIEPFAEIMELPRDHVDDDKPSFAWKVFKWILYLIVFIILCAVVAVSYYIYKKNEEQ 306          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Planmine SMEST
Match: SMESG000046570.1 (SMESG000046570.1)

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 264/264 (100.00%), Postives = 264/264 (100.00%), Query Frame = 3
Query:  186 MTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGDTSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDADYYKIEPFAEIMESPRDHVDDDKPSFAWKVFKWILYLIVFIILCAVVAVSYYIYKKNEEQ 977
            MTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGDTSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDADYYKIEPFAEIMESPRDHVDDDKPSFAWKVFKWILYLIVFIILCAVVAVSYYIYKKNEEQ
Sbjct:    1 MTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGDTSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDADYYKIEPFAEIMESPRDHVDDDKPSFAWKVFKWILYLIVFIILCAVVAVSYYIYKKNEEQ 264          
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Planmine SMEST
Match: SMESG000078243.1 (SMESG000078243.1)

HSP 1 Score: 95.1301 bits (235), Expect = 3.132e-21
Identity = 68/209 (32.54%), Postives = 99/209 (47.37%), Query Frame = 3
Query:  138 LVKPYSGSWDFF---GTSIMTNDYIRLTSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGDTSTLFGDGLAFWYTDKPLQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDHDTDGTHTQLSGCSAQFRNK---IHDTILAIRYVKDKLTVSHDINNDGTWKECFTVDNVKLPL-GYFFGASAATGELSDNHDI 743
            +V P +    FF   G  I   D +RLT++   Q G + +        ++I + FKI G +  +  DGLA W        G   G  + + GL IF DTY N      + +P + A+ N+GT  YD  TDG    +  C   FRN+   +H  I+   +  + L  S     +   +ECF V    LP   Y+FG SAATG L+D+HD+
Sbjct:   37 IVLPNTNEIPFFEIGGHVIPGKDRVRLTTSLPDQQGWIWSKGNASFEGFQIDILFKITG-SGRIGADGLALWIVKNKSSGGHALGASNIWNGLGIFFDTYDNDG---QNNNPIILAISNDGTKFYDSSTDGRDLNIGHCIRDFRNRPHPVHSRIIYFNHTLEVLVSSGIEETNPVLEECFKV-KTNLPHDNYYFGLSAATGTLADDHDV 240          
The following BLAST results are available for this feature:
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LMAN26.049e-8848.53lectin, mannose binding 2 [Source:HGNC Symbol;Acc:... [more]
LMAN22.808e-8449.40lectin, mannose binding 2 [Source:HGNC Symbol;Acc:... [more]
LMAN2L1.644e-8042.91lectin, mannose binding 2 like [Source:HGNC Symbol... [more]
LMAN2L8.634e-7841.37lectin, mannose binding 2 like [Source:HGNC Symbol... [more]
LMAN24.779e-7548.35lectin, mannose binding 2 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ile-21.109e-10053.23Intracellular LEctin [Source:UniProtKB/TrEMBL;Acc... [more]
ile-13.739e-3234.63ERGIC-53-like protein; Intracellular LEctin [Sour... [more]
ile-13.739e-3234.63ERGIC-53-like protein; Intracellular LEctin [Sour... [more]
back to top
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG55103.636e-9751.92gene:FBgn0039160 transcript:FBtr0084576[more]
ergic534.721e-3733.94gene:FBgn0035909 transcript:FBtr0076626[more]
ergic534.721e-3733.94gene:FBgn0035909 transcript:FBtr0301629[more]
back to top
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lman26.843e-9551.10lectin, mannose-binding 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
lman2lb6.339e-7544.57lectin, mannose-binding 2-like b [Source:ZFIN;Acc:... [more]
lman2la5.089e-5036.86lectin, mannose-binding 2-like a [Source:ZFIN;Acc:... [more]
lman11.693e-2934.78lectin, mannose-binding, 1 [Source:ZFIN;Acc:ZDB-GE... [more]
lman12.535e-2934.78lectin, mannose-binding, 1 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cep57l12.958e-9648.34centrosomal protein 57kDa-like 1 [Source:Xenbase;A... [more]
cep57l17.457e-9648.34centrosomal protein 57kDa-like 1 [Source:Xenbase;A... [more]
lman2l2.305e-8244.19lectin, mannose-binding 2-like [Source:NCBI gene;A... [more]
lman2l7.050e-8042.63lectin, mannose-binding 2-like [Source:NCBI gene;A... [more]
lman13.281e-3232.20lectin, mannose binding 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lman27.123e-8749.43lectin, mannose-binding 2 [Source:MGI Symbol;Acc:M... [more]
Lman2l3.683e-7842.36lectin, mannose-binding 2-like [Source:MGI Symbol;... [more]
Lman2l2.001e-7540.80lectin, mannose-binding 2-like [Source:MGI Symbol;... [more]
Lman2l2.662e-5655.33lectin, mannose-binding 2-like [Source:MGI Symbol;... [more]
Lman12.289e-3333.96lectin, mannose-binding, 1 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P49256|LMAN2_CANLF2.939e-9247.51Vesicular integral-membrane protein VIP36 OS=Canis... [more]
sp|Q12907|LMAN2_HUMAN2.905e-8748.53Vesicular integral-membrane protein VIP36 OS=Homo ... [more]
sp|Q9DBH5|LMAN2_MOUSE4.982e-8649.43Vesicular integral-membrane protein VIP36 OS=Mus m... [more]
sp|Q9H0V9|LMA2L_HUMAN7.895e-8042.91VIP36-like protein OS=Homo sapiens OX=9606 GN=LMAN... [more]
sp|Q2HJD1|LMA2L_BOVIN4.792e-7942.71VIP36-like protein OS=Bos taurus OX=9913 GN=LMAN2L... [more]
back to top
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K7J8S02.451e-11353.42L-type lectin-like domain-containing protein OS=Na... [more]
A0A0P4ZPL01.240e-11054.27Vesicular integral-membrane protein VIP36 OS=Daphn... [more]
A0A1S3H4T53.077e-11056.66vesicular integral-membrane protein VIP36 isoform ... [more]
A0A267E0111.275e-10955.10L-type lectin-like domain-containing protein OS=Ma... [more]
A0A1I8H1N21.534e-10955.10L-type lectin-like domain-containing protein OS=Ma... [more]
back to top
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lman21.149e-9451.10lectin, mannose binding 2 [Source:NCBI gene;Acc:10... [more]
lman29.277e-9050.37lectin, mannose binding 2 [Source:NCBI gene;Acc:10... [more]
lman2la1.394e-7650.43lectin, mannose binding 2 like [Source:NCBI gene;A... [more]
lman2la9.771e-7643.52lectin, mannose binding 2 like [Source:NCBI gene;A... [more]
lman2lb1.258e-7348.47lectin, mannose-binding 2-like b [Source:ZFIN;Acc:... [more]
back to top
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
LMAN2L9.512e-8346.15lectin, mannose binding 2 like [Source:HGNC Symbol... [more]
ENSPMAT00000007107.15.242e-3047.37pep scaffold:Pmarinus_7.0:GL482611:8915:17191:1 ge... [more]
ENSPMAT00000009163.11.649e-2638.93pep scaffold:Pmarinus_7.0:GL478385:152536:161254:1... [more]
back to top
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
UIP51.136e-826.37Protein of unknown function that interacts with Ul... [more]
back to top
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO487121.739e-10049.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334051.876e-3936.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409719.664e-737.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lman25.323e-9350.37lectin, mannose binding 2 [Source:NCBI gene;Acc:10... [more]
lman27.756e-9250.00lectin, mannose binding 2 [Source:NCBI gene;Acc:10... [more]
lman2lb3.709e-8043.10VIP36-like protein [Source:NCBI gene;Acc:101165400... [more]
lman2la7.953e-7448.28lectin, mannose binding 2 like [Source:NCBI gene;A... [more]
lman2la1.165e-7146.91lectin, mannose binding 2 like [Source:NCBI gene;A... [more]
back to top
BLAST of Vesicular integral-membrane protein VIP36-like Protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000046570.10.000e+0100.00SMESG000046570.1[more]
SMESG000010959.10.000e+099.66SMESG000010959.1[more]
SMESG000046570.10.000e+0100.00SMESG000046570.1[more]
SMESG000078243.13.132e-2132.54SMESG000078243.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014180 ID=SMED30014180|Name=Vesicular integral-membrane protein VIP36-like Protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1132bp
ATTTGTAGTTAGATTTTGTTAAAATACATACGCTTTTACAGTTAAAATTT
AAATAAAAAATGAAATTAATATTTATACTATTGTCCTTATTTTCCTTCAC
ATTTTGCGGTGAATTCTTTCTGAAAAAGGAATATAGTCTAGTTAAGCCAT
ATTCAGGATCATGGGATTTTTTCGGGACTTCAATAATGACAAATGACTAT
ATTAGATTAACAAGTAATCAGCAAAGTCAAACTGGCGGAATGATTAATTT
AAATCCCAATGTAATGCGTGATTGGGAAATTCATTTGAATTTTAAAATTC
ACGGTGACACGAGTACATTATTTGGAGATGGCTTAGCGTTTTGGTATACA
GATAAACCTTTACAGCCAGGTCCAGTGTTTGGAAACCAAGATTATTTCAA
AGGTCTTGCTATATTTTTAGATACGTACAGTAATCATAATGGAGCTCATC
ACCACGAACATCCTTATGTTAGTGCAATGGTTAATAATGGTACATTACAT
TATGATCACGATACTGATGGTACACATACTCAACTATCTGGCTGTTCTGC
TCAATTTAGAAATAAAATACACGATACAATTTTAGCAATACGATATGTTA
AAGATAAACTGACAGTTTCACATGATATTAATAATGATGGAACATGGAAA
GAATGCTTTACTGTTGATAATGTTAAACTACCTCTTGGATATTTTTTTGG
AGCATCAGCTGCTACTGGAGAATTATCAGATAATCACGATATTATTTCAA
TCAAAACTTATGAAATTGAAGTTGATCATTCAGGTGAAGGAGATGCGGAC
TATTACAAAATAGAACCCTTTGCAGAAATCATGGAATCACCAAGAGATCA
CGTTGATGATGATAAGCCATCATTTGCATGGAAAGTCTTCAAATGGATAT
TATATTTAATTGTTTTTATTATTCTATGTGCCGTAGTTGCTGTCAGTTAT
TACATATATAAAAAAAATGAGGAACAAAAGAAGCGATTGTATTAAAAATC
GAATTTGAAACTTTTACTGTTAAAGTGCTAAGCTTGAATAATTTTCATTT
TACCAATTTTGTAGTTGCAAACATAACGACATGAAATTTAACAAAATAAA
TTTATATTTTCTGTTTTATTCGTCAATAAAAG
back to top

protein sequence of SMED30014180-orf-1

>SMED30014180-orf-1 ID=SMED30014180-orf-1|Name=SMED30014180-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=312bp
MKLIFILLSLFSFTFCGEFFLKKEYSLVKPYSGSWDFFGTSIMTNDYIRL
TSNQQSQTGGMINLNPNVMRDWEIHLNFKIHGDTSTLFGDGLAFWYTDKP
LQPGPVFGNQDYFKGLAIFLDTYSNHNGAHHHEHPYVSAMVNNGTLHYDH
DTDGTHTQLSGCSAQFRNKIHDTILAIRYVKDKLTVSHDINNDGTWKECF
TVDNVKLPLGYFFGASAATGELSDNHDIISIKTYEIEVDHSGEGDADYYK
IEPFAEIMESPRDHVDDDKPSFAWKVFKWILYLIVFIILCAVVAVSYYIY
KKNEEQKKRLY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005052Lectin_leg
IPR013320ConA-like_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005052Legume-like lectinPFAMPF03388Lectin_leg-likecoord: 22..237
e-value: 2.5E-81
score: 272.4
IPR005052Legume-like lectinPROSITEPS51328L_LECTIN_LIKEcoord: 7..236
score: 46.08
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 33..260
e-value: 3.9E-90
score: 303.3
NoneNo IPR availablePANTHERPTHR12223VESICULAR MANNOSE-BINDING LECTINcoord: 20..311
NoneNo IPR availablePANTHERPTHR12223:SF36VESICULAR INTEGRAL-MEMBRANE PROTEIN VIP36coord: 20..311
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.88
NoneNo IPR availableTMHMMTMhelixcoord: 279..300
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 20..235