Kinesin-like protein

Overview
NameKinesin-like protein
Smed IDSMED30014167
Length (bp)3353
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kinesin-like protein (SMED30014167) t-SNE clustered cells

Violin plots show distribution of expression levels for Kinesin-like protein (SMED30014167) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kinesin-like protein (SMED30014167) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kinesin-like protein (SMED30014167) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014167

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30014167SMESG000050123.1 SmedASXL_003694SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30014167SMESG000050139.1 SMESG000050123.1 SmedASXL_007195SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30014167SMESG000050139.1 SMESG000050123.1 SmedASXL_000080SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30014167SMESG000050123.1 SmedASXL_001468SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30014167SMESG000050123.1 SmedASXL_003146SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30014167SMESG000050139.1 SMESG000050123.1 dd_Smed_v4_20223_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30014167SMESG000050139.1 SMESG000050123.1 dd_Smed_v6_20223_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
oocyteSMED30014167SMESG000050139.1 SMESG000050123.1 Contig55231newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30014167SMESG000050139.1 SMESG000050123.1 Contig55231uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30014167SMESG000050139.1 SMESG000050123.1 Contig55231newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30014167SMESG000050139.1 SMESG000050123.1 Contig55231uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30014167SMESG000050123.1 Contig55314newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30014167SMESG000050123.1 Contig55314uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30014167SMESG000050139.1 SMESG000050123.1 Contig13432newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30014167SMESG000050139.1 SMESG000050123.1 Contig13432uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30014167SMESG000050139.1 SMESG000050123.1 Contig13432newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30014167SMESG000050139.1 SMESG000050123.1 Contig13432uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30014167SMESG000050139.1 SMESG000050123.1 Contig13432newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30014167SMESG000050139.1 SMESG000050123.1 Contig13432uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF1B (kinesin family member 1B [Source:HGNC Symbol;Acc:HGNC:16636])

HSP 1 Score: 450.669 bits (1158), Expect = 5.904e-139
Identity = 287/675 (42.52%), Postives = 377/675 (55.85%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTD-KKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYG--ANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDI--RKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT-IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQ-----------------GLSSDEVSELRREIME----EFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEAD---------------KRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAII--ERKN--EHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVK-ENKNLPKL------IDWEYAQNEIAHADGF 1976
            MS  SVKVAVRVRPFN RE  + +K  I MQGN+T I NP+N  +  K F+FDYSYWSH            P+ P   +ASQ  V+ D+GK +L +AF GYN  +FAYGQTG+GKSY+M+G    +  GI+P +C+ELF+K+  N ++ M Y V  S +EIY E VRDLL+   + KG L VR+ P  G +V+ L K+ V SY +I   M+ G  +RTVA TNMN TSSR+H V  I F Q    N +++   K S ++LVDLAGSERADSTGA G RLKEGANINKSL+ LG VISALA++S  KKKT  +PYRDSVLT LL+  LGGNS+T M+AALSPADINYDETL TLRYADRAKQIK  A++NE+P  KL+RELK E  RLK  L +  L   ++                   GL+S  V+ ++  IM     E   +    SE I AE  + W  +L   RK  AI  + E   A+                  K  HL+NLNEDP +S  +++Y+ + +T + +   +                                 IVL G  I   H I   ER N  E   T+ P    ++T +NG  ++    L   +RI+ G +H++ F  PE  + E +  P        +DW +AQ E+    G 
Sbjct:    1 MSGASVKVAVRVRPFNSRETSKESKCIIQMQGNSTSIINPKNPKEAPKSFSFDYSYWSHTS----------PEDPC--FASQNRVYNDIGKEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEESQAGIIPQLCEELFEKINDNCNEEMSYSVEVSYMEIYCERVRDLLN--PKNKGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQKKHDNETNLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVSKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIKCNAVINEDPNAKLVRELKEEVTRLKDLLRAQGLGDIIDTSMGSLTSSPSSCSLSSQVGLTS--VTSIQERIMSTPGGEEAIERLKESEKIIAELNETWEEKL---RKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAERR-----------------------------QDIVLSGAHIKEEHCIFRSERSNSGEVIVTLEPC-ERSETYVNGKRVSQPVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPSEPVDWTFAQRELLEKQGI 626          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF1B (kinesin family member 1B [Source:HGNC Symbol;Acc:HGNC:16636])

HSP 1 Score: 450.669 bits (1158), Expect = 5.904e-139
Identity = 287/675 (42.52%), Postives = 377/675 (55.85%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTD-KKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYG--ANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDI--RKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT-IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQ-----------------GLSSDEVSELRREIME----EFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEAD---------------KRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAII--ERKN--EHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVK-ENKNLPKL------IDWEYAQNEIAHADGF 1976
            MS  SVKVAVRVRPFN RE  + +K  I MQGN+T I NP+N  +  K F+FDYSYWSH            P+ P   +ASQ  V+ D+GK +L +AF GYN  +FAYGQTG+GKSY+M+G    +  GI+P +C+ELF+K+  N ++ M Y V  S +EIY E VRDLL+   + KG L VR+ P  G +V+ L K+ V SY +I   M+ G  +RTVA TNMN TSSR+H V  I F Q    N +++   K S ++LVDLAGSERADSTGA G RLKEGANINKSL+ LG VISALA++S  KKKT  +PYRDSVLT LL+  LGGNS+T M+AALSPADINYDETL TLRYADRAKQIK  A++NE+P  KL+RELK E  RLK  L +  L   ++                   GL+S  V+ ++  IM     E   +    SE I AE  + W  +L   RK  AI  + E   A+                  K  HL+NLNEDP +S  +++Y+ + +T + +   +                                 IVL G  I   H I   ER N  E   T+ P    ++T +NG  ++    L   +RI+ G +H++ F  PE  + E +  P        +DW +AQ E+    G 
Sbjct:    1 MSGASVKVAVRVRPFNSRETSKESKCIIQMQGNSTSIINPKNPKEAPKSFSFDYSYWSHTS----------PEDPC--FASQNRVYNDIGKEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEESQAGIIPQLCEELFEKINDNCNEEMSYSVEVSYMEIYCERVRDLLN--PKNKGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQKKHDNETNLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVSKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIKCNAVINEDPNAKLVRELKEEVTRLKDLLRAQGLGDIIDTSMGSLTSSPSSCSLSSQVGLTS--VTSIQERIMSTPGGEEAIERLKESEKIIAELNETWEEKL---RKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAERR-----------------------------QDIVLSGAHIKEEHCIFRSERSNSGEVIVTLEPC-ERSETYVNGKRVSQPVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPSEPVDWTFAQRELLEKQGI 626          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF1B (kinesin family member 1B [Source:HGNC Symbol;Acc:HGNC:16636])

HSP 1 Score: 449.899 bits (1156), Expect = 1.538e-134
Identity = 285/671 (42.47%), Postives = 377/671 (56.18%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTD-KKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYG--ANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDI--RKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT-IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQ-----------------GLSSDEVSELRREIME----EFKAQMSANSEIIAAEDPKIWNARL----------EEARKEVAIISKEEKNEADKRS--KLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAII--ERKN--EHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVK-ENKNLPKL------IDWEYAQNEIAHADG 1973
            MS  SVKVAVRVRPFN RE  + +K  I MQGN+T I NP+N  +  K F+FDYSYWSH            P+ P   +ASQ  V+ D+GK +L +AF GYN  +FAYGQTG+GKSY+M+G    +  GI+P +C+ELF+K+  N ++ M Y V  S +EIY E VRDLL+ +   KG L VR+ P  G +V+ L K+ V SY +I   M+ G  +RTVA TNMN TSSR+H V  I F Q    N +++   K S ++LVDLAGSERADSTGA G RLKEGANINKSL+ LG VISALA++S  KKKT  +PYRDSVLT LL+  LGGNS+T M+AALSPADINYDETL TLRYADRAKQIK  A++NE+P  KL+RELK E  RLK  L +  L   ++                   GL+S  V+ ++  IM     E   +    SE I AE  + W  +L          E    E+ +  +E+       S  K  HL+NLNEDP +S  +++Y+ + +T + +   +                                 IVL G  I   H I   ER N  E   T+ P    ++T +NG  ++    L   +RI+ G +H++ F  PE  + E +  P        +DW +AQ E+    G
Sbjct:    1 MSGASVKVAVRVRPFNSRETSKESKCIIQMQGNSTSIINPKNPKEAPKSFSFDYSYWSHTS----------PEDPC--FASQNRVYNDIGKEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEESQAGIIPQLCEELFEKINDNCNEEMSYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQKKHDNETNLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVSKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIKCNAVINEDPNAKLVRELKEEVTRLKDLLRAQGLGDIIDTSMGSLTSSPSSCSLSSQVGLTS--VTSIQERIMSTPGGEEAIERLKESEKIIAELNETWEEKLRKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAE-----------------------------RRQDIVLSGAHIKEEHCIFRSERSNSGEVIVTLEPC-ERSETYVNGKRVSQPVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPSEPVDWTFAQRELLEKQG 625          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF1C (kinesin family member 1C [Source:HGNC Symbol;Acc:HGNC:6317])

HSP 1 Score: 432.95 bits (1112), Expect = 8.474e-133
Identity = 276/686 (40.23%), Postives = 378/686 (55.10%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTD-KKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGY--GANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQIT--QSNGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT-IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVS-------------------------ELRREIMEEFKAQMSAN--------SEIIAAEDPKIWNARL----------EEARKEVAIISKEEKNEADKRS--KLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHA----IIERKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKENKN---------LPKLIDWEYAQNEIAHADGF 1976
            M+  SVKVAVRVRPFN RE  + AK  + MQGNTT I NP+ S D  K FTFDYSYWSH    ED            ++ASQ+ V+ D+G+ +L +AF GYN  +FAYGQTG+GKSY+M+G      +GIVP +C++LF ++  N S  + Y V  S +EIY E VRDLL+ ++  +G L VR+ P  G +VQ L K+ V SY +I   M+ G  +RTVA TNMN TSSR+H V  I F Q    Q  G D  K S ++LVDLAGSERADS+GA G RLKEGANINKSL+ LG VISALAD+ + K+K+  +PYRDSVLT LL+  LGGNS+T MIAALSPADINY+ETL TLRYADR KQI+  AI+NE+P  +L+REL+ E  RL++ L +  L  +  ++GL ++E S                         EL        ++Q+           +E I AE  + W  +L          E    E+ +  +E+       S  K  HL+NLNEDP +S  +++++ + +T + +                                ++M+ I L G  I  +H     I +   E   T+ P   GA+T +NG  +T    L   +RI+ G +H++ F  PE  +  +            + +DW +AQ E+    G 
Sbjct:    1 MAGASVKVAVRVRPFNARETSQDAKCVVSMQGNTTSIINPKQSKDAPKSFTFDYSYWSHTS-TEDP-----------QFASQQQVYRDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGRQEPGQQGIVPQLCEDLFSRVSENQSAQLSYSVEVSYMEIYCERVRDLLNPKS--RGSLRVREHPILGPYVQDLSKLAVTSYADIADLMDCGNKARTVAATNMNETSSRSHAVFTIVFTQRCHDQLTGLDSEKVSKISLVDLAGSERADSSGARGMRLKEGANINKSLTTLGKVISALADMQSKKRKSDFIPYRDSVLTWLLKENLGGNSRTAMIAALSPADINYEETLSTLRYADRTKQIRCNAIINEDPNARLIRELQEEVARLRELLMAQGLSASA-LEGLKTEEGSVRGALPAVSSPPAPVSPSSPTTHNGELEPSFSPNTESQIGPEEAMERLQETEKIIAELNETWEEKLRKTEALRMEREALLAEMGVAVREDGGTVGVFSPKKTPHLVNLNEDPLMSECLLYHIKDGVTRVGQ--------------------------------VDMD-IKLTGQFIREQHCLFRSIPQPDGEVVVTLEPC-EGAETYVNGKLVTEPLVLKSGNRIVMGKNHVFRFNHPEQARLERERGVPPPPGPPSEPVDWNFAQKELLEQQGI 637          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF1B (kinesin family member 1B [Source:HGNC Symbol;Acc:HGNC:16636])

HSP 1 Score: 431.409 bits (1108), Expect = 7.963e-128
Identity = 285/694 (41.07%), Postives = 376/694 (54.18%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDK-KVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYG--ANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDI--RKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT-------IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQ-------------------------------GLSSDEVSELRREIME----EFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEAD---------------KRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAII--ERKN--EHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVK-ENKNLPKL------IDWEYAQNEIAHADG 1973
            MS  SVKVAVRVRPFN RE  + +K  I MQGN+T I NP+N  +  K F+FDYSYWSH            P+ P   +ASQ  V+ D+GK +L +AF GYN  +FAYGQTG+GKSY+M+G    +  GI+P +C+ELF+K+  N ++ M Y V  S +EIY E VRDLL+ +   KG L VR+ P  G +V+ L K+ V SY +I   M+ G  +RTVA TNMN TSSR+H V  I F Q    N +++   K S ++LVDLAGSERADSTGA G RLKEGANINKSL+ LG VISALA++ N   K+        +PYRDSVLT LL+  LGGNS+T M+AALSPADINYDETL TLRYADRAKQIK  A++NE+P  KL+RELK E  RLK  L +  L   ++I                                GL+S  V+ ++  IM     E   +    SE I AE  + W  +L   RK  AI  + E   A+                  K  HL+NLNEDP +S  +++Y+ + +T + +   +                                 IVL G  I   H I   ER N  E   T+ P    ++T +NG  ++    L   +RI+ G +H++ F  PE  + E +  P        +DW +AQ E+    G
Sbjct:    1 MSGASVKVAVRVRPFNSRETSKESKCIIQMQGNSTSIINPKNPKEAPKSFSFDYSYWSHTS----------PEDPC--FASQNRVYNDIGKEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEESQAGIIPQLCEELFEKINDNCNEEMSYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQKKHDNETNLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVDNCTSKSKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIKCNAVINEDPNAKLVRELKEEVTRLKDLLRAQGLGDIIDIDPLIDDYSGSGSKSSMGSLTSSPSSCSLSSQVGLTS--VTSIQERIMSTPGGEEAIERLKESEKIIAELNETWEEKL---RKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAE-----------------------------RRQDIVLSGAHIKEEHCIFRSERSNSGEVIVTLEPC-ERSETYVNGKRVSQPVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPSEPVDWTFAQRELLEKQG 645          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: klp-6 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:G5EFQ4])

HSP 1 Score: 656.366 bits (1692), Expect = 0.000e+0
Identity = 376/889 (42.29%), Postives = 533/889 (59.96%), Query Frame = 3
Query:  120 ESVKVAVRVRPFNQREKDRLAKLTIDMQGN-TTIITNPENSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQIT--QSNGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGK--KKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARL-EEARKEVAIISKEEKNEADKRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKENKNLPKLIDWEYAQNEIA--HADGFGTENVKGLTKDXXXXXXXILEILPMISEVNAISEELEKSKTFEIILVPPNAQDSKYGSAKRTAIMIKVMDNKNGNFWIWERGKFMSRRYLMQEMYQQFLEDKSLKETISSKDPFWEPT-GEVLIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSISPSTSNGRVIDEDNFVDDPKSLLTRTYHFLIGIASVELHNAKYTIGIKVRFRIFKDEKSFETETSKGSKSAVFNYNKVISFARITQEHLDYFLTG--YITF 2753
            +S+ VAVRVRPFN REK R  KL I+M    TT+I +P+ + D+K FT+D+SYWSHD F E  NG+L P  P+  YA Q+ VFEDLG+ VL NA+ GYNCSLFAYGQTGSGKSYS+VG+  NKGIVP++C+ELFK++  N   +M++EV  SM+EIY E VRDLLS    PKGGL VR+ P  GF+V+ L  +PV S+KEIE+++E+GT SRT+A T MNATSSRAHT+V ITF+Q +  Q+ G+ ++KS I NLVDLAGSER  + G  GDRLKEG  IN+SL+ LG VI AL D    K  KKT +PYRDSVLT LL+NALGGNSKT+MIAA+SPADIN++ETL TLR+ADRAK IK  A+VNEN  E+ LREL+ EN RL+  +  G           S++E+ +LRR++ E  K            E  K W  ++ EEA K  +  S++ + EA K+ K+ HL NLNEDP L+ +IVH++    +++                                     N I + GLSI  +H  ++    +   + P        +NG  +  E  L   DR+ FG +H+Y+F +P      K +   I +E AQ EIA  HA   G   + G +K   +++++++  LP++   NA++ EL ++  FEI+LV P  +    G    T I +KV +     +++WE+ +FM+R Y MQEMY+   +          +DPF+EP    V I ++ VFLQ+LA+ +D E++ PI++  G E G ++V +SP ++ G+ +    +V+DP  L+ +   F + + S  +   +  +    ++R F  +K   T T  G+  A + + +   F  +T+E  DY      YITF
Sbjct:    5 DSIIVAVRVRPFNDREKTRNCKLVIEMPDEETTVIRDPK-TNDEKRFTYDHSYWSHDGFSEKKNGYLEPTDPH--YADQRRVFEDLGRGVLANAWAGYNCSLFAYGQTGSGKSYSIVGFKNNKGIVPIVCEELFKQIADNKKKNMQFEVFVSMMEIYCEKVRDLLSSTPPPKGGLKVREHPKNGFYVENLTTVPVNSFKEIEAKIEEGTKSRTIAATQMNATSSRAHTIVKITFNQKSSKQAGGTSMKKSEI-NLVDLAGSERQSAAGTEGDRLKEGIVINQSLTTLGRVIKALHDSQKAKSGKKTQIPYRDSVLTCLLKNALGGNSKTIMIAAISPADINFEETLSTLRFADRAKSIKTNAVVNENQTERALRELREENLRLQSQIQGGTAGDA------SNEEIEKLRRQLAENQKEM---------EEMEKSWQQKIAEEAAKHASGASEKVEMEA-KKKKMCHLWNLNEDPALTNVIVHFIPVGESVVG-----------------------------NKPTSSGNFIQMSGLSILPQHVTLKNDGNNQIHLSPCSEDLDIFINGKPVHGETQLQQNDRVFFGGNHLYVFNNP----TKKGIRTDITYENAQAEIAQNHAAALGNRGLGGGSKRDLILEEELMSTLPLVQRANAMATELGRNVKFEIVLVSPEMRGLTSG---LTEIWVKVHNISEDTYFLWEKSRFMNRYYGMQEMYEAKQDGSEDWNMPKERDPFYEPPDSPVFIASSVVFLQSLAYLIDVEEQFPIVDLSGQEIGLLTVGLSPCSTTGKEL-RGEYVEDPDQLIGKNIAFKVKVISA-VGLPRRILKSNCKYRFFGSKKMTTTATVSGNTPA-YGHEETFQFKPVTKEVADYLANSNLYITF 834          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: unc-104 (Kinesin-like protein unc-104 [Source:UniProtKB/Swiss-Prot;Acc:P23678])

HSP 1 Score: 416.772 bits (1070), Expect = 5.790e-124
Identity = 263/645 (40.78%), Postives = 363/645 (56.28%), Query Frame = 3
Query:  123 SVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANK---GIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGS--DIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT---IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQT-VNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARL----------EEARKEVAIISKEEKNEADKRS--KLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHA-IIERKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKENK-NLPKL----IDWEYAQNEIAHADGF 1976
            SVKVAVRVRPFNQRE    +K  + + GNTT I     + +   F FD+SYWS   F  +   F+          +QK V+E+LG  +LE+AF GYN  +FAYGQTGSGKSY+M+G   +    GI+P +C++LF +++ N+   ++Y V  S +EIY E V+DLL+  +   G L VR+ P  G +V  L K+ V SY +I + M++G  +RTVA TNMN+TSSR+H V  I   Q      S  D  K S ++LVDLAGSERA+STGA G RLKEGANINKSL+ LG VIS LA+ S  KKK+   ++PYRDSVLT LL+  LGGNSKT M+AALSPADIN+DETL TLRYADRAKQI  +A+VNE+P  KL+REL  E  +L+  L    +  T V        +  +L   + E+ +      SE + AE  K W  +L          EE  +++ +   E+       S  KL HL+NLNEDP +S  +++YL E +T + R   +                                 I+L G +I   H   I      + T++P    A   +NG  +T+   L    R++ G HH++ + DP+  ++++ NL  +    IDW+YAQ E+    G 
Sbjct:    3 SVKVAVRVRPFNQREISNTSKCVLQVNGNTTTINGHSINKENFSFNFDHSYWS---FARNDPHFI----------TQKQVYEELGVEMLEHAFEGYNVCIFAYGQTGSGKSYTMMGKANDPDEMGIIPRLCNDLFARIDNNNDKDVQYSVEVSYMEIYCERVKDLLNPNS--GGNLRVREHPLLGPYVDDLTKMAVCSYHDICNLMDEGNKARTVAATNMNSTSSRSHAVFTIVLTQKRHCADSNLDTEKHSKISLVDLAGSERANSTGAEGQRLKEGANINKSLTTLGLVISKLAEESTKKKKSNKGVIPYRDSVLTWLLRENLGGNSKTAMLAALSPADINFDETLSTLRYADRAKQIVCQAVVNEDPNAKLIRELNEEVIKLRHILKDKGIDVTDVQETPGKHKKGPKLPAHVHEQLEKLQE--SEKLMAEIGKTWEQKLIHTEEIRKQREEELRDMGLACAEDGTTLGVFSPKKLPHLVNLNEDPLMSECLIYYLKEGVTSVGRPEAEHRP-----------------------------DILLSGEAILELHCEFINEDGNVTLTMKP---NASCYINGKQVTTPTVLHTGSRVILGEHHVFRYNDPQEARQSRHNLAAIAEQPIDWKYAQQELLDKQGI 598          

HSP 2 Score: 56.9954 bits (136), Expect = 8.800e-8
Identity = 48/183 (26.23%), Postives = 79/183 (43.17%), Query Frame = 3
Query: 2052 ISEVNAISEELEKSKTFEIILVPPN------------AQDSKYGSAKRTAIMIKVMDNKNGNFWIWERGKFMSRRYLMQEMYQQFLE-----DKSLKETISSKDPFWEPTGEV-LIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSISPSTSNGRVIDEDNFVDDPKSLLTRTYHFL 2546
            + E NAIS EL+K   F+  L+                +D       +T + I+V D KNG    W   K   R   M++MY+   E        + + +   DPF++      ++G A V+L  L  N+    K+ ++N +G  +G++ V+I P   +  VI++   V     L  R   FL
Sbjct:  711 VKEANAISVELKKKVQFQFALLTDTMYSPLPPDLLPPGEDLTLRPYPKTVVAIQVQDLKNGATHYWSIEKLKQRLEAMRDMYETDAEMSPADGDPMMDALMGTDPFYDRFPWFRMVGRAFVYLNNLLHNVPLIHKVAVVNEKGEVKGYLKVAIEPVQKD-EVINQKKGVRQTAKLHFRKEDFL 892          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: unc-104 (Kinesin-like protein unc-104 [Source:UniProtKB/Swiss-Prot;Acc:P23678])

HSP 1 Score: 416.772 bits (1070), Expect = 5.790e-124
Identity = 263/645 (40.78%), Postives = 363/645 (56.28%), Query Frame = 3
Query:  123 SVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANK---GIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGS--DIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT---IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQT-VNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARL----------EEARKEVAIISKEEKNEADKRS--KLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHA-IIERKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKENK-NLPKL----IDWEYAQNEIAHADGF 1976
            SVKVAVRVRPFNQRE    +K  + + GNTT I     + +   F FD+SYWS   F  +   F+          +QK V+E+LG  +LE+AF GYN  +FAYGQTGSGKSY+M+G   +    GI+P +C++LF +++ N+   ++Y V  S +EIY E V+DLL+  +   G L VR+ P  G +V  L K+ V SY +I + M++G  +RTVA TNMN+TSSR+H V  I   Q      S  D  K S ++LVDLAGSERA+STGA G RLKEGANINKSL+ LG VIS LA+ S  KKK+   ++PYRDSVLT LL+  LGGNSKT M+AALSPADIN+DETL TLRYADRAKQI  +A+VNE+P  KL+REL  E  +L+  L    +  T V        +  +L   + E+ +      SE + AE  K W  +L          EE  +++ +   E+       S  KL HL+NLNEDP +S  +++YL E +T + R   +                                 I+L G +I   H   I      + T++P    A   +NG  +T+   L    R++ G HH++ + DP+  ++++ NL  +    IDW+YAQ E+    G 
Sbjct:    3 SVKVAVRVRPFNQREISNTSKCVLQVNGNTTTINGHSINKENFSFNFDHSYWS---FARNDPHFI----------TQKQVYEELGVEMLEHAFEGYNVCIFAYGQTGSGKSYTMMGKANDPDEMGIIPRLCNDLFARIDNNNDKDVQYSVEVSYMEIYCERVKDLLNPNS--GGNLRVREHPLLGPYVDDLTKMAVCSYHDICNLMDEGNKARTVAATNMNSTSSRSHAVFTIVLTQKRHCADSNLDTEKHSKISLVDLAGSERANSTGAEGQRLKEGANINKSLTTLGLVISKLAEESTKKKKSNKGVIPYRDSVLTWLLRENLGGNSKTAMLAALSPADINFDETLSTLRYADRAKQIVCQAVVNEDPNAKLIRELNEEVIKLRHILKDKGIDVTDVQETPGKHKKGPKLPAHVHEQLEKLQE--SEKLMAEIGKTWEQKLIHTEEIRKQREEELRDMGLACAEDGTTLGVFSPKKLPHLVNLNEDPLMSECLIYYLKEGVTSVGRPEAEHRP-----------------------------DILLSGEAILELHCEFINEDGNVTLTMKP---NASCYINGKQVTTPTVLHTGSRVILGEHHVFRYNDPQEARQSRHNLAAIAEQPIDWKYAQQELLDKQGI 598          

HSP 2 Score: 56.9954 bits (136), Expect = 8.800e-8
Identity = 48/183 (26.23%), Postives = 79/183 (43.17%), Query Frame = 3
Query: 2052 ISEVNAISEELEKSKTFEIILVPPN------------AQDSKYGSAKRTAIMIKVMDNKNGNFWIWERGKFMSRRYLMQEMYQQFLE-----DKSLKETISSKDPFWEPTGEV-LIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSISPSTSNGRVIDEDNFVDDPKSLLTRTYHFL 2546
            + E NAIS EL+K   F+  L+                +D       +T + I+V D KNG    W   K   R   M++MY+   E        + + +   DPF++      ++G A V+L  L  N+    K+ ++N +G  +G++ V+I P   +  VI++   V     L  R   FL
Sbjct:  711 VKEANAISVELKKKVQFQFALLTDTMYSPLPPDLLPPGEDLTLRPYPKTVVAIQVQDLKNGATHYWSIEKLKQRLEAMRDMYETDAEMSPADGDPMMDALMGTDPFYDRFPWFRMVGRAFVYLNNLLHNVPLIHKVAVVNEKGEVKGYLKVAIEPVQKD-EVINQKKGVRQTAKLHFRKEDFL 892          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: unc-104 (Kinesin-like protein unc-104 [Source:UniProtKB/Swiss-Prot;Acc:P23678])

HSP 1 Score: 416.772 bits (1070), Expect = 7.621e-124
Identity = 263/645 (40.78%), Postives = 363/645 (56.28%), Query Frame = 3
Query:  123 SVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANK---GIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGS--DIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT---IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQT-VNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARL----------EEARKEVAIISKEEKNEADKRS--KLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHA-IIERKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKENK-NLPKL----IDWEYAQNEIAHADGF 1976
            SVKVAVRVRPFNQRE    +K  + + GNTT I     + +   F FD+SYWS   F  +   F+          +QK V+E+LG  +LE+AF GYN  +FAYGQTGSGKSY+M+G   +    GI+P +C++LF +++ N+   ++Y V  S +EIY E V+DLL+  +   G L VR+ P  G +V  L K+ V SY +I + M++G  +RTVA TNMN+TSSR+H V  I   Q      S  D  K S ++LVDLAGSERA+STGA G RLKEGANINKSL+ LG VIS LA+ S  KKK+   ++PYRDSVLT LL+  LGGNSKT M+AALSPADIN+DETL TLRYADRAKQI  +A+VNE+P  KL+REL  E  +L+  L    +  T V        +  +L   + E+ +      SE + AE  K W  +L          EE  +++ +   E+       S  KL HL+NLNEDP +S  +++YL E +T + R   +                                 I+L G +I   H   I      + T++P    A   +NG  +T+   L    R++ G HH++ + DP+  ++++ NL  +    IDW+YAQ E+    G 
Sbjct:    3 SVKVAVRVRPFNQREISNTSKCVLQVNGNTTTINGHSINKENFSFNFDHSYWS---FARNDPHFI----------TQKQVYEELGVEMLEHAFEGYNVCIFAYGQTGSGKSYTMMGKANDPDEMGIIPRLCNDLFARIDNNNDKDVQYSVEVSYMEIYCERVKDLLNPNS--GGNLRVREHPLLGPYVDDLTKMAVCSYHDICNLMDEGNKARTVAATNMNSTSSRSHAVFTIVLTQKRHCADSNLDTEKHSKISLVDLAGSERANSTGAEGQRLKEGANINKSLTTLGLVISKLAEESTKKKKSNKGVIPYRDSVLTWLLRENLGGNSKTAMLAALSPADINFDETLSTLRYADRAKQIVCQAVVNEDPNAKLIRELNEEVIKLRHILKDKGIDVTDVQETPGKHKKGPKLPAHVHEQLEKLQE--SEKLMAEIGKTWEQKLIHTEEIRKQREEELRDMGLACAEDGTTLGVFSPKKLPHLVNLNEDPLMSECLIYYLKEGVTSVGRPEAEHRP-----------------------------DILLSGEAILELHCEFINEDGNVTLTMKP---NASCYINGKQVTTPTVLHTGSRVILGEHHVFRYNDPQEARQSRHNLAAIAEQPIDWKYAQQELLDKQGI 598          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: unc-104 (Kinesin-like protein unc-104 [Source:UniProtKB/Swiss-Prot;Acc:P23678])

HSP 1 Score: 416.772 bits (1070), Expect = 7.621e-124
Identity = 263/645 (40.78%), Postives = 363/645 (56.28%), Query Frame = 3
Query:  123 SVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANK---GIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGS--DIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT---IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQT-VNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARL----------EEARKEVAIISKEEKNEADKRS--KLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHA-IIERKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKENK-NLPKL----IDWEYAQNEIAHADGF 1976
            SVKVAVRVRPFNQRE    +K  + + GNTT I     + +   F FD+SYWS   F  +   F+          +QK V+E+LG  +LE+AF GYN  +FAYGQTGSGKSY+M+G   +    GI+P +C++LF +++ N+   ++Y V  S +EIY E V+DLL+  +   G L VR+ P  G +V  L K+ V SY +I + M++G  +RTVA TNMN+TSSR+H V  I   Q      S  D  K S ++LVDLAGSERA+STGA G RLKEGANINKSL+ LG VIS LA+ S  KKK+   ++PYRDSVLT LL+  LGGNSKT M+AALSPADIN+DETL TLRYADRAKQI  +A+VNE+P  KL+REL  E  +L+  L    +  T V        +  +L   + E+ +      SE + AE  K W  +L          EE  +++ +   E+       S  KL HL+NLNEDP +S  +++YL E +T + R   +                                 I+L G +I   H   I      + T++P    A   +NG  +T+   L    R++ G HH++ + DP+  ++++ NL  +    IDW+YAQ E+    G 
Sbjct:    3 SVKVAVRVRPFNQREISNTSKCVLQVNGNTTTINGHSINKENFSFNFDHSYWS---FARNDPHFI----------TQKQVYEELGVEMLEHAFEGYNVCIFAYGQTGSGKSYTMMGKANDPDEMGIIPRLCNDLFARIDNNNDKDVQYSVEVSYMEIYCERVKDLLNPNS--GGNLRVREHPLLGPYVDDLTKMAVCSYHDICNLMDEGNKARTVAATNMNSTSSRSHAVFTIVLTQKRHCADSNLDTEKHSKISLVDLAGSERANSTGAEGQRLKEGANINKSLTTLGLVISKLAEESTKKKKSNKGVIPYRDSVLTWLLRENLGGNSKTAMLAALSPADINFDETLSTLRYADRAKQIVCQAVVNEDPNAKLIRELNEEVIKLRHILKDKGIDVTDVQETPGKHKKGPKLPAHVHEQLEKLQE--SEKLMAEIGKTWEQKLIHTEEIRKQREEELRDMGLACAEDGTTLGVFSPKKLPHLVNLNEDPLMSECLIYYLKEGVTSVGRPEAEHRP-----------------------------DILLSGEAILELHCEFINEDGNVTLTMKP---NASCYINGKQVTTPTVLHTGSRVILGEHHVFRYNDPQEARQSRHNLAAIAEQPIDWKYAQQELLDKQGI 598          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: unc-104 (gene:FBgn0267002 transcript:FBtr0087079)

HSP 1 Score: 420.239 bits (1079), Expect = 1.963e-124
Identity = 271/671 (40.39%), Postives = 365/671 (54.40%), Query Frame = 3
Query:  123 SVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPE---NSTDK-KVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANK--GIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDI--RKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT----IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRREIM--------------EEFKAQMSANSEIIAAEDPKIWNARL---EEAR-------KEVAIISKEEKNEADKRS--KLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKE---------------NKNLPKLIDWEYAQNEIAHADGF 1976
            SVKVAVRVRPFN RE  R +K  I+M G TT ITNP+   N++D  K F FDYSYWSHD    D             +++Q  V++D+G+ +L+++F GYN  +FAYGQTG+GKSY+M+G    +  GI+P+IC +LF +++   +D ++Y V  S +EIY E VRDLL+ +   KG L VR+ P  G +V+ L K+ V  Y++I   +++G  +RTVA TNMN TSSR+H V  I F Q      +++   K S ++LVDLAGSERADSTGA G RLKEGANINKSL+ LG VISALA++++ KK T     +PYRDS LT LL+  LGGNSKT MIAA+SPADINYDETL TLRYADRAKQI  KA+VNE+   KL+RELK E ++L+  L +         +G+   E  EL +  +               E        SE + AE  + W  +L   EE R        E+ +  KE+       S  K  HL+NLNEDP LS  +++Y+ E LT +                                       I L G  I   H   E KN  + T+ P    A   +NG  L     L    R++ G +H++ F +PE  +E                K   + +DW +AQ E+    G 
Sbjct:    3 SVKVAVRVRPFNSREIARESKCIIEMAGATTAITNPKVPPNTSDSVKRFNFDYSYWSHDHHDAD-------------FSTQSMVYKDIGEEMLQHSFDGYNVCIFAYGQTGAGKSYTMMGRQEEQQEGIIPMICKDLFTRIQDTETDDLKYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTDYQDIHDLIDEGNKARTVAATNMNETSSRSHAVFTIFFTQRRHDLMTNLTTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVASKKKNTKKADFIPYRDSALTWLLRENLGGNSKTAMIAAISPADINYDETLSTLRYADRAKQIVCKAVVNEDANAKLIRELKEEIQKLRDLLKA---------EGIEVQEEDELTKSTVIKSPTKSRNRNGSTTEMAVDQLQASEKLIAELNETWEEKLKRTEEIRVQREAVFAEMGVAVKEDGITVGVFSPKKTPHLVNLNEDPNLSECLLYYIKEGLTRLGTHEANVP-----------------------------QDIQLSGSHILKEHCTFENKNS-TVTLLPH-KDAIIYVNGRKLVEPEVLKTGSRVILGKNHVFRFTNPEQARELRDKIETENEAENEVEKTDTQQVDWNFAQCELLEKQGI 618          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: unc-104 (gene:FBgn0267002 transcript:FBtr0113088)

HSP 1 Score: 419.083 bits (1076), Expect = 2.343e-124
Identity = 271/671 (40.39%), Postives = 365/671 (54.40%), Query Frame = 3
Query:  123 SVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPE---NSTDK-KVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYG--ANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDI--RKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT----IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRREIM--------------EEFKAQMSANSEIIAAEDPKIWNARL---EEAR-------KEVAIISKEEKNEADKRS--KLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKE---------------NKNLPKLIDWEYAQNEIAHADGF 1976
            SVKVAVRVRPFN RE  R +K  I+M G TT ITNP+   N++D  K F FDYSYWSHD    D             +++Q  V++D+G+ +L+++F GYN  +FAYGQTG+GKSY+M+G      +GI+P+IC +LF +++   +D ++Y V  S +EIY E VRDLL+ +   KG L VR+ P  G +V+ L K+ V  Y++I   +++G  +RTVA TNMN TSSR+H V  I F Q      +++   K S ++LVDLAGSERADSTGA G RLKEGANINKSL+ LG VISALA++++ KK T     +PYRDS LT LL+  LGGNSKT MIAA+SPADINYDETL TLRYADRAKQI  KA+VNE+   KL+RELK E ++L+  L +         +G+   E  EL +  +               E        SE + AE  + W  +L   EE R        E+ +  KE+       S  K  HL+NLNEDP LS  +++Y+ E LT +                                       I L G  I   H   E KN  + T+ P    A   +NG  L     L    R++ G +H++ F +PE  +E                K   + +DW +AQ E+    G 
Sbjct:    3 SVKVAVRVRPFNSREIARESKCIIEMAGATTAITNPKVPPNTSDSVKRFNFDYSYWSHDHHDAD-------------FSTQSMVYKDIGEEMLQHSFDGYNVCIFAYGQTGAGKSYTMMGRQEEQQEGIIPMICKDLFTRIQDTETDDLKYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTDYQDIHDLIDEGNKARTVAATNMNETSSRSHAVFTIFFTQRRHDLMTNLTTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVASKKKNTKKADFIPYRDSALTWLLRENLGGNSKTAMIAAISPADINYDETLSTLRYADRAKQIVCKAVVNEDANAKLIRELKEEIQKLRDLLKA---------EGIEVQEEDELTKSTVIKSPTKSRNRNGSTTEMAVDQLQASEKLIAELNETWEEKLKRTEEIRVQREAVFAEMGVAVKEDGITVGVFSPKKTPHLVNLNEDPNLSECLLYYIKEGLTRLGTHEANVP-----------------------------QDIQLSGSHILKEHCTFENKNS-TVTLLPH-KDAIIYVNGRKLVEPEVLKTGSRVILGKNHVFRFTNPEQARELRDKIETENEAENEVEKTDTQQVDWNFAQCELLEKQGI 618          

HSP 2 Score: 61.6178 bits (148), Expect = 4.387e-9
Identity = 45/175 (25.71%), Postives = 80/175 (45.71%), Query Frame = 3
Query: 2049 MISEVNAISEELEKSKTFEIIL----------------VPPNAQDSKYGS--AKRTAIMIKVMDNKNGNFWIWERGKFMSRRYLMQEMYQQFLEDKSLK-----ETISSKDPFWEPTGEV-LIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSISPSTSNGRVIDEDNF 2501
             + E NAIS EL+K   F+  L                V P  Q+ ++G+    +T + ++V D KNG    W   K   R  LM+EMY    E          E+++  DPF++      ++G + ++L  L + +    K+ I+N  G+  G++ +++ P      V+DE++ 
Sbjct:  731 FLKEANAISVELKKKVQFQFTLLTDTLYSPLPPELASTVAPVHQEDEFGAPPVSKTLVAVEVTDTKNGATHHWSLEKLRQRLELMREMYHNEAEMSPTSPDYNVESLTGGDPFYDRFPWFRMVGRSFIYLSNLLYPVPLVHKVAIVNERGDVRGYLRIAVQP------VLDEESI 899          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: unc-104 (gene:FBgn0267002 transcript:FBtr0113087)

HSP 1 Score: 419.083 bits (1076), Expect = 2.343e-124
Identity = 271/671 (40.39%), Postives = 365/671 (54.40%), Query Frame = 3
Query:  123 SVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPE---NSTDK-KVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYG--ANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDI--RKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT----IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRREIM--------------EEFKAQMSANSEIIAAEDPKIWNARL---EEAR-------KEVAIISKEEKNEADKRS--KLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKE---------------NKNLPKLIDWEYAQNEIAHADGF 1976
            SVKVAVRVRPFN RE  R +K  I+M G TT ITNP+   N++D  K F FDYSYWSHD    D             +++Q  V++D+G+ +L+++F GYN  +FAYGQTG+GKSY+M+G      +GI+P+IC +LF +++   +D ++Y V  S +EIY E VRDLL+ +   KG L VR+ P  G +V+ L K+ V  Y++I   +++G  +RTVA TNMN TSSR+H V  I F Q      +++   K S ++LVDLAGSERADSTGA G RLKEGANINKSL+ LG VISALA++++ KK T     +PYRDS LT LL+  LGGNSKT MIAA+SPADINYDETL TLRYADRAKQI  KA+VNE+   KL+RELK E ++L+  L +         +G+   E  EL +  +               E        SE + AE  + W  +L   EE R        E+ +  KE+       S  K  HL+NLNEDP LS  +++Y+ E LT +                                       I L G  I   H   E KN  + T+ P    A   +NG  L     L    R++ G +H++ F +PE  +E                K   + +DW +AQ E+    G 
Sbjct:    3 SVKVAVRVRPFNSREIARESKCIIEMAGATTAITNPKVPPNTSDSVKRFNFDYSYWSHDHHDAD-------------FSTQSMVYKDIGEEMLQHSFDGYNVCIFAYGQTGAGKSYTMMGRQEEQQEGIIPMICKDLFTRIQDTETDDLKYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTDYQDIHDLIDEGNKARTVAATNMNETSSRSHAVFTIFFTQRRHDLMTNLTTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVASKKKNTKKADFIPYRDSALTWLLRENLGGNSKTAMIAAISPADINYDETLSTLRYADRAKQIVCKAVVNEDANAKLIRELKEEIQKLRDLLKA---------EGIEVQEEDELTKSTVIKSPTKSRNRNGSTTEMAVDQLQASEKLIAELNETWEEKLKRTEEIRVQREAVFAEMGVAVKEDGITVGVFSPKKTPHLVNLNEDPNLSECLLYYIKEGLTRLGTHEANVP-----------------------------QDIQLSGSHILKEHCTFENKNS-TVTLLPH-KDAIIYVNGRKLVEPEVLKTGSRVILGKNHVFRFTNPEQARELRDKIETENEAENEVEKTDTQQVDWNFAQCELLEKQGI 618          

HSP 2 Score: 61.6178 bits (148), Expect = 4.387e-9
Identity = 45/175 (25.71%), Postives = 80/175 (45.71%), Query Frame = 3
Query: 2049 MISEVNAISEELEKSKTFEIIL----------------VPPNAQDSKYGS--AKRTAIMIKVMDNKNGNFWIWERGKFMSRRYLMQEMYQQFLEDKSLK-----ETISSKDPFWEPTGEV-LIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSISPSTSNGRVIDEDNF 2501
             + E NAIS EL+K   F+  L                V P  Q+ ++G+    +T + ++V D KNG    W   K   R  LM+EMY    E          E+++  DPF++      ++G + ++L  L + +    K+ I+N  G+  G++ +++ P      V+DE++ 
Sbjct:  731 FLKEANAISVELKKKVQFQFTLLTDTLYSPLPPELASTVAPVHQEDEFGAPPVSKTLVAVEVTDTKNGATHHWSLEKLRQRLELMREMYHNEAEMSPTSPDYNVESLTGGDPFYDRFPWFRMVGRSFIYLSNLLYPVPLVHKVAIVNERGDVRGYLRIAVQP------VLDEESI 899          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: unc-104 (gene:FBgn0267002 transcript:FBtr0346959)

HSP 1 Score: 419.083 bits (1076), Expect = 2.424e-124
Identity = 271/671 (40.39%), Postives = 365/671 (54.40%), Query Frame = 3
Query:  123 SVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPE---NSTDK-KVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANK--GIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDI--RKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT----IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRREIM--------------EEFKAQMSANSEIIAAEDPKIWNARL---EEAR-------KEVAIISKEEKNEADKRS--KLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKE---------------NKNLPKLIDWEYAQNEIAHADGF 1976
            SVKVAVRVRPFN RE  R +K  I+M G TT ITNP+   N++D  K F FDYSYWSHD    D             +++Q  V++D+G+ +L+++F GYN  +FAYGQTG+GKSY+M+G    +  GI+P+IC +LF +++   +D ++Y V  S +EIY E VRDLL+ +   KG L VR+ P  G +V+ L K+ V  Y++I   +++G  +RTVA TNMN TSSR+H V  I F Q      +++   K S ++LVDLAGSERADSTGA G RLKEGANINKSL+ LG VISALA++++ KK T     +PYRDS LT LL+  LGGNSKT MIAA+SPADINYDETL TLRYADRAKQI  KA+VNE+   KL+RELK E ++L+  L +         +G+   E  EL +  +               E        SE + AE  + W  +L   EE R        E+ +  KE+       S  K  HL+NLNEDP LS  +++Y+ E LT +                                       I L G  I   H   E KN  + T+ P    A   +NG  L     L    R++ G +H++ F +PE  +E                K   + +DW +AQ E+    G 
Sbjct:    3 SVKVAVRVRPFNSREIARESKCIIEMAGATTAITNPKVPPNTSDSVKRFNFDYSYWSHDHHDAD-------------FSTQSMVYKDIGEEMLQHSFDGYNVCIFAYGQTGAGKSYTMMGRQEEQQEGIIPMICKDLFTRIQDTETDDLKYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTDYQDIHDLIDEGNKARTVAATNMNETSSRSHAVFTIFFTQRRHDLMTNLTTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVASKKKNTKKADFIPYRDSALTWLLRENLGGNSKTAMIAAISPADINYDETLSTLRYADRAKQIVCKAVVNEDANAKLIRELKEEIQKLRDLLKA---------EGIEVQEEDELTKSTVIKSPTKSRNRNGSTTEMAVDQLQASEKLIAELNETWEEKLKRTEEIRVQREAVFAEMGVAVKEDGITVGVFSPKKTPHLVNLNEDPNLSECLLYYIKEGLTRLGTHEANVP-----------------------------QDIQLSGSHILKEHCTFENKNS-TVTLLPH-KDAIIYVNGRKLVEPEVLKTGSRVILGKNHVFRFTNPEQARELRDKIETENEAENEVEKTDTQQVDWNFAQCELLEKQGI 618          

HSP 2 Score: 61.6178 bits (148), Expect = 4.383e-9
Identity = 45/175 (25.71%), Postives = 80/175 (45.71%), Query Frame = 3
Query: 2049 MISEVNAISEELEKSKTFEIIL----------------VPPNAQDSKYGS--AKRTAIMIKVMDNKNGNFWIWERGKFMSRRYLMQEMYQQFLEDKSLK-----ETISSKDPFWEPTGEV-LIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSISPSTSNGRVIDEDNF 2501
             + E NAIS EL+K   F+  L                V P  Q+ ++G+    +T + ++V D KNG    W   K   R  LM+EMY    E          E+++  DPF++      ++G + ++L  L + +    K+ I+N  G+  G++ +++ P      V+DE++ 
Sbjct:  731 FLKEANAISVELKKKVQFQFTLLTDTLYSPLPPELASTVAPVHQEDEFGAPPVSKTLVAVEVTDTKNGATHHWSLEKLRQRLELMREMYHNEAEMSPTSPDYNVESLTGGDPFYDRFPWFRMVGRSFIYLSNLLYPVPLVHKVAIVNERGDVRGYLRIAVQP------VLDEESI 899          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: unc-104 (gene:FBgn0267002 transcript:FBtr0330003)

HSP 1 Score: 418.698 bits (1075), Expect = 3.079e-124
Identity = 271/671 (40.39%), Postives = 365/671 (54.40%), Query Frame = 3
Query:  123 SVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPE---NSTDK-KVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANK--GIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDI--RKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT----IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRREIM--------------EEFKAQMSANSEIIAAEDPKIWNARL---EEAR-------KEVAIISKEEKNEADKRS--KLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKE---------------NKNLPKLIDWEYAQNEIAHADGF 1976
            SVKVAVRVRPFN RE  R +K  I+M G TT ITNP+   N++D  K F FDYSYWSHD    D             +++Q  V++D+G+ +L+++F GYN  +FAYGQTG+GKSY+M+G    +  GI+P+IC +LF +++   +D ++Y V  S +EIY E VRDLL+ +   KG L VR+ P  G +V+ L K+ V  Y++I   +++G  +RTVA TNMN TSSR+H V  I F Q      +++   K S ++LVDLAGSERADSTGA G RLKEGANINKSL+ LG VISALA++++ KK T     +PYRDS LT LL+  LGGNSKT MIAA+SPADINYDETL TLRYADRAKQI  KA+VNE+   KL+RELK E ++L+  L +         +G+   E  EL +  +               E        SE + AE  + W  +L   EE R        E+ +  KE+       S  K  HL+NLNEDP LS  +++Y+ E LT +                                       I L G  I   H   E KN  + T+ P    A   +NG  L     L    R++ G +H++ F +PE  +E                K   + +DW +AQ E+    G 
Sbjct:    3 SVKVAVRVRPFNSREIARESKCIIEMAGATTAITNPKVPPNTSDSVKRFNFDYSYWSHDHHDAD-------------FSTQSMVYKDIGEEMLQHSFDGYNVCIFAYGQTGAGKSYTMMGRQEEQQEGIIPMICKDLFTRIQDTETDDLKYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTDYQDIHDLIDEGNKARTVAATNMNETSSRSHAVFTIFFTQRRHDLMTNLTTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVASKKKNTKKADFIPYRDSALTWLLRENLGGNSKTAMIAAISPADINYDETLSTLRYADRAKQIVCKAVVNEDANAKLIRELKEEIQKLRDLLKA---------EGIEVQEEDELTKSTVIKSPTKSRNRNGSTTEMAVDQLQASEKLIAELNETWEEKLKRTEEIRVQREAVFAEMGVAVKEDGITVGVFSPKKTPHLVNLNEDPNLSECLLYYIKEGLTRLGTHEANVP-----------------------------QDIQLSGSHILKEHCTFENKNS-TVTLLPH-KDAIIYVNGRKLVEPEVLKTGSRVILGKNHVFRFTNPEQARELRDKIETENEAENEVEKTDTQQVDWNFAQCELLEKQGI 618          

HSP 2 Score: 61.6178 bits (148), Expect = 4.735e-9
Identity = 45/175 (25.71%), Postives = 80/175 (45.71%), Query Frame = 3
Query: 2049 MISEVNAISEELEKSKTFEIIL----------------VPPNAQDSKYGS--AKRTAIMIKVMDNKNGNFWIWERGKFMSRRYLMQEMYQQFLEDKSLK-----ETISSKDPFWEPTGEV-LIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSISPSTSNGRVIDEDNF 2501
             + E NAIS EL+K   F+  L                V P  Q+ ++G+    +T + ++V D KNG    W   K   R  LM+EMY    E          E+++  DPF++      ++G + ++L  L + +    K+ I+N  G+  G++ +++ P      V+DE++ 
Sbjct:  731 FLKEANAISVELKKKVQFQFTLLTDTLYSPLPPELASTVAPVHQEDEFGAPPVSKTLVAVEVTDTKNGATHHWSLEKLRQRLELMREMYHNEAEMSPTSPDYNVESLTGGDPFYDRFPWFRMVGRSFIYLSNLLYPVPLVHKVAIVNERGDVRGYLRIAVQP------VLDEESI 899          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif1b (kinesin family member 1B [Source:ZFIN;Acc:ZDB-GENE-030820-1])

HSP 1 Score: 457.988 bits (1177), Expect = 9.969e-142
Identity = 285/685 (41.61%), Postives = 380/685 (55.47%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYG--ANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDI--RKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT-IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSD-----------------------------EVSELRREIME----EFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEAD---------------KRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAII--ERK-NEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVK-ENKNLP------KLIDWEYAQNEIAHADGF 1976
            MS  SVKVAVRVRPFN RE  + +K  I MQGN+T I NP+N  + K F+FDYSYWSH            PD P+  +ASQ  V+ D+GK +L++AF GYN  +FAYGQTG+GKSY+M+G      +GI+P +C+ELF+K+  N+++ + Y V  + +EIY E VRDLL+ +   KG L VR+ P  G +V+ L K+ V SY +I   M+ G  +RTVA TNMN TSSR+H V  I F Q    + +D+   K S ++LVDLAGSERADSTGA G RLKEGANINKSL+ LG VISALA++S  KKKT  +PYRDSVLT LL+  LGGNS+T M+AALSPADIN+DETL TLRYADRAKQIK  A++NE+P  KL+RELK E  RLK+ L +  L   ++I+ +  D                              VS ++  IM     E   +    SE I AE  + W  +L   RK  AI  + E   A+                  K  HL+NLNEDP +S  +++Y+ + +T + +   +                                 IVL G  I   H I   ER  N H         G++T +NG  + S   L   +RI+ G +H++ F  PE  + E +  P      + +DW +AQ E+    G 
Sbjct:    1 MSGASVKVAVRVRPFNSRETGKESKCIIQMQGNSTTILNPKNPKEPKTFSFDYSYWSHTS----------PDDPS--FASQNQVYNDIGKEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEEGQEGIIPQLCEELFEKINDNNNEEISYSVEVAYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQRKYDSETDLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVSKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINFDETLSTLRYADRAKQIKCNAVINEDPNAKLVRELKDEVSRLKELLRAQGLGDILDIEPMGDDCLGSGSKSPMGCLTASPSSGSLCSQAGLQSVSSIQERIMSTPGGEEAIERLKESEKIIAELNETWEEKL---RKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAE-----------------------------RRQDIVLSGAHIKEEHCIFRSERNANGHVIVTLEPCEGSETYVNGKRVNSAVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPVEPVDWTFAQRELLEKQGI 639          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif1b (kinesin family member 1B [Source:ZFIN;Acc:ZDB-GENE-030820-1])

HSP 1 Score: 457.988 bits (1177), Expect = 9.969e-142
Identity = 285/685 (41.61%), Postives = 380/685 (55.47%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYG--ANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDI--RKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT-IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSD-----------------------------EVSELRREIME----EFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEAD---------------KRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAII--ERK-NEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVK-ENKNLP------KLIDWEYAQNEIAHADGF 1976
            MS  SVKVAVRVRPFN RE  + +K  I MQGN+T I NP+N  + K F+FDYSYWSH            PD P+  +ASQ  V+ D+GK +L++AF GYN  +FAYGQTG+GKSY+M+G      +GI+P +C+ELF+K+  N+++ + Y V  + +EIY E VRDLL+ +   KG L VR+ P  G +V+ L K+ V SY +I   M+ G  +RTVA TNMN TSSR+H V  I F Q    + +D+   K S ++LVDLAGSERADSTGA G RLKEGANINKSL+ LG VISALA++S  KKKT  +PYRDSVLT LL+  LGGNS+T M+AALSPADIN+DETL TLRYADRAKQIK  A++NE+P  KL+RELK E  RLK+ L +  L   ++I+ +  D                              VS ++  IM     E   +    SE I AE  + W  +L   RK  AI  + E   A+                  K  HL+NLNEDP +S  +++Y+ + +T + +   +                                 IVL G  I   H I   ER  N H         G++T +NG  + S   L   +RI+ G +H++ F  PE  + E +  P      + +DW +AQ E+    G 
Sbjct:    1 MSGASVKVAVRVRPFNSRETGKESKCIIQMQGNSTTILNPKNPKEPKTFSFDYSYWSHTS----------PDDPS--FASQNQVYNDIGKEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEEGQEGIIPQLCEELFEKINDNNNEEISYSVEVAYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQRKYDSETDLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVSKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINFDETLSTLRYADRAKQIKCNAVINEDPNAKLVRELKDEVSRLKELLRAQGLGDILDIEPMGDDCLGSGSKSPMGCLTASPSSGSLCSQAGLQSVSSIQERIMSTPGGEEAIERLKESEKIIAELNETWEEKL---RKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAE-----------------------------RRQDIVLSGAHIKEEHCIFRSERNANGHVIVTLEPCEGSETYVNGKRVNSAVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPVEPVDWTFAQRELLEKQGI 639          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif1b (kinesin family member 1B [Source:ZFIN;Acc:ZDB-GENE-030820-1])

HSP 1 Score: 458.373 bits (1178), Expect = 9.847e-138
Identity = 285/672 (42.41%), Postives = 379/672 (56.40%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYG--ANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDI--RKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT-IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQAL--------------------NSGNLPQTVNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEAD---------------KRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAII--ER-KNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVK-ENKNLPKL------IDWEYAQNEIAHADGF 1976
            MS  SVKVAVRVRPFN RE  + +K  I MQGN+T I NP+N  + K F+FDYSYWSH            PD P+  +ASQ  V+ D+GK +L++AF GYN  +FAYGQTG+GKSY+M+G      +GI+P +C+ELF+K+  N+++ + Y V  + +EIY E VRDLL+ +   KG L VR+ P  G +V+ L K+ V SY +I   M+ G  +RTVA TNMN TSSR+H V  I F Q    + +D+   K S ++LVDLAGSERADSTGA G RLKEGANINKSL+ LG VISALA++S  KKKT  +PYRDSVLT LL+  LGGNS+T M+AALSPADIN+DETL TLRYADRAKQIK  A++NE+P  KL+RELK E  RLK+ L                    +SG+L     +Q +SS +   +     EE   ++   SE I AE  + W  +L   RK  AI  + E   A+                  K  HL+NLNEDP +S  +++Y+ + +T + +   +                                 IVL G  I   H I   ER  N H         G++T +NG  + S   L   +RI+ G +H++ F  PE  + E +  P        +DW +AQ E+    G 
Sbjct:    1 MSGASVKVAVRVRPFNSRETGKESKCIIQMQGNSTTILNPKNPKEPKTFSFDYSYWSHTS----------PDDPS--FASQNQVYNDIGKEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEEGQEGIIPQLCEELFEKINDNNNEEISYSVEVAYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQRKYDSETDLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVSKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINFDETLSTLRYADRAKQIKCNAVINEDPNAKLVRELKDEVSRLKELLRAQGLGDILDTPMGCLTASPSSGSLCSQAGLQSVSSIQERIMSTPGGEEAIERLK-ESEKIIAELNETWEEKL---RKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAE-----------------------------RRQDIVLSGAHIKEEHCIFRSERNANGHVIVTLEPCEGSETYVNGKRVNSAVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPVEPVDWTFAQRELLEKQGI 625          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif1b (kinesin family member 1B [Source:ZFIN;Acc:ZDB-GENE-030820-1])

HSP 1 Score: 457.603 bits (1176), Expect = 1.491e-137
Identity = 285/672 (42.41%), Postives = 379/672 (56.40%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYG--ANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDI--RKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT-IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQAL--------------------NSGNLPQTVNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEAD---------------KRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAII--ER-KNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVK-ENKNLPKL------IDWEYAQNEIAHADGF 1976
            MS  SVKVAVRVRPFN RE  + +K  I MQGN+T I NP+N  + K F+FDYSYWSH            PD P+  +ASQ  V+ D+GK +L++AF GYN  +FAYGQTG+GKSY+M+G      +GI+P +C+ELF+K+  N+++ + Y V  + +EIY E VRDLL+ +   KG L VR+ P  G +V+ L K+ V SY +I   M+ G  +RTVA TNMN TSSR+H V  I F Q    + +D+   K S ++LVDLAGSERADSTGA G RLKEGANINKSL+ LG VISALA++S  KKKT  +PYRDSVLT LL+  LGGNS+T M+AALSPADIN+DETL TLRYADRAKQIK  A++NE+P  KL+RELK E  RLK+ L                    +SG+L     +Q +SS +   +     EE   ++   SE I AE  + W  +L   RK  AI  + E   A+                  K  HL+NLNEDP +S  +++Y+ + +T + +   +                                 IVL G  I   H I   ER  N H         G++T +NG  + S   L   +RI+ G +H++ F  PE  + E +  P        +DW +AQ E+    G 
Sbjct:    1 MSGASVKVAVRVRPFNSRETGKESKCIIQMQGNSTTILNPKNPKEPKTFSFDYSYWSHTS----------PDDPS--FASQNQVYNDIGKEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEEGQEGIIPQLCEELFEKINDNNNEEISYSVEVAYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQRKYDSETDLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVSKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINFDETLSTLRYADRAKQIKCNAVINEDPNAKLVRELKDEVSRLKELLRAQGLGDILDTPMGCLTASPSSGSLCSQAGLQSVSSIQERIMSTPGGEEAIERLK-ESEKIIAELNETWEEKL---RKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAE-----------------------------RRQDIVLSGAHIKEEHCIFRSERNANGHVIVTLEPCEGSETYVNGKRVNSAVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPVEPVDWTFAQRELLEKQGI 625          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif1ab (kinesin family member 1Ab [Source:ZFIN;Acc:ZDB-GENE-070912-480])

HSP 1 Score: 441.425 bits (1134), Expect = 1.292e-131
Identity = 282/692 (40.75%), Postives = 374/692 (54.05%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGA--NKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSD--IRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKK--TIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLP----------------QTVNIQG--------------------LSS--DEVSELRREIM----EEFKAQMSANSEIIAAEDPKIWNARL----------EEARKEVAIISKEEKNEADKRS--KLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKN----EHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKENKNLPKL-------IDWEYAQNEIAHADG 1973
            M+  SVKVAVRVRPFN RE  + +K  I M GNTT I NP+   + K F FDYSYWSH    ED N           YA QK V+ D+G+ +L +AF GYN  +FAYGQTG+GKSY+M+G      +GI+P++C++LF K+  N+ ++M Y V  S +EIY E VRDLL+ +   KG L VR+ P  G +V+ L K+ V SY +I+  M+ G  +RTVA TNMN TSSR+H V  I F Q    N S+    K S ++LVDLAGSERADSTGA G RLKEGANINKSL+ LG VISALA+++  KKK  + +PYRDSVLT LL+  LGGNS+T M+AALSPADINYDETL TLRYADRAKQI+  A++NE+P  +L+RELK E  RLK  L +  L                 Q VN +G                    L+S    +S L   IM     E   +    +E I AE  + W  +L          E    E+ +  +E+       S  K  HL+NLNEDP +S  +++Y+ + +T + R                                     IVL G  I + H I         E +  + P   GA+T +NG  +T    L   +RI+ G  H++ F DPE  ++++            +DW +AQ E+    G
Sbjct:    1 MAGASVKVAVRVRPFNSREIGKDSKCIIQMSGNTTTILNPKQPKENKSFNFDYSYWSHTT-PEDVN-----------YACQKQVYRDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQEGIIPLLCEDLFTKINDNNDNNMSYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLMGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKQHDNDSENTTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMNKKKKKVESFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDPNNRLVRELKEEVARLKDLLYAQGLGDIIENLSNYKANISSIQAVNQRGDFSTVTNAMTGMSPSPSLSALTSRVGSISSLHDRIMFSPGSEEAIERLKETEKIIAELNETWEEKLRRTEAIRMEREALLAEMGVAMREDGGTVGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITKVGREDASSR-----------------------------QDIVLSGHFIKDEHCIFTSTTNAIGEGTVVLEPC-EGAETYVNGKRVTEPTVLKSGNRIIMGKSHVFRFNDPEQARQDRERTPCADTPVEPVDWAFAQRELLEKQG 648          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: kcnq4 (potassium channel, voltage gated KQT-like subfamily Q, member 4 [Source:Xenbase;Acc:XB-GENE-5817035])

HSP 1 Score: 560.066 bits (1442), Expect = 0.000e+0
Identity = 327/805 (40.62%), Postives = 467/805 (58.01%), Query Frame = 3
Query:  165 EKDRLAKLTIDMQGNTTIITNPENSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARLEEARKE----VAIISKEEKNEADKRSKLH-HLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKENKNLPKLIDWEYAQNEIAHADGFGTENVKGLT-KDXXXXXXXILEILPMISEVNAISEELEKSKTFEIILVPPNAQDSKYGSAKRTAIMIKVMDNKNGNFWIWERGKFMSRRYLMQEMYQQFLE--DKSLKETISSKDPFWEPTGEVLIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSISPSTSNGRVIDEDNFVDDPKSLLTRTYHFLIGI 2555
            EKD  +K  I M+ N T I +P+N  ++K F FD +YWSH E+++++   L+PDG  SRYA QK+VF+DLG+ +L+NA+ GYN +L AYGQTGSGKSYSM+GYG N+GI+P++C+ELF+ +E N   + +Y+VTFSMLEIYNE V DLLSK  +  GGL VR+   QGF+V GLK +P  SY +IE  +EQG   RT A T+MNA+SSR+H V+ I F QI      DI K S +NLVDLAGSER  S+ + GDRL+EG  +N SL+ LGNVISALA+ + GKK   +PYRDSVLTKLLQ+ALGGNS+TVMIAA+SPADI Y+ETL TLRY         K  V+   V + LR L  EN                           ELR + M+                    W  +L+EARKE     A I++E      +  +L+ +LLN+NEDPQLSG++ H++ E  + + +                                   N I L+GL I  +HA         F ++P   G K  +NG  +     L H DRI+ GS+  YL+I     +   +L +  D+++ Q+E+A A+GF  + ++G        V    ++++P+++E N +SEEL K   FE+ +      DS+ G   +  I +KV++      WIW + KF++R++LM+E+YQ++L+  D SL       DPFW+P   + +G+A+++LQ+LA+ +  E++  +LN EG EE  + ++I+P +   R   E++ V DP  LL R   F I I
Sbjct:   18 EKDASSKCVISMKTNCTTICDPKNVGNEKTFKFDLAYWSHSEYLKNTESTLVPDGSYSRYADQKTVFQDLGQGILDNAWQGYNATLLAYGQTGSGKSYSMIGYGTNRGIIPLVCEELFRAIENNQEKNKQYQVTFSMLEIYNEQVTDLLSK-TKKSGGLKVREDQHQGFYVDGLKLVPCESYAQIERLIEQGKKIRTTASTSMNASSSRSHMVITIQFKQILLKE--DITKQSSINLVDLAGSERQKSSASEGDRLREGTCVNLSLTTLGNVISALAEAAMGKKVLHIPYRDSVLTKLLQSALGGNSRTVMIAAISPADICYEETLSTLRYC--------KVYVS---VSEELRRLLAEN---------------------------ELRIQTMQ------------------ITWEHQLQEARKEWEQQYAAITQER-----RMMQLYPYLLNINEDPQLSGVLKHFIQEGASDVGQDPS--------------------------------NVITLRGLGILPQHATFINSESKVF-VKPHGKG-KVIVNGVPIVLNTKLQHLDRIILGSNSAYLYIGFPAERGPDDLCRF-DYDFFQSELAAAEGFSVDTLEGKPDPSVLAVFHDFIKLMPLVAEANQMSEELSKDLKFELKVKNLALTDSR-GYDLQKEISVKVINQITNQVWIWSKSKFINRKFLMEELYQRYLDGGDISLDR---ESDPFWDPVEVIHLGSAHIWLQSLAYCMKLEEQTELLNSEGVEEAILVINITPCSDTERPFGEEDIVIDPLELLGRKIEFQIHI 719          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: kif1c (kinesin family member 1C [Source:NCBI gene;Acc:779557])

HSP 1 Score: 447.588 bits (1150), Expect = 7.979e-139
Identity = 281/658 (42.71%), Postives = 375/658 (56.99%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDK-KVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANK--GIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGS--DIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT-IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQ---TVNIQGLSSDEVSEL-RREIMEEFKAQMSANSEIIAAEDPKIWNARLEEAR----------KEVAIISKEEKNEADKRS--KLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKNEHS----FTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVK----------ENKNLPKLIDWEYAQNEIAHADGF 1976
            M+  SVKVAVRVRPFN RE    AK  I MQGNTT I+NP+   D  K FTFDYSYWSH    ED N           +ASQ  V++D+G+ +L +AF GYN  +FAYGQTGSGKSY+M+G   ++  GI+P +C++LF ++  N S  +   V  S +EIY E VRDLL+ ++  KG L VR+ P  G +V+ L K+ V SY +I   M+ G  +RTVA TNMN TSSR+H V  I F Q      +  D  K S ++LVDLAGSERADSTGA G RLKEGANINKSL+ LG VISALA++ N KKK+  +PYRDS LT LL+  LGGNS+T MIAALSPADINY+ETL TLRYADRAKQIK  A++NE+P  +L+RELK E  RL+Q L S  L     +V +   SS + +E+   E ME  +      +E I AE  + W  +L +             E+ +  +E+       S  K+ HL+NLNEDP +S  +++++ E +T + +                                +E++ I L G  I  +H +       S     T+ P   GA+T +NG  +T    L    RI+ G +H++ F  PE  +          EN + P  +DW +AQ E+    G 
Sbjct:    1 MAGASVKVAVRVRPFNSREIAHDAKCVIQMQGNTTCISNPKQPKDSAKNFTFDYSYWSHT-TAEDPN-----------FASQCQVYKDIGEEMLLHAFEGYNVCIFAYGQTGSGKSYTMMGKPESEQHGIIPQLCEDLFARVSANRSPDLSCSVEVSYMEIYCERVRDLLNPKS--KGNLRVREHPIMGPYVEDLSKLAVTSYHDIADLMDCGNKARTVAATNMNETSSRSHAVFTIVFTQKRHDEMTNLDTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMQNKKKKSDFIPYRDSALTWLLKENLGGNSRTAMIAALSPADINYEETLSTLRYADRAKQIKCNAVINEDPNARLIRELKEEVARLRQLLYSQGLEGKTLSVLVAATSSSDAAEICTEEAMERLQ-----ETEKIIAELNETWEEKLRKTEALRTEREALLAEMGVAVREDGGTVGVFSPKKIPHLVNLNEDPLMSECLLYHIKEGITRVGQ--------------------------------VEVD-IKLSGQFIKEQHCLFHCDTNPSGEVIVTLEPC-EGAETYVNGKLVTQALVLKSGTRIVMGKNHVFRFNHPEQARLERERSSAAIENPSEP--VDWNFAQKELLEKQGI 603          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: kif1c (kinesin family member 1C [Source:NCBI gene;Acc:779557])

HSP 1 Score: 438.343 bits (1126), Expect = 4.242e-135
Identity = 281/674 (41.69%), Postives = 370/674 (54.90%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDK-KVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANK--GIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGS--DIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT-IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRR--------------------EIMEEFKAQMSANSEIIAAEDPKIWNARLEEAR----------KEVAIISKEEKNEADKRS--KLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKNEHS----FTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVK----------ENKNLPKLIDWEYAQNEIAHADGF 1976
            M+  SVKVAVRVRPFN RE    AK  I MQGNTT I+NP+   D  K FTFDYSYWSH    ED N           +ASQ  V++D+G+ +L +AF GYN  +FAYGQTGSGKSY+M+G   ++  GI+P +C++LF ++  N S  +   V  S +EIY E VRDLL+ ++  KG L VR+ P  G +V+ L K+ V SY +I   M+ G  +RTVA TNMN TSSR+H V  I F Q      +  D  K S ++LVDLAGSERADSTGA G RLKEGANINKSL+ LG VISALA++ N KKK+  +PYRDS LT LL+  LGGNS+T MIAALSPADINY+ETL TLRYADRAKQIK  A++NE+P  +L+RELK E  RL+Q L S         QGL  D  S                        EI  E   +    +E I AE  + W  +L +             E+ +  +E+       S  K+ HL+NLNEDP +S  +++++ E +T + +                                +E++ I L G  I  +H +       S     T+ P   GA+T +NG  +T    L    RI+ G +H++ F  PE  +          EN + P  +DW +AQ E+    G 
Sbjct:    1 MAGASVKVAVRVRPFNSREIAHDAKCVIQMQGNTTCISNPKQPKDSAKNFTFDYSYWSHT-TAEDPN-----------FASQCQVYKDIGEEMLLHAFEGYNVCIFAYGQTGSGKSYTMMGKPESEQHGIIPQLCEDLFARVSANRSPDLSCSVEVSYMEIYCERVRDLLNPKS--KGNLRVREHPIMGPYVEDLSKLAVTSYHDIADLMDCGNKARTVAATNMNETSSRSHAVFTIVFTQKRHDEMTNLDTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMQNKKKKSDFIPYRDSALTWLLKENLGGNSRTAMIAALSPADINYEETLSTLRYADRAKQIKCNAVINEDPNARLIRELKEEVARLRQLLYS---------QGLEDDSASAPHPPSPAAAPVSPPPLPGSLDAAEICTEEAMERLQETEKIIAELNETWEEKLRKTEALRTEREALLAEMGVAVREDGGTVGVFSPKKIPHLVNLNEDPLMSECLLYHIKEGITRVGQ--------------------------------VEVD-IKLSGQFIKEQHCLFHCDTNPSGEVIVTLEPC-EGAETYVNGKLVTQALVLKSGTRIVMGKNHVFRFNHPEQARLERERSSAAIENPSEP--VDWNFAQKELLEKQGI 615          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: kif1c (kinesin family member 1C [Source:NCBI gene;Acc:779557])

HSP 1 Score: 436.417 bits (1121), Expect = 3.088e-134
Identity = 281/680 (41.32%), Postives = 371/680 (54.56%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDK-KVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANK--GIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGS--DIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT-IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNL------------------------PQTVNIQGLSSDEVSELR--REIMEEFKAQMSANSEIIAAEDPKIWNARLEEAR----------KEVAIISKEEKNEADKRS--KLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKNEHS----FTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVK----------ENKNLPKLIDWEYAQNEIAHADGF 1976
            M+  SVKVAVRVRPFN RE    AK  I MQGNTT I+NP+   D  K FTFDYSYWSH    ED N           +ASQ  V++D+G+ +L +AF GYN  +FAYGQTGSGKSY+M+G   ++  GI+P +C++LF ++  N S  +   V  S +EIY E VRDLL+ ++  KG L VR+ P  G +V+ L K+ V SY +I   M+ G  +RTVA TNMN TSSR+H V  I F Q      +  D  K S ++LVDLAGSERADSTGA G RLKEGANINKSL+ LG VISALA++ N KKK+  +PYRDS LT LL+  LGGNS+T MIAALSPADINY+ETL TLRYADRAKQIK  A++NE+P  +L+RELK E  RL+Q L S  L                        P     Q   S+   E     EI  E   +    +E I AE  + W  +L +             E+ +  +E+       S  K+ HL+NLNEDP +S  +++++ E +T + +                                +E++ I L G  I  +H +       S     T+ P   GA+T +NG  +T    L    RI+ G +H++ F  PE  +          EN + P  +DW +AQ E+    G 
Sbjct:    1 MAGASVKVAVRVRPFNSREIAHDAKCVIQMQGNTTCISNPKQPKDSAKNFTFDYSYWSHT-TAEDPN-----------FASQCQVYKDIGEEMLLHAFEGYNVCIFAYGQTGSGKSYTMMGKPESEQHGIIPQLCEDLFARVSANRSPDLSCSVEVSYMEIYCERVRDLLNPKS--KGNLRVREHPIMGPYVEDLSKLAVTSYHDIADLMDCGNKARTVAATNMNETSSRSHAVFTIVFTQKRHDEMTNLDTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMQNKKKKSDFIPYRDSALTWLLKENLGGNSRTAMIAALSPADINYEETLSTLRYADRAKQIKCNAVINEDPNARLIRELKEEVARLRQLLYSQGLEALGGEHGPAAAPVSPPPLPGSLAPLASPTQNGQSEPFPEGEDAAEICTEEAMERLQETEKIIAELNETWEEKLRKTEALRTEREALLAEMGVAVREDGGTVGVFSPKKIPHLVNLNEDPLMSECLLYHIKEGITRVGQ--------------------------------VEVD-IKLSGQFIKEQHCLFHCDTNPSGEVIVTLEPC-EGAETYVNGKLVTQALVLKSGTRIVMGKNHVFRFNHPEQARLERERSSAAIENPSEP--VDWNFAQKELLEKQGI 630          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: kif1c (kinesin family member 1C [Source:NCBI gene;Acc:779557])

HSP 1 Score: 432.565 bits (1111), Expect = 6.352e-133
Identity = 281/676 (41.57%), Postives = 368/676 (54.44%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDK-KVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANK--GIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGS--DIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT-IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNL--------------------------------PQTVNIQGLSSDEVSELR--REIMEEFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEADKRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKNEHS----FTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVK----------ENKNLPKLIDWEYAQNEIAHADGF 1976
            M+  SVKVAVRVRPFN RE    AK  I MQGNTT I+NP+   D  K FTFDYSYWSH    ED N           +ASQ  V++D+G+ +L +AF GYN  +FAYGQTGSGKSY+M+G   ++  GI+P +C++LF ++  N S  +   V  S +EIY E VRDLL+ ++  KG L VR+ P  G +V+ L K+ V SY +I   M+ G  +RTVA TNMN TSSR+H V  I F Q      +  D  K S ++LVDLAGSERADSTGA G RLKEGANINKSL+ LG VISALA++ N KKK+  +PYRDS LT LL+  LGGNS+T MIAALSPADINY+ETL TLRYADRAKQIK  A++NE+P  +L+RELK E  RL+Q L S  L                                P     Q   S+   E     EI  E   +    +E I AE  + W  +L   RK  A+     + E      + HL+NLNEDP +S  +++++ E +T + +                                +E++ I L G  I  +H +       S     T+ P   GA+T +NG  +T    L    RI+ G +H++ F  PE  +          EN + P  +DW +AQ E+    G 
Sbjct:    1 MAGASVKVAVRVRPFNSREIAHDAKCVIQMQGNTTCISNPKQPKDSAKNFTFDYSYWSHT-TAEDPN-----------FASQCQVYKDIGEEMLLHAFEGYNVCIFAYGQTGSGKSYTMMGKPESEQHGIIPQLCEDLFARVSANRSPDLSCSVEVSYMEIYCERVRDLLNPKS--KGNLRVREHPIMGPYVEDLSKLAVTSYHDIADLMDCGNKARTVAATNMNETSSRSHAVFTIVFTQKRHDEMTNLDTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMQNKKKKSDFIPYRDSALTWLLKENLGGNSRTAMIAALSPADINYEETLSTLRYADRAKQIKCNAVINEDPNARLIRELKEEVARLRQLLYSQGLEDIVIDDSASAPHPPSPAAAPVSPPPLPGSLAPLASPTQNGQSEPFPEGEDAAEICTEEAMERLQETEKIIAELNETWEEKL---RKTEAL-----RTERWGVISIPHLVNLNEDPLMSECLLYHIKEGITRVGQ--------------------------------VEVD-IKLSGQFIKEQHCLFHCDTNPSGEVIVTLEPC-EGAETYVNGKLVTQALVLKSGTRIVMGKNHVFRFNHPEQARLERERSSAAIENPSEP--VDWNFAQKELLEKQGI 618          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif28 (kinesin family member 28 [Source:MGI Symbol;Acc:MGI:2686151])

HSP 1 Score: 583.948 bits (1504), Expect = 0.000e+0
Identity = 345/915 (37.70%), Postives = 520/915 (56.83%), Query Frame = 3
Query:  120 ESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEADKRSK-----LHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKENKNLPKLIDWEYAQNEIAHADGFGTENVKGLTKDXXXXXXXIL-------EILPMISEVNAISEELEKSKTFEIILVPPNAQDSKYGSAKRTAIMIKVMDNKNGNFWIWERGKFMSRRYLMQEMYQQFLEDKSLKETISSKDPFWEPTGEVLIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSISPSTSNGRVIDEDNFVDDPKSLLTRTYHF---LIGIASVELHNAKYTIGIKVRFRIFKDEKSFETETSKGSKSAVFNYNKVISFARI--TQEHLDYFLTGYITFRIFVNQDDSNK-NVIRLDLL 2810
            +SV+VAVRVRPF+QREK+  ++  I M      I +P+N    K FTFD +YWSHD F +D +G LIP  P S++A Q  VF D+G+ +L++A+ GYN +L AYGQTGSGKSYSM+G+G NKG++P +C+ELF+ +E    +++  +V FSMLEIYNE +RDLLS+   P GGL VR+    GFFV+GLK +P  +Y +IE  +EQG+  R  A TNMNA+SSR+H ++ I F Q+       + K S +N+VDLAGSER  S+G+ GDRL+EG+ +N SL+ LGNVISALADL+ GKK   +PYRDSVLTKLLQ+ALGGNS+T +IAALSPADI Y+ETL TLRYA+RAK+++N+A++N  P   L R  + EN  L            +  +G  + E           F A+    ++         W   LE+AR+E      EE+ EA  + +     L HLLN+NEDPQL+G++  ++      + R +                                 N I L+GL IS++HA     +    T+ P  +  K  +NG  +T    L H DRI+ GS+  +L++   + +  ++L +  D+++ Q E A A+G     +  ++         IL       +++P++ E N +SEEL+K  T E+ +    + DS+ G   +  +M+KV        WIW + KF++R++LM+E+YQ+FLE +         DPFW+P   V +G+A+V+LQ LA  +  E+++  LN +G EE  + + I+P +  G    E++ V DP  LL +   F   ++    V+      + GI++ ++I+    +  T+     KS      + + FA +  ++E LDY LT  +   ++  Q+      V +LD+L
Sbjct:   15 DSVRVAVRVRPFSQREKNSGSQCVISMHSGNISIRDPKNEERVKTFTFDLTYWSHDGFQKDEDGVLIPSDPASKFAGQSDVFHDIGRGILDSAWRGYNATLLAYGQTGSGKSYSMIGFGTNKGLIPRVCEELFQAIE-KQKENLEPQVMFSMLEIYNEQIRDLLSRTKAP-GGLRVREDQQLGFFVEGLKWVPCENYAQIEKLVEQGSKIRMTASTNMNASSSRSHMLIAIQFKQVFLDTA--LTKRSSINMVDLAGSERQRSSGSEGDRLREGSRVNLSLTSLGNVISALADLAMGKKVLHIPYRDSVLTKLLQSALGGNSRTTLIAALSPADICYEETLSTLRYAERAKKVRNRAVINTCP---LARASRAENALL------------LGFRGAGAAEHPAC-------FWAEQQLGNQ-------GTWAQLLEQARREW-----EEQYEALTQEQKMVRILPHLLNVNEDPQLTGVLKFFIHNGSCDVGRAAS--------------------------------NAICLQGLGISDKHASFVNLD-GKVTVAPH-SKCKVIVNGVPVTGRTKLQHLDRIILGSNSAFLYVGFPSERGAEDLSRF-DYDFFQLERAAAEGVSVATLGCVSPGDDQADPSILAVFQDYVKLMPLVVEANQMSEELKKGLTMELKVKNLASSDSR-GYDLQKEVMVKVTKQGTHEVWIWSKAKFINRKFLMEELYQRFLESRD-SHVAQEDDPFWDPLEVVHLGSAHVWLQPLAHCMMLEEQVEFLNCDGLEEAVLHIRITPCSPEGWAHGEEDMVIDPLELLGKRIDFQTHIVRCLGVKWLKEDGSRGIQMGYKIYDLPNTLYTKPV--WKSVNPRIEETVHFAALGASREFLDYLLTNALIVDLWGLQEGCAPLGVSQLDVL 852          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif28 (kinesin family member 28 [Source:MGI Symbol;Acc:MGI:2686151])

HSP 1 Score: 583.948 bits (1504), Expect = 0.000e+0
Identity = 345/915 (37.70%), Postives = 520/915 (56.83%), Query Frame = 3
Query:  120 ESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEADKRSK-----LHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKENKNLPKLIDWEYAQNEIAHADGFGTENVKGLTKDXXXXXXXIL-------EILPMISEVNAISEELEKSKTFEIILVPPNAQDSKYGSAKRTAIMIKVMDNKNGNFWIWERGKFMSRRYLMQEMYQQFLEDKSLKETISSKDPFWEPTGEVLIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSISPSTSNGRVIDEDNFVDDPKSLLTRTYHF---LIGIASVELHNAKYTIGIKVRFRIFKDEKSFETETSKGSKSAVFNYNKVISFARI--TQEHLDYFLTGYITFRIFVNQDDSNK-NVIRLDLL 2810
            +SV+VAVRVRPF+QREK+  ++  I M      I +P+N    K FTFD +YWSHD F +D +G LIP  P S++A Q  VF D+G+ +L++A+ GYN +L AYGQTGSGKSYSM+G+G NKG++P +C+ELF+ +E    +++  +V FSMLEIYNE +RDLLS+   P GGL VR+    GFFV+GLK +P  +Y +IE  +EQG+  R  A TNMNA+SSR+H ++ I F Q+       + K S +N+VDLAGSER  S+G+ GDRL+EG+ +N SL+ LGNVISALADL+ GKK   +PYRDSVLTKLLQ+ALGGNS+T +IAALSPADI Y+ETL TLRYA+RAK+++N+A++N  P   L R  + EN  L            +  +G  + E           F A+    ++         W   LE+AR+E      EE+ EA  + +     L HLLN+NEDPQL+G++  ++      + R +                                 N I L+GL IS++HA     +    T+ P  +  K  +NG  +T    L H DRI+ GS+  +L++   + +  ++L +  D+++ Q E A A+G     +  ++         IL       +++P++ E N +SEEL+K  T E+ +    + DS+ G   +  +M+KV        WIW + KF++R++LM+E+YQ+FLE +         DPFW+P   V +G+A+V+LQ LA  +  E+++  LN +G EE  + + I+P +  G    E++ V DP  LL +   F   ++    V+      + GI++ ++I+    +  T+     KS      + + FA +  ++E LDY LT  +   ++  Q+      V +LD+L
Sbjct:   15 DSVRVAVRVRPFSQREKNSGSQCVISMHSGNISIRDPKNEERVKTFTFDLTYWSHDGFQKDEDGVLIPSDPASKFAGQSDVFHDIGRGILDSAWRGYNATLLAYGQTGSGKSYSMIGFGTNKGLIPRVCEELFQAIE-KQKENLEPQVMFSMLEIYNEQIRDLLSRTKAP-GGLRVREDQQLGFFVEGLKWVPCENYAQIEKLVEQGSKIRMTASTNMNASSSRSHMLIAIQFKQVFLDTA--LTKRSSINMVDLAGSERQRSSGSEGDRLREGSRVNLSLTSLGNVISALADLAMGKKVLHIPYRDSVLTKLLQSALGGNSRTTLIAALSPADICYEETLSTLRYAERAKKVRNRAVINTCP---LARASRAENALL------------LGFRGAGAAEHPAC-------FWAEQQLGNQ-------GTWAQLLEQARREW-----EEQYEALTQEQKMVRILPHLLNVNEDPQLTGVLKFFIHNGSCDVGRAAS--------------------------------NAICLQGLGISDKHASFVNLD-GKVTVAPH-SKCKVIVNGVPVTGRTKLQHLDRIILGSNSAFLYVGFPSERGAEDLSRF-DYDFFQLERAAAEGVSVATLGCVSPGDDQADPSILAVFQDYVKLMPLVVEANQMSEELKKGLTMELKVKNLASSDSR-GYDLQKEVMVKVTKQGTHEVWIWSKAKFINRKFLMEELYQRFLESRD-SHVAQEDDPFWDPLEVVHLGSAHVWLQPLAHCMMLEEQVEFLNCDGLEEAVLHIRITPCSPEGWAHGEEDMVIDPLELLGKRIDFQTHIVRCLGVKWLKEDGSRGIQMGYKIYDLPNTLYTKPV--WKSVNPRIEETVHFAALGASREFLDYLLTNALIVDLWGLQEGCAPLGVSQLDVL 852          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif1b (kinesin family member 1B [Source:MGI Symbol;Acc:MGI:108426])

HSP 1 Score: 448.743 bits (1153), Expect = 1.926e-138
Identity = 286/675 (42.37%), Postives = 377/675 (55.85%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTD-KKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYG--ANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDI--RKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT-IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQ-----------------GLSSDEVSELRREIME----EFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEAD---------------KRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAII--ERKN--EHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVK-ENKNLP------KLIDWEYAQNEIAHADGF 1976
            MS  SVKVAVRVRPFN RE  + +K  I MQGN+T I NP+N  +  K F+FDYSYWSH            P+ P   +ASQ  V+ D+GK +L +AF GYN  +FAYGQTG+GKSY+M+G    +  GI+P +C+ELF+K+  N ++ M Y V  S +EIY E VRDLL+   + KG L VR+ P  G +V+ L K+ V SY +I   M+ G  +RTVA TNMN TSSR+H V  I F Q  Q   +++   K S ++LVDLAGSERADSTGA G RLKEGANINKSL+ LG VISALA++S  KKKT  +PYRDSVLT LL+  LGGNS+T M+AALSPADINYDETL TLRYADRAKQIK  A++NE+P  KL+RELK E  RLK  L +  L   ++                   GL+S  V+ ++  IM     E   +    SE I AE  + W  +L   RK  AI  + E   A+                  K  HL+NLNEDP +S  +++Y+ + +T + +   +                                 IVL G  I   H +   ER N  E   T+ P    ++T +NG  +     L   +RI+ G +H++ F  PE  + E +  P      + +DW +AQ E+    G 
Sbjct:    1 MSGASVKVAVRVRPFNSRETSKESKCIIQMQGNSTSIINPKNPKEAPKSFSFDYSYWSHTS----------PEDPC--FASQNRVYNDIGKEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEESQAGIIPQLCEELFEKINDNCNEEMSYSVEVSYMEIYCERVRDLLN--PKNKGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQKKQDPETNLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVSKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIKCNAVINEDPNAKLVRELKEEVTRLKDLLRAQGLGDIIDTSMGSLTSSPSSCSLNSQVGLTS--VTSIQERIMSTPGGEEAIERLKESEKIIAELNETWEEKL---RKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAERR-----------------------------QDIVLSGAHIKEEHCLFRSERSNTGEVIVTLEPC-ERSETYVNGKRVAHPVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPSEPVDWTFAQRELLEKQGI 626          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif1b (kinesin family member 1B [Source:MGI Symbol;Acc:MGI:108426])

HSP 1 Score: 447.203 bits (1149), Expect = 9.462e-134
Identity = 286/674 (42.43%), Postives = 377/674 (55.93%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTD-KKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYG--ANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDI--RKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT-IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQ-----------------GLSSDEVSELRREIME----EFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEAD---------------KRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAII--ERKN--EHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVK-ENKNLP------KLIDWEYAQNEIAHADG 1973
            MS  SVKVAVRVRPFN RE  + +K  I MQGN+T I NP+N  +  K F+FDYSYWSH            P+ P   +ASQ  V+ D+GK +L +AF GYN  +FAYGQTG+GKSY+M+G    +  GI+P +C+ELF+K+  N ++ M Y V  S +EIY E VRDLL+ +   KG L VR+ P  G +V+ L K+ V SY +I   M+ G  +RTVA TNMN TSSR+H V  I F Q  Q   +++   K S ++LVDLAGSERADSTGA G RLKEGANINKSL+ LG VISALA++S  KKKT  +PYRDSVLT LL+  LGGNS+T M+AALSPADINYDETL TLRYADRAKQIK  A++NE+P  KL+RELK E  RLK  L +  L   ++                   GL+S  V+ ++  IM     E   +    SE I AE  + W  +L   RK  AI  + E   A+                  K  HL+NLNEDP +S  +++Y+ + +T + +   +                                 IVL G  I   H +   ER N  E   T+ P    ++T +NG  +     L   +RI+ G +H++ F  PE  + E +  P      + +DW +AQ E+    G
Sbjct:    1 MSGASVKVAVRVRPFNSRETSKESKCIIQMQGNSTSIINPKNPKEAPKSFSFDYSYWSHTS----------PEDPC--FASQNRVYNDIGKEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEESQAGIIPQLCEELFEKINDNCNEEMSYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQKKQDPETNLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVSKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIKCNAVINEDPNAKLVRELKEEVTRLKDLLRAQGLGDIIDTSMGSLTSSPSSCSLNSQVGLTS--VTSIQERIMSTPGGEEAIERLKESEKIIAELNETWEEKL---RKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAE-----------------------------RRQDIVLSGAHIKEEHCLFRSERSNTGEVIVTLEPC-ERSETYVNGKRVAHPVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPSEPVDWTFAQRELLEKQG 625          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif1c (kinesin family member 1C [Source:MGI Symbol;Acc:MGI:1098260])

HSP 1 Score: 431.024 bits (1107), Expect = 3.439e-132
Identity = 276/686 (40.23%), Postives = 374/686 (54.52%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTD-KKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGY--GANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQIT--QSNGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT-IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVS-------------------------ELRREIMEEFKAQMSA--------NSEIIAAEDPKIWNARL----------EEARKEVAIISKEEKNEADKRS--KLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHA----IIERKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKENKN---------LPKLIDWEYAQNEIAHADGF 1976
            M+  SVKVAVRVRPFN RE  + AK  + MQGNTT I NP+ S D  K FTFDYSYWSH   VED            ++ASQ+ V+ D+G+ +L +AF GYN  +FAYGQTG+GKSY+M+G      +GIVP +C++LF ++ +N S  + Y V  S +EIY E VRDLL+ ++  +G L VR+ P  G +VQ L K+ V SY +I   M+ G  +RTVA TNMN TSSR+H V  I F Q +  Q  G D  K S ++LVDLAGSERADS+GA G RLKEGANINKSL+ LG VISALADL + K+K+  +PYRDSVLT LL+  LGGNS+T MIAALSPADINY+ETL TLRYADR KQI+  A++NE+P  +L+REL+ E  RL+  L +  L  +  + GL  +E S                         EL        + Q+           +E I AE  + W  +L          E    E+ +  +E+       S  K  HL+NLNEDP +S  +++++ + +T + ++                                    I L G  I  +H     I +   E   T+ P   GA+T +NG  +T    L   +RI+ G +H++ F  PE  +  +            + +DW +AQ E+    G 
Sbjct:    1 MAGASVKVAVRVRPFNARETSQDAKCVVSMQGNTTSIINPKQSKDAPKSFTFDYSYWSHTS-VEDP-----------QFASQQQVYRDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGRQEPGQQGIVPQLCEDLFSRVNVNQSAQLSYSVEVSYMEIYCERVRDLLNPKS--RGSLRVREHPILGPYVQDLSKLAVTSYADIADLMDCGNKARTVAATNMNETSSRSHAVFTIVFTQRSHDQLTGLDSEKVSKISLVDLAGSERADSSGARGMRLKEGANINKSLTTLGKVISALADLQSKKRKSDFIPYRDSVLTWLLKENLGGNSRTAMIAALSPADINYEETLSTLRYADRTKQIRCNAVINEDPNARLIRELQEEVARLRDLLMAQGLSASA-LGGLKVEEGSPGGVLPPASSPPAPASPSSPPPHNGELEPSFSPSAEPQIGPEEAMERLQETEKIIAELNETWEEKLRKTEALRMEREALLAEMGVAVREDGGTVGVFSPKKTPHLVNLNEDPLMSECLLYHIKDGVTRVGQVD---------------------------------VDIKLTGQFIREQHCLFRSIPQPDGEVMVTLEPC-EGAETYVNGKLVTEPLVLKSGNRIVMGKNHVFRFNHPEQARLERERGVPPPPGPPSEPVDWNFAQKELLEQQGI 637          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|F8WLE0|KIF28_RAT (Kinesin-like protein KIF28P OS=Rattus norvegicus OX=10116 GN=Kif28p PE=2 SV=1)

HSP 1 Score: 585.489 bits (1508), Expect = 0.000e+0
Identity = 340/897 (37.90%), Postives = 510/897 (56.86%), Query Frame = 3
Query:  120 ESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEADKRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKENKNLPKLIDWEYAQNEIAHADGFGTENVKGLTKDXXXXXXXIL-------EILPMISEVNAISEELEKSKTFEIILVPPNAQDSKYGSAKRTAIMIKVMDNKNGNFWIWERGKFMSRRYLMQEMYQQFLEDKSLKETISSKDPFWEPTGEVLIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSISPSTSNGRVIDEDNFVDDPKSLLTRTYHFLIGIASVELHNAKY-----TIGIKVRFRIFKDEKSFETETSKGSKSAVFNYNKVISFARITQEHLDYFLTGYITFRIFVNQD 2774
            +SV+VAVRVRPF+QREK+  ++  I M   +  I +P+++   K FTFD +YWSHD F +D +G LIP  P S++A Q  VF D+G+ +L++A+ GYN +L AYGQTGSGKSYSM+GYGANKGI+P +C+ELF+ +E    +S+  +V FSMLEIYNE +RDLLS+   P GGL VR+    GFFV+GLK +P     +IE  +EQG+  R  A TNMNA+SSR+H ++ I F Q+       + K S +N+VDLAGSER  S+G+ GDRL+EG+ +N SL+ LGNVISALADL+ GKK   +PYRDSVLTKLLQ+ALGGNS+T +IAALSPADI Y+ETL TLRYA+RAK+++N+A++N  P   L+R  + EN  L            +   G  + E S         F A+    +          W   LE+AR+E          E      L HLLN+NEDPQL+G++  ++      + R +                                 N I L+ L IS++HA     +    T+ P + G K  +NG  ++S   L H DRI+ GS+  +L+I   + +  ++L +  D+++ Q E A A+G   + +   +         IL       +++P++ E N +SEEL+K    E+ +    + DS+ G   +  +M+KV        WIW + KF++R++LM+E+YQ+FLE +         DPFW+P   + +G+A+V+LQ+LA  +  E+++  LN EG EE  + + I+P +  G    E++ V DP  LL +   F I I  V+    K+     T GI++ ++++    +  T+    S +     +   +   +++E L+Y LT  +   ++  Q+
Sbjct:   15 DSVRVAVRVRPFSQREKNSGSQCVISMHARSITIRDPKDAELVKTFTFDLAYWSHDGFQKDEDGVLIPSDPTSKFAGQSDVFHDIGRGILDSAWQGYNATLLAYGQTGSGKSYSMIGYGANKGIIPRVCEELFQAIE-KQKESLEAQVMFSMLEIYNEQIRDLLSRTKAP-GGLRVREDQRLGFFVEGLKWVPCEDSVQIEKLVEQGSKIRMTASTNMNASSSRSHMLIAIRFKQVFLDTA--LTKQSSINMVDLAGSERQRSSGSEGDRLREGSRVNLSLTNLGNVISALADLAMGKKVLHIPYRDSVLTKLLQSALGGNSRTTLIAALSPADICYEETLSTLRYAERAKKVRNRAVINTCP---LVRASRAENALL------------LGFGGAGAAEHSAC-------FWAEQQLGTW-------GTWAQLLEQARREWEQQYMALAQEQQMVKILPHLLNVNEDPQLTGVLKFFIHNGSCEVGRAAS--------------------------------NAICLQSLGISDKHASFTNMD-GKVTVAPHITG-KVIVNGVPVSSRTKLQHLDRIILGSNSAFLYIGFPSERGAEDLGRF-DYDFFQMERAAAEGVSVDMLGTASPGDDQADPSILAVFQDYIKLMPLVVEANQMSEELKKGLKMELKVKNLASSDSR-GCDLQKEVMVKVTKQGTHEVWIWSKAKFINRKFLMEELYQRFLESRD-SHVAQEDDPFWDPVEVLHLGSAHVWLQSLAHRMMLEEQVEFLNCEGLEEAVLHIQITPCSPEGWAHGEEDTVIDPLELLGKRIDFQIHI--VQCLGVKWLKEDATRGIQLGYKVYDLPNTLYTKPVWQSVNPRVEESVHFAALGVSREFLNYLLTNALVVDLWGLQE 839          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|D3YXS5|KIF28_MOUSE (Kinesin-like protein KIF28P OS=Mus musculus OX=10090 GN=Kif28p PE=3 SV=1)

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 345/915 (37.70%), Postives = 519/915 (56.72%), Query Frame = 3
Query:  120 ESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEADKRSK-----LHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKENKNLPKLIDWEYAQNEIAHADGFGTENVKGLTKDXXXXXXXIL-------EILPMISEVNAISEELEKSKTFEIILVPPNAQDSKYGSAKRTAIMIKVMDNKNGNFWIWERGKFMSRRYLMQEMYQQFLEDKSLKETISSKDPFWEPTGEVLIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSISPSTSNGRVIDEDNFVDDPKSLLTRTYHF---LIGIASVELHNAKYTIGIKVRFRIFKDEKSFETETSKGSKSAVFNYNKVISFARI--TQEHLDYFLTGYITFRIFVNQDDSNK-NVIRLDLL 2810
            +SV+VAVRVRPF+QREK+  ++  I M      I +P+N    K FTFD +YWSHD F +D +G LIP  P S++A Q  VF D+G+ +L++A+ GYN +L AYGQTGSGKSYSM+G+G NKG++P +C+ELF+ +E    +++  +V FSMLEIYNE +RDLLS+   P GGL VR+    GFFV+GLK +P  +Y +IE  +EQG+  R  A TNMNA+SSR+H ++ I F Q+       + K S +N+VDLAGSER  S+G+ GDRL+EG+ +N SL+ LGNVISALADL+ GKK   +PYRDSVLTKLLQ+ALGGNS+T +IAALSPADI Y+ETL TLRYA+RAK+++N+A++N  P   L R  + EN  L            +  +G  + E           F A+    ++         W   LE+AR+E      EE+ EA  + +     L HLLN+NEDPQL+G++  ++      + R +                                 N I L+GL IS++HA     +    T+ P  +  K  +NG  +T    L H DRI+ GS+  +L++   + +  ++L +  D+++ Q E A A+G     +  ++         IL       +++P++ E N +SEEL+K  T E+ +    + DS+ G   +  +M+KV        WIW + KF++R++LM+E+YQ+FLE +         DPFW+P   V +G+A+V+LQ LA  +  E+++  LN +G EE  + + I+P +  G    E++ V DP  LL +   F   ++    V+      + GI++ + I+    +  T+     KS      + + FA +  ++E LDY LT  +   ++  Q+      V +LD+L
Sbjct:   10 DSVRVAVRVRPFSQREKNSGSQCVISMHSGNISIRDPKNEERVKTFTFDLTYWSHDGFQKDEDGVLIPSDPASKFAGQSDVFHDIGRGILDSAWRGYNATLLAYGQTGSGKSYSMIGFGTNKGLIPRVCEELFQAIE-KQKENLEPQVMFSMLEIYNEQIRDLLSRTKAP-GGLRVREDQQLGFFVEGLKWVPCENYAQIEKLVEQGSKIRMTASTNMNASSSRSHMLIAIQFKQVFLDTA--LTKRSSINMVDLAGSERQRSSGSEGDRLREGSRVNLSLTSLGNVISALADLAMGKKVLHIPYRDSVLTKLLQSALGGNSRTTLIAALSPADICYEETLSTLRYAERAKKVRNRAVINTCP---LARASRAENALL------------LGFRGAGAAEHPAC-------FWAEQQLGNQ-------GTWAQLLEQARREW-----EEQYEALTQEQKMVRILPHLLNVNEDPQLTGVLKFFIHNGSCDVGRAAS--------------------------------NAICLQGLGISDKHASFVNLD-GKVTVAPH-SKCKVIVNGVPVTGRTKLQHLDRIILGSNSAFLYVGFPSERGAEDLSRF-DYDFFQLERAAAEGVSVATLGCVSPGDDQADPSILAVFQDYVKLMPLVVEANQMSEELKKGLTMELKVKNLASSDSR-GYDLQKEVMVKVTKQGTHEVWIWSKAKFINRKFLMEELYQRFLESRD-SHVAQEDDPFWDPLEVVHLGSAHVWLQPLAHCMMLEEQVEFLNCDGLEEAVLHIRITPCSPEGWAHGEEDMVIDPLELLGKRIDFQTHIVRCLGVKWLKEDGSRGIQMGYGIYDLPNTLYTKPV--WKSVNPRIEETVHFAALGASREFLDYLLTNALIVDLWGLQEGCAPLGVSQLDVL 847          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|Q9NGQ2|KIF1_DICDI (Kinesin-related protein 1 OS=Dictyostelium discoideum OX=44689 GN=kif1 PE=1 SV=1)

HSP 1 Score: 452.595 bits (1163), Expect = 1.305e-133
Identity = 254/506 (50.20%), Postives = 338/506 (66.80%), Query Frame = 3
Query:  126 VKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPE----------NSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEI---NSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQ--ITQSNGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSS--DEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARLEEAR--KEVAIISKEEKNEADK-RSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISR 1583
            V+VAVRVRPFN REK+R A+L + M   +TI+T P            + D+K F+FDYSYWS+D     SN        +  +ASQ +V+ DLGK VL+NA+ G+NCS+FAYGQTGSGKSYSM+GYG  KGI+P+IC+ELF++++    NS++   Y+ T S +EIYNE V+DLL+      GGL VR  P  G +V+ L K+ V S+ EI+  M++G+ +RTVA TNMNATSSR+H V  I F Q  I ++ G+ I + S ++LVDLAGSERA+STGATG RLKEGANINKSLS LG VISALA+ S  KK   VPYRDSVLT LL+  LGGNSKT+MIAA+SPADINY+E+L TLRYAD AK+IK  A+VNE+   KL+REL+ E ERL+  ++ G      + + ++S  DE      E +E++        E + AE  K W  +L EA   +E  + + ++   A K  S + HL+NLNEDP +S  +++Y+ E  T I R
Sbjct:    3 VQVAVRVRPFNSREKERNAELIVQMNNKSTILTRPSALRANPLAAPTADDEKSFSFDYSYWSYD-----SN--------DPHFASQSTVYNDLGKEVLKNAWDGFNCSIFAYGQTGSGKSYSMMGYGEEKGIIPLICEELFQRIQSTPSNSNEQTIYKTTVSYMEIYNEKVKDLLNPNNNKTGGLKVRNNPSTGPYVEDLSKLAVKSFSEIDMLMDEGSKARTVASTNMNATSSRSHAVFTIVFTQSKIDKTRGTAIDRVSKISLVDLAGSERANSTGATGVRLKEGANINKSLSTLGKVISALAENSTSKKAVFVPYRDSVLTYLLKETLGGNSKTIMIAAISPADINYEESLSTLRYADSAKKIKTVAVVNEDAQSKLIRELQGEVERLRAMMDQGGQYHANDSKLMNSDYDETVSTLNEKIEQY--------EKLMAELNKSWEEKLSEAEAIREDRMAALKDMGVAIKVVSSIPHLINLNEDPLMSESLIYYVKEGKTRIGR 487          

HSP 2 Score: 62.3882 bits (150), Expect = 2.496e-8
Identity = 66/265 (24.91%), Postives = 122/265 (46.04%), Query Frame = 3
Query: 2040 ILPMISEVNAISEELEKS-----KTFEIILVPPNAQDSKYGSA--KRTAIMIKVMDNKNGNFWIWERGKFMSRRYLMQEMYQQFLEDKSLKETISSKDPF-WEPTGEVLIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSISPSTSNGRVIDEDNFVDDPKSLLTRTYHFLIGIASVELHNAKYTIGIKVRFRIFKDEKSF-----------------ETETSKGSKSAVFNYNKVISFARITQEHLDYFLTGYITFRI 2759
            I+  ++E NAIS  L K      K + +   P    D+       ++T I+IK  D+  G   +     F+ R YLM+E+YQ    D  L +T   +DPF +  T + LIG ++V+L+   + ++    +PIL+  GN++G++++ +S S+++    +   ++++P    +     L+G       N + TIG +  F  F DE  F                 +T  ++    + F   K I    +T+  ++   T Y++F I
Sbjct:  716 IILSLNEANAISSTLNKKINLSLKLYSVFPEPDQISDNIEPEIDWRKTQILIKATDSSTGESTLVTDQDFVDRIYLMRELYQN---DGRL-DTELPEDPFQFTFTKDSLIGVSHVYLKNTLYLVESNRPVPILDENGNQKGYLNLLVSSSSTDITESERGLYLENP----SNNKSLLLG------KNLEITIGFE-GFSEFIDENKFSDVFIKFNFPNQNGTIVDTFLTEPQPISAFIDQKRIVITSLTESLINLLQTQYVSFEI 965          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|O43896|KIF1C_HUMAN (Kinesin-like protein KIF1C OS=Homo sapiens OX=9606 GN=KIF1C PE=1 SV=3)

HSP 1 Score: 432.95 bits (1112), Expect = 4.069e-132
Identity = 276/686 (40.23%), Postives = 378/686 (55.10%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTD-KKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGY--GANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQIT--QSNGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT-IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVS-------------------------ELRREIMEEFKAQMSAN--------SEIIAAEDPKIWNARL----------EEARKEVAIISKEEKNEADKRS--KLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHA----IIERKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKENKN---------LPKLIDWEYAQNEIAHADGF 1976
            M+  SVKVAVRVRPFN RE  + AK  + MQGNTT I NP+ S D  K FTFDYSYWSH    ED            ++ASQ+ V+ D+G+ +L +AF GYN  +FAYGQTG+GKSY+M+G      +GIVP +C++LF ++  N S  + Y V  S +EIY E VRDLL+ ++  +G L VR+ P  G +VQ L K+ V SY +I   M+ G  +RTVA TNMN TSSR+H V  I F Q    Q  G D  K S ++LVDLAGSERADS+GA G RLKEGANINKSL+ LG VISALAD+ + K+K+  +PYRDSVLT LL+  LGGNS+T MIAALSPADINY+ETL TLRYADR KQI+  AI+NE+P  +L+REL+ E  RL++ L +  L  +  ++GL ++E S                         EL        ++Q+           +E I AE  + W  +L          E    E+ +  +E+       S  K  HL+NLNEDP +S  +++++ + +T + +                                ++M+ I L G  I  +H     I +   E   T+ P   GA+T +NG  +T    L   +RI+ G +H++ F  PE  +  +            + +DW +AQ E+    G 
Sbjct:    1 MAGASVKVAVRVRPFNARETSQDAKCVVSMQGNTTSIINPKQSKDAPKSFTFDYSYWSHTS-TEDP-----------QFASQQQVYRDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGRQEPGQQGIVPQLCEDLFSRVSENQSAQLSYSVEVSYMEIYCERVRDLLNPKS--RGSLRVREHPILGPYVQDLSKLAVTSYADIADLMDCGNKARTVAATNMNETSSRSHAVFTIVFTQRCHDQLTGLDSEKVSKISLVDLAGSERADSSGARGMRLKEGANINKSLTTLGKVISALADMQSKKRKSDFIPYRDSVLTWLLKENLGGNSRTAMIAALSPADINYEETLSTLRYADRTKQIRCNAIINEDPNARLIRELQEEVARLRELLMAQGLSASA-LEGLKTEEGSVRGALPAVSSPPAPVSPSSPTTHNGELEPSFSPNTESQIGPEEAMERLQETEKIIAELNETWEEKLRKTEALRMEREALLAEMGVAVREDGGTVGVFSPKKTPHLVNLNEDPLMSECLLYHIKDGVTRVGQ--------------------------------VDMD-IKLTGQFIREQHCLFRSIPQPDGEVVVTLEPC-EGAETYVNGKLVTEPLVLKSGNRIVMGKNHVFRFNHPEQARLERERGVPPPPGPPSEPVDWNFAQKELLEQQGI 637          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|O35071|KIF1C_MOUSE (Kinesin-like protein KIF1C OS=Mus musculus OX=10090 GN=Kif1c PE=1 SV=2)

HSP 1 Score: 430.639 bits (1106), Expect = 2.493e-131
Identity = 276/686 (40.23%), Postives = 374/686 (54.52%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTD-KKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGY--GANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQIT--QSNGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT-IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVS-------------------------ELRREIMEEFKAQMSA--------NSEIIAAEDPKIWNARL----------EEARKEVAIISKEEKNEADKRS--KLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHA----IIERKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKENKN---------LPKLIDWEYAQNEIAHADGF 1976
            M+  SVKVAVRVRPFN RE  + AK  + MQGNTT I NP+ S D  K FTFDYSYWSH   VED            ++ASQ+ V+ D+G+ +L +AF GYN  +FAYGQTG+GKSY+M+G      +GIVP +C++LF ++ +N S  + Y V  S +EIY E VRDLL+ ++  +G L VR+ P  G +VQ L K+ V SY +I   M+ G  +RTVA TNMN TSSR+H V  I F Q +  Q  G D  K S ++LVDLAGSERADS+GA G RLKEGANINKSL+ LG VISALADL + K+K+  +PYRDSVLT LL+  LGGNS+T MIAALSPADINY+ETL TLRYADR KQI+  A++NE+P  +L+REL+ E  RL+  L +  L  +  + GL  +E S                         EL        + Q+           +E I AE  + W  +L          E    E+ +  +E+       S  K  HL+NLNEDP +S  +++++ + +T + ++                                    I L G  I  +H     I +   E   T+ P   GA+T +NG  +T    L   +RI+ G +H++ F  PE  +  +            + +DW +AQ E+    G 
Sbjct:    1 MAGASVKVAVRVRPFNARETSQDAKCVVSMQGNTTSIINPKQSKDAPKSFTFDYSYWSHTS-VEDP-----------QFASQQQVYRDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGRQEPGQQGIVPQLCEDLFSRVNVNQSAQLSYSVEVSYMEIYCERVRDLLNPKS--RGSLRVREHPILGPYVQDLSKLAVTSYADIADLMDCGNKARTVAATNMNETSSRSHAVFTIVFTQRSHDQLTGLDSEKVSKISLVDLAGSERADSSGARGMRLKEGANINKSLTTLGKVISALADLQSKKRKSDFIPYRDSVLTWLLKENLGGNSRTAMIAALSPADINYEETLSTLRYADRTKQIRCNAVINEDPNARLIRELQEEVARLRDLLMAQGLSASA-LGGLKVEEGSPGGVLPPASSPPAPASPSSPPPHNGELEPSFSPSAEPQIGPEEAMERLQETEKIIAELNETWEEKLRKTEALRMEREALLAEMGVAVREDGGTVGVFSPKKTPHLVNLNEDPLMSECLLYHIKDGVTRVGQVD---------------------------------VDIKLTGQFIREQHCLFRSIPQPDGEVMVTLEPC-EGAETYVNGKLVTEPLVLKSGNRIVMGKNHVFRFNHPEQARLERERGVPPPPGPPSEPVDWNFAQKELLEQQGI 637          
BLAST of Kinesin-like protein vs. TrEMBL
Match: R7U173 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_223727 PE=3 SV=1)

HSP 1 Score: 1023.08 bits (2644), Expect = 0.000e+0
Identity = 535/996 (53.71%), Postives = 705/996 (70.78%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQAL-NSGNLP----QTVNIQGLSSDEVSELRREIMEEFKAQMSANSEIIA---AEDPKIWNARLEEARKEVAIISKEEKNEADKRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKENKNLPKLIDWEYAQNEIAHADGFGTENVKGLTKDXXXXXXXILEILPMISEVNAISEELEKSKTFEIILVPPNAQDSKYGSAKRTAIMIKVMDNKNGNFWIWERGKFMSRRYLMQEMYQQFLE-DKSLKETISSKDPFWEPTGEVLIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSISPSTSNGRVIDEDNFVDDPKSLLTRTYHFLIGIASVELHNAKYTIGIKVRFRIFKDEKSFETETSKGSKSAVFNYNKVISFARITQEHLDYFLTGYITFRIFVNQDD----------SNKNVIRLDLLDANSTMKRPENRRISVIPLVDASEEIMKLKTDLTIIXXXXXXXXXXXXXXXXXCNDFNSNSNG--NYEAFHRATNAI 3035
            MS ESVKVAVRVRPFNQREKDR AKL I M G  T I NP++    K F FD+SYWSHDEF  D  G L P G N +Y+SQ+ VF DLG+ VL NAF GYN SLFAYGQTGSGKSYSMVGYG NKGIVP+ CDE+FK ++ N   + R+EVTFSMLEIYNE VRDLL+K+  PKGGL VRQ P  GF+VQ LKK+PVGSYKEIE RMEQGT+SRTVA T MNATSSRAHTVV ITFDQI + +  + +KSS+MNLVDLAGSERADSTGATGDRLKEGANINKSLS LGNVISALAD S+G KK +VPYRDSVLTKLLQNALGGNSKT+MIAALSPADINYDETL TLRYADRAK+IKNKA+VNENPV++L+RELK ENE+LKQ +   G +P    Q ++ +GLS++E+ ++R+E+ EE +AQ+ AN E++A    E P  W  +L  A  E    S  E    D+++K  HL NLNEDP L+G++ HY  +  T I R     + D                             ++L GLSI   HA+I  KN+  + +RP + GAKTK+NG  LT    LTHKDR+LFGS+HMY+F +P     + +LP  IDWE+AQ EIA A GF T    GLTKDQQ+ Q+Q+LEILPM+SEVNA+SEEL+K +TFE++LV   AQ+   G+ K T +M+K+ +  NGN W+WERGKFM+RR+L+Q++YQ++L+ D+ +++    +DPFWEPT +VLIG ANVFLQ+LA+ LDF+D++ I +Y+G EEG ISV ++P T  G+ +DED FVD+P  LL + YHF + I S E+  A+++ GI++++R++ +EK  ET+  KG+ S  FN++++ +F+ +T++HL +F    ITF ++  Q+D          S K + +++     ST     NRR +V  L   S E  +LK++L ++ +K +RLE+K+++++ +C ++   +    +++   R+ +A+
Sbjct:    1 MSGESVKVAVRVRPFNQREKDRGAKLIIGMNGKQTTIKNPDSKEGPKNFAFDFSYWSHDEFEADEEGILQPTGSN-KYSSQRLVFNDLGQGVLNNAFEGYNTSLFAYGQTGSGKSYSMVGYGPNKGIVPITCDEMFKTIQGNQEQNKRFEVTFSMLEIYNEQVRDLLNKD-NPKGGLQVRQNPKIGFYVQDLKKVPVGSYKEIERRMEQGTASRTVASTQMNATSSRAHTVVTITFDQIIKGDSGETKKSSVMNLVDLAGSERADSTGATGDRLKEGANINKSLSALGNVISALADQSSGNKKVLVPYRDSVLTKLLQNALGGNSKTIMIAALSPADINYDETLSTLRYADRAKKIKNKAVVNENPVDRLIRELKEENEKLKQMMTGGGQMPLEGSQAMSQEGLSAEEIDKMRKEMEEEIRAQLMANQEMLAGAEGEGPS-WEEKLAAANTE----SMTEAAVPDRKNKEAHLTNLNEDPLLAGVVFHYFKDGETTIGRKDADVKPD-----------------------------VILSGLSIMKNHAVI-TKNKAEYELRPGMPGAKTKVNGAPLTGPLTLTHKDRVLFGSNHMYVFCNPTKKDSSADLPDTIDWEFAQKEIAQAKGFDT-GAAGLTKDQQIAQEQVLEILPMVSEVNAVSEELDKHRTFEVVLVSAAAQEGALGTQKGTKVMVKMKNLLNGNTWLWERGKFMNRRFLVQDLYQRWLDGDEDVQKIKKEEDPFWEPTEDVLIGNANVFLQSLAYGLDFDDRLAITDYKGQEEGSISVHVAPCTQTGKPLDEDYFVDNPSELLGKPYHFKVSIRSAEIKKARFSKGIQIKYRVYTNEKITETKMIKGNLSPKFNHSEIFTFSSVTEDHLLFFDNQCITFSVYGVQEDSVADPKLNKMSTKELRQMEHFQTPST-----NRRGTVFSL--DSSETGQLKSELMLLQKKFDRLEQKEKRMQEICREWEKKAEAEKDFDGLLRSVSAV 951          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A7SL10 (Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g245960 PE=3 SV=1)

HSP 1 Score: 977.622 bits (2526), Expect = 0.000e+0
Identity = 526/1039 (50.63%), Postives = 719/1039 (69.20%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPEN-STDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQG-FFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQS-NGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEADKRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKENKNLPKLIDWEYAQNEIAHADGFGTENVKGLTKDXXXXXXXILEILPMISEVNAISEELEKSKTFEIILVPPNAQDSKYGSAKRTAIMIKVMDNKNGNFWIWERGKFMSRRYLMQEMYQQFLEDKSLKETISSKDPFWEPTGEVLIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSISPSTSNGRVIDEDNFVDDPKSLLTRTYHFLIGIASVELHNAKYTIGIKVRFRIFKDEKSFETETSKGSKSAVFNYNKVISFARITQEHLDYFLTGYITFRIFVNQDDSNKNVIRLDLLDANSTMKRPENRRISVIP----------LVDASEEIMKLKTDLTIIXXXXXXXXXXXXXXXXXCNDFNSNSNGNYEAFHRATNAILFYGDNQ-KFRTDGMIIGNMVSYSNSKTNGMNDTNIDGTVKLDSQNSNSCI 3185
            MS ESVKVAVRVRPFN REKDR +K+ +DM    T I +PEN +   K FTFD+SYWSHD F ED NG+L P+ P  +YA Q+ VF+DLG  VL NAF G+NCSLFAYGQTG+GKSYSMVGYG NKGIVP+ CDELFK+M  N+  +++Y+V+FSMLEIYNE VRDLL K   PKGGL VRQ P +G F+VQ LKK+ VGSY+EIE R E+GT++RTVA T MNATSSRAHTVV I FDQI ++ +G + +KSSI+NLVDLAGSERADSTGATGDRLKEGANINKSLS LGNVISALADLS GKKK +VPYRDSVLTKLLQNALGGNSKT+MIAALSPADINYDETLGTLRYADRAK+IKNKA+VNENP++KL+RELK ENERLK+++  G +P  ++  G+S +E+  +R+++ EE KAQ++ N+E + +     W+ +L+++R E +  S E +    K + + H++NLNEDP LSG++ H++ ++   I     + +                              +IV  GLSI  +HA+I  K+    TI+P  +GAKTK+NG  LT E PL H DRILFGS+HMY   +P+N ++N+  P  +DW++AQ EIA A GF T +  G TK+QQ+ Q+Q+LE+LP++SE+NA+SEEL+K KTFE++LV   AQ    G+   T +M+K+ +  N N W+W+RGKF++RR+LMQEMYQ+F++ + +      +DPFWEP  +VLIGTANVFLQ+LA+ LDF+DK+   +Y+G+EE  I V++SP T  G+ +DED FVD+PK LL + +H+ + I S ++H A++  G+ ++++   DE+  +T+T   + S  FN +KV S   I+++HL++F  G ITF ++  Q+DS  +  RL      S M   E R++  I           +V A   + +LK +  ++ R+LERL+ K+++L+ +C+DF   S+ +Y+ F+R   A  FY   Q K++ + +   N +   N K +  N   +   +    + S +CI
Sbjct:    1 MSGESVKVAVRVRPFNSREKDRGSKVCLDMIDALTQIRDPENPNAPPKEFTFDFSYWSHDGFREDENGYLHPEDP--KYADQRKVFDDLGAGVLRNAFEGFNCSLFAYGQTGAGKSYSMVGYGVNKGIVPITCDELFKQMATNTDATVKYQVSFSMLEIYNEQVRDLLCKN-NPKGGLQVRQNPKEGSFYVQNLKKVAVGSYEEIERRTEEGTANRTVAATQMNATSSRAHTVVTIAFDQIMKNESGQETKKSSIINLVDLAGSERADSTGATGDRLKEGANINKSLSALGNVISALADLSLGKKKVLVPYRDSVLTKLLQNALGGNSKTIMIAALSPADINYDETLGTLRYADRAKKIKNKAVVNENPMDKLIRELKEENERLKKSMEGG-IP--LSAAGMSPEEIERMRKQMEEEIKAQLAMNNESMMS-----WDDKLQQSRDEGS--SSEVQEMQQKLNSVPHIVNLNEDPLLSGVVKHFIEQEEVTIGNKKAEPQP-----------------------------SIVFSGLSIQKQHAVITIKDSE-ITIKPGTSGAKTKVNGLPLTGETPLKHMDRILFGSNHMYYLFNPKNKEKNEGSPDRVDWDFAQKEIAEAKGFSTGSGSGQTKEQQLAQEQVLELLPLVSEINAVSEELDKQKTFEVVLVSGAAQ-GNIGTG--TKVMVKMKNLLNENVWLWDRGKFLNRRFLMQEMYQKFMDSEDIN-VPKEEDPFWEPPEDVLIGTANVFLQSLAYALDFDDKLTATDYKGSEEASIFVNVSPCTQTGKSLDEDYFVDEPKDLLGKPFHYKVTIRSADIHKARFNKGVYIKYKCLGDEEFTQTDTKANTLSPEFNNSKVFSIPSISEKHLEWFENGCITFMVYGRQEDSIPDP-RL------SKMTTKELRQMDHIKGPQMGPRTGTIVGADVNVSQLKAETILMKRQLERLQNKEKRLQNICDDFEKKSDKDYDKFYREIRAAAFYKPGQLKYKVNQL---NAL-MKNQKGSTANGGQVKTELPKAQEGSRACI 981          
BLAST of Kinesin-like protein vs. TrEMBL
Match: K1QTK9 (Kinesin-related protein 1 OS=Crassostrea gigas OX=29159 GN=CGI_10022253 PE=3 SV=1)

HSP 1 Score: 969.533 bits (2505), Expect = 0.000e+0
Identity = 531/994 (53.42%), Postives = 701/994 (70.52%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDK-KVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQG-FFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQS-NGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNG-KKKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEADKRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKENKN-LPKLIDWEYAQNEIAHADGFGTENVKGLTKDXXXXXXXILEILPMISEVNAISEELEKSKTFEIILVPPNAQD-SKYGSAKRTAIMIKVMDNKNGNFWIWERGKFMSRRYLMQEMYQQFLEDKSLKETISSKDPFWEPTGEVLIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSISPSTSNGRVIDEDNFVDDPKSLLTRTYHFLIGIASVELHNAKYTIGIKVRFRIFKDEKSFE--TETSKGSKSAVFNYNKVISFARITQEHLDYFLTGYITFRIFVNQDDS--NKNVIRLDLLDANSTMKRPEN-------RRISVIPLVDASEEIMKLKTDLTIIXXXXXXXXXXXXXXXXXCNDFNSNSNG--NYEAFHRATNAI 3035
            M DESVKVAVRVRPFNQREKDR AKL I MQG  T I NPE   ++ K F+FDYSYWSHD F E S+G L P G  S YASQ+ VFEDLG+ VL+NAF GYNCSLFAYGQTGSGKSYSMVGYG NKGIVP+ CDE+FK M+ N+  + R+EVTFSMLEIYNE VRDLLSK+  PKGGL VRQ P  G F+V+ LK++PVGSY EIE R +QGT+SRTVA TNMNATSSRAHTVV ITFDQI +S +GS+ +KSS+MNLVDLAGSERADSTGATGDRLKEGANINKSLS LGNVISALADLS G KKK +VPYRDSVLTKLLQNALGGNSKT+MIAALSPADINYDETL TLRYADRAK+IKNKA+VNENP++KL+RELK ENERLK+A+  G +       GL+ +E+ ++R+++ E+ +AQ+ AN  +I AE+ + W+ +L EAR E   I     + + ++SK  +L+NLNEDP LSG+I H+L    T + R                                  +  I L GLSI  +HA+I  K         + +G+KTK+NG  LT    L HKDRILFGS+HMY+ ++P   +   N LPK I WEYAQ EIA   GF T +  GL+K+QQ+VQ+Q+LEILPM+SEVNA+SEEL K K+FE++L+   AQ+      +  + + +K+ +  NGN W+WERGKF++RRYL+QE+YQ+FL+ +++      +DPFWEPT +VLIGT+N+FLQ+L++ LDFED + I +Y+G EEG + V + P  + G+ IDE+ FVDDP  LL + YHF + + +  +H ++++ GI V++ +  + K  E  T T K + +  FN++KVIS  ++ QE+LD+F +G IT  I+  Q+D+  +  +++L+  +    M+  EN       RR ++     AS +   LKT++ ++ RK ERL++K+R+++ +C +++   +G   +E F+RA +A+
Sbjct:    1 MPDESVKVAVRVRPFNQREKDRSAKLIIKMQGQMTTIANPETPNEEPKSFSFDYSYWSHDGFQEKSDGVLEPAG-GSSYASQRRVFEDLGQGVLDNAFEGYNCSLFAYGQTGSGKSYSMVGYGQNKGIVPITCDEMFKTMDKNADPNKRFEVTFSMLEIYNEQVRDLLSKD-NPKGGLNVRQNPKLGLFYVENLKRVPVGSYAEIEKRTDQGTASRTVASTNMNATSSRAHTVVTITFDQIIKSESGSETKKSSVMNLVDLAGSERADSTGATGDRLKEGANINKSLSALGNVISALADLSMGTKKKIMVPYRDSVLTKLLQNALGGNSKTIMIAALSPADINYDETLSTLRYADRAKKIKNKAVVNENPLDKLIRELKEENERLKKAMEGGGVVMQEGA-GLTPEELDKMRKQMEEDIRAQLMANQAMI-AENAQSWDDKLAEARTETEKIDVGGADNS-RKSKEAYLINLNEDPMLSGVICHFLNSGETSVGRKDAS-----------------------------PVPNICLSGLSIQKQHAVIFNKKGVIEIESVSGSGSKTKINGIPLTGRKALCHKDRILFGSNHMYVLMNPLKPETADNSLPKEITWEYAQKEIAQVKGFATGSA-GLSKEQQIVQEQVLEILPMVSEVNAVSEELNKQKSFEVVLISAAAQEGGDITQSHASKVTVKMKNLLNGNTWLWERGKFITRRYLIQELYQKFLDGENISNIPKEQDPFWEPTEDVLIGTSNLFLQSLSYCLDFEDTLNISDYKGQEEGHLKVKLEPCDNKGKPIDEEAFVDDPHELLNKPYHFKLTVENANIHKSRFSKGIMVKYSVKNNGKVEEVKTPTVKNTLTPTFNHSKVISIPKLKQENLDFFESGCITLSIYGIQEDTMPDPKLLKLNTRELRQ-MENMENSTANASGRRATMFGNEIAS-DTSHLKTEVVLLQRKYERLQQKERRMQQICEEWSKKPDGEKQFEPFYRAVSAV 957          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A210QN17 (Kinesin-like protein KLP6 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT14092 PE=3 SV=1)

HSP 1 Score: 959.133 bits (2478), Expect = 0.000e+0
Identity = 517/1008 (51.29%), Postives = 697/1008 (69.15%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDK-KVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQG-FFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSN-GSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNG-KKKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPK-IWNARLEEARKEVAIISKEEKNEADKRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKNEHSFTIRPALAGA-KTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENV-KENKNLPKLIDWEYAQNEIAHADGFGTENVKGLTKDXXXXXXXILEILPMISEVNAISEELEKSKTFEIILVPPNAQDS------------KYGSAKRTAIMIKVMDNKNGNFWIWERGKFMSRRYLMQEMYQQFLEDKSLKETISSKDPFWEPTGEVLIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSISPSTSNGRVIDEDNFVDDPKSLLTRTYHFLIGIASVELHNAKYTIGIKVRFRIF----KDEKSFETETSKGSKSAVFNYNKVISFARITQEHLDYFLTGYITFRIFVNQDDS----NKNVIRLDLLDANSTMKRPENRRISVIPLV--DASEEIMKLKTDLTIIXXXXXXXXXXXXXXXXXCNDFNSNSNG--NYEAFHRATNAILF 3041
            M +E VKVAVRVRPFNQREKDR A L I M G  T I NPE   ++ K F+FDYSYWSHD  VE + G L    P S YASQ+ VFEDLG+ VL+NAF GYNCSLFAYGQTGSGKSYSMVGYGAN+GIVP+ CDELFK M  N+  + R+EVTFSMLEIYNE VRDLLS+E  PKGGL VRQ P  G F+V+GLKK+PVGSY EIE RM+QGT+SRTVA TNMNATSSRAHTVV ITFDQI +S  GS+ +KSS+MNLVDLAGSERADSTGATGDRLKEGANINKSLS LGNVISALADLS G KKK +VPYRDSVLTKLLQNALGGNSKT+MIAALSPADINYDETL TLRYADRAK+IKNKA++NENP++K++RELK EN+RLK+A+ SG + +     G+S +E++ +++E+ EE ++Q+ AN  ++   D K  W+A+L  A+ E   + K   ++  +RS+  +L+NLNEDP LSG+I H+L  + T + R   +                              +  + L GLSI   HA+I  KN  +  I+PA   A KTK+NG  L     L+HKDRILFGS+HMY+ ++P+     +KNLP +IDWE+AQ EIA   GF T ++ GLTKDQ + Q+Q+LE+LPM+SEVNA+SEEL+K KTFE++L+   AQ+                S+  T +M+K+ +  N N W+W+RGKF++RRYL+Q++YQ+FL+   L +    +DPFWEP  EVLIGTAN FLQ+L++ LDFED++ I +Y+G EEG + V+++P  + G+  D++ FV++P  LL + ++F + +   E++ ++++ G++V+F +     K+ ++ +T   K S S  FN++KV+S  ++ ++HLD+F  G +TF ++  Q+D+    N + +    L   + MK   +  +    L   D + +   LK ++ ++ RK ERL +K+R+++ +C ++         +E F+RA +A  F
Sbjct:    1 MPEEGVKVAVRVRPFNQREKDRKANLMIKMSGQMTSIANPETPNEEPKKFSFDYSYWSHDGMVETAEGVLQAT-PGSSYASQREVFEDLGQGVLDNAFEGYNCSLFAYGQTGSGKSYSMVGYGANRGIVPITCDELFKTMATNADANKRFEVTFSMLEIYNEQVRDLLSRE-NPKGGLQVRQNPKLGYFYVEGLKKVPVGSYAEIEKRMDQGTASRTVASTNMNATSSRAHTVVSITFDQIIKSEVGSETKKSSVMNLVDLAGSERADSTGATGDRLKEGANINKSLSALGNVISALADLSTGSKKKIVVPYRDSVLTKLLQNALGGNSKTIMIAALSPADINYDETLSTLRYADRAKKIKNKAVINENPMDKIIRELKEENDRLKKAMESGGMIE--GSAGMSPEELTRMKKEMEEEIRSQLMANQAMLMENDSKEDWDAKLRAAQSETDEL-KGAVSQNKRRSQEPYLINLNEDPMLSGVICHFLDTEKTTVGRKDAQ-----------------------------PLPDVCLSGLSIQKLHAVITNKN-GNIEIKPAPGSASKTKVNGLPLNDTKVLSHKDRILFGSNHMYVIMNPKRTDTADKNLPNVIDWEFAQKEIAEIKGFATHSL-GLTKDQLIAQEQVLELLPMVSEVNAVSEELDKRKTFEVVLISAAAQEGVASVTAAGQEGVDVNSSNGTRVMVKMTNLLNSNTWLWQRGKFLNRRYLIQDLYQRFLDGDDLSKVSKEEDPFWEPPEEVLIGTANAFLQSLSYALDFEDQLMITDYKGQEEGTLDVTVAPCDAKGKTSDDETFVENPNELLNKPFYFKVFVRKAEINKSRFSKGVRVQFSMPFSNKKEPENVQTPIIKNSLSPEFNFSKVLSVNKVQKKHLDFFELGSLTFYVYGLQEDTLPEPNLSKLTTKELRQRNNMKENADTGVRRKTLFGNDIASDQSHLKAEVVLLQRKHERLVQKERRIQEICKEWEKKQEAERQFEPFYRAVSAAAF 972          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A3Q0JQB0 (kinesin-like protein KIF28P isoform X4 OS=Ciona intestinalis OX=7719 GN=LOC100182352 PE=3 SV=1)

HSP 1 Score: 944.495 bits (2440), Expect = 0.000e+0
Identity = 517/994 (52.01%), Postives = 690/994 (69.42%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENST-DKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQG-FFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSN-GSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEADKRSKLHHLLNLNEDPQLSGIIVHYLTE-KLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKENKNLPKLIDWEYAQNEIAHADGFGTENVKGLTKDXXXXXXXILEILPMISEVNAISEELEKSKTFEIILVPPNAQDSKYGSAKRTAIMIKVMDNKNGNFWIWERGKFMSRRYLMQEMYQQFLE-DKSLKETISSKDPFWEPTGEVLIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSISPSTSNGRVIDEDNFVDDPKSLLTRTYHFLIGIASVELHNAKYTIGIKVRFRIFKDEKSFETETSKGSKSAVFNYNKVISFARITQEHLDYFLTGYITFRIFVNQDD-----SNKNVIRLDLLDANSTMKRPENRRISVIPLVDASEEIMKLKTDLTIIXXXXXXXXXXXXXXXXXCNDFNSNS--NGNYEAFHRATNAILFYGDNQ 3056
            MS ESVKVAVRVRPFNQREKDR AK  I+M+G TT I NPE    D K+F FDYSYWSHD F  D +G L+    N +YA+Q+ VF++LG+ VL+NAF GYNCSLFAYGQTGSGKS+SMVGYG N+GIVP+ CDELF+ +   SSD  ++EVTFSMLEIYNE VRDLL+K+  PKGGL VRQ P  G F+V+ LKK+ VGSY EIE RME+GT++RTVA T MNATSSRAHTVV ITFDQI ++  G + +KSS +NLVDLAGSERADSTGATGDRLKEGANIN+SLS LGNVISALADLS GKKK +VPYRDSVLTKLL +ALGGNSKT+MIAALSPADINYDETL TLRYADRAK+IKNKA+VNENP++KL+REL+ ENERLK+A   G LP      G+S +E+ E+RR++ EE +AQ+  N E +   D   W+A+L E+RKE A +S   K+    +  + H +NLNEDP LSG+I H L E K TLI R   +                                 I+L GLSI  +HA I   NE    I+PA  GA+ K+NG  LT E  L H DR+L GS+H+Y+FI+P      +  P+ IDW++AQ E+A   GF T+N  G++KDQQ  Q+Q+LE+LPM+SEVNA+SEEL K + FE++L+    Q+ K    K T +M++V +  N N W+WERGKFM+RRY++QE+YQQ+++ D S K     KDPF++P  +V++GTANVFLQ+L++ LDF+DK+ I +Y+G EEG ++V+++P   NGR +DE++F++DP  LL + YHF I I + E++N++Y+ G+ VR +   D+   +T+  + + S  FNY+++I+   + QEHLDYF +  ITF +   Q D     S K +   +L + +  M  P  RR + +   + + +  +LK+++  + RK +RLE+K+++++ LC  ++  S    ++E F  +  A+ F   N+
Sbjct:    1 MSGESVKVAVRVRPFNQREKDRGAKCVIEMKGPTTYIQNPETPNEDPKMFGFDYSYWSHDGFA-DEDGVLV--AKNDKYATQRKVFDNLGQGVLDNAFEGYNCSLFAYGQTGSGKSFSMVGYGKNRGIVPITCDELFQAIN-KSSDGTKFEVTFSMLEIYNEQVRDLLTKD-NPKGGLNVRQNPKLGLFYVEKLKKVAVGSYNEIERRMEEGTANRTVASTQMNATSSRAHTVVTITFDQIMKNEAGQETKKSSSINLVDLAGSERADSTGATGDRLKEGANINRSLSALGNVISALADLSLGKKKIVVPYRDSVLTKLLMSALGGNSKTIMIAALSPADINYDETLSTLRYADRAKKIKNKAVVNENPIDKLIRELREENERLKKAA-GGVLPMQSQA-GMSPEEIEEMRRKMQEEIRAQLLENQEQMKDLD---WDAKLAESRKEDAQLS---KDHGPAKMTVPHFVNLNEDPMLSGVIKHPLVEGKETLIGRKDAEITPH-----------------------------IILTGLSIQKQHASIMFDNEE-IVIKPASNGARIKVNGAPLTGERKLEHHDRVLLGSNHLYVFINPLKPDLPEGTPESIDWDFAQKELAEQSGFSTQN-SGMSKDQQRAQEQVLELLPMVSEVNAVSEELNKYRHFELVLISGGYQEDK---DKGTKVMVQVKNLLNNNIWMWERGKFMNRRYIIQELYQQYIDGDDSYKNIEQDKDPFFDPPEDVMLGTANVFLQSLSYALDFDDKLAITDYKGQEEGMLTVAVTPCLPNGRSLDEESFIEDPSDLLGKPYHFKITIRNCEINNSRYSKGVYVRHKTLGDKDPIKTKVVEDTLSPEFNYSRIITIPSVNQEHLDYFESQSITFFVHGCQVDTPPVASVKKLTTKELREMDGQMTAPMLRRRNTLVASNMAVD-SQLKSEIHTLQRKYDRLEKKEKRIQELCRQWSDKSPEEQDFEKFMNSIKAVAFSSGNK 946          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kif1b (kinesin family member 1B [Source:NCBI gene;Acc:103027085])

HSP 1 Score: 444.891 bits (1143), Expect = 7.199e-137
Identity = 283/677 (41.80%), Postives = 375/677 (55.39%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDK-KVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYG--ANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDI--RKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT-IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQAL--------------------NSGNLPQTVNIQGLSSDEVSELRREIME----EFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEAD---------------KRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAII--ERK-NEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVK-ENKNLP------KLIDWEYAQNEIAHADGF 1976
            MS  SVKVAVRVRPFN RE  + +K  I MQGN+T I NP+   +  K F+FDYSYWSH            PD P   +ASQ  V+ D+GK +L++AF GYN  +FAYGQTG+GKSY+M+G      +GI+P +C++LF+K+  N +D + Y V  + +EIY E VRDLL+   + KG L VR+ P  G +V+ L K+ V SY +I   M+ G  +RTVA TNMN TSSR+H V  I F Q      +D+   K S ++LVDLAGSERADSTGA G RLKEGANINKSL+ LG VISALA++S  KKK+  +PYRDSVLT LL+  LGGNS+T M+AALSPADINYDETL TLRYADRAKQIK  A++NE+P  KL+RELK E  RLK  L                    +SG+L     +Q +SS     ++  IM     E   +    SE I AE  + W  +L   RK  AI  + E   A+                  K  HL+NLNEDP +S  +++Y+ + +T + +   +                                 IVL G  I   H I   ER  N     +     G++T +NG  + +   L   +RI+ G +H++ F  PE  + E +  P      + +DW +AQ E+    G 
Sbjct:    1 MSGASVKVAVRVRPFNSREISKESKCIIQMQGNSTTILNPKAPKESPKSFSFDYSYWSHTS----------PDDPT--FASQNRVYNDIGKEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEEGQEGIIPQLCEDLFEKINDNINDEISYSVEVAYMEIYCERVRDLLN--PKNKGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQRKHDTETDLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVSKKKKKSDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIKCNAVINEDPNAKLVRELKDEVLRLKDLLRAQGLGDILDTPMGCLTASPSSGSLCSQAGLQSVSS-----IQERIMSTPGGEEAIERLKESEKIIAELNETWEEKL---RKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAERR-----------------------------QDIVLSGAHIKEEHCIFRSERNANGDVIVMLVPCEGSETYVNGKRVMAAVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPTAETPVEPVDWTFAQRELLEKQGI 626          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kif1b (kinesin family member 1B [Source:NCBI gene;Acc:103027085])

HSP 1 Score: 443.736 bits (1140), Expect = 6.175e-133
Identity = 280/670 (41.79%), Postives = 375/670 (55.97%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDK-KVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYG--ANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDI--RKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT-IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQAL--------------------NSGNLPQTVNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARL----------EEARKEVAIISKEEKNEADKRS--KLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAII--ER-KNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVK-ENKNLP------KLIDWEYAQNEIAHADGF 1976
            MS  SVKVAVRVRPFN RE  + +K  I MQGN+T I NP+   +  K F+FDYSYWSH            PD P   +ASQ  V+ D+GK +L++AF GYN  +FAYGQTG+GKSY+M+G      +GI+P +C++LF+K+  N +D + Y V  + +EIY E VRDLL+   + KG L VR+ P  G +V+ L K+ V SY +I   M+ G  +RTVA TNMN TSSR+H V  I F Q      +D+   K S ++LVDLAGSERADSTGA G RLKEGANINKSL+ LG VISALA++S  KKK+  +PYRDSVLT LL+  LGGNS+T M+AALSPADINYDETL TLRYADRAKQIK  A++NE+P  KL+RELK E  RLK  L                    +SG+L     +Q +SS +   +     EE   ++   SE I AE  + W  +L          E    E+ +  +E+       S  K  HL+NLNEDP +S  +++Y+ + +T + +   +                                 IVL G  I   H I   ER  N     +     G++T +NG  + +   L   +RI+ G +H++ F  PE  + E +  P      + +DW +AQ E+    G 
Sbjct:    1 MSGASVKVAVRVRPFNSREISKESKCIIQMQGNSTTILNPKAPKESPKSFSFDYSYWSHTS----------PDDPT--FASQNRVYNDIGKEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEEGQEGIIPQLCEDLFEKINDNINDEISYSVEVAYMEIYCERVRDLLN--PKNKGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQRKHDTETDLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVSKKKKKSDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIKCNAVINEDPNAKLVRELKDEVLRLKDLLRAQGLGDILDTPMGCLTASPSSGSLCSQAGLQSVSSIQERIMSTPGGEEAIERLK-ESEKIIAELNETWEEKLRKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAE-----------------------------RRQDIVLSGAHIKEEHCIFRSERNANGDVIVMLVPCEGSETYVNGKRVMAAVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPTAETPVEPVDWTFAQRELLEKQGI 626          

HSP 2 Score: 51.6026 bits (122), Expect = 5.360e-6
Identity = 41/159 (25.79%), Postives = 69/159 (43.40%), Query Frame = 3
Query: 2052 ISEVNAISEELEKSKTFEIILVPPNAQDSKYGSAK------------------RTAIMIKVMDNKNGNFWIWERGKFMSRRYLMQEMYQQFLEDKSLKE-----TISSKDPFWEPTGEV-LIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSI 2456
            + E NAIS EL+K   F+ +L+     D+ Y                      RT + ++V D KNG    W   K   R   M+EMY +  E  S  +      ++  DPF++      L+G A V+L  L +++    ++ ++  +G   GF+ V +
Sbjct:  730 LKEANAISVELKKKVQFQFVLL----TDTLYSPLPPELLPPEPEKERDSRPFPRTVVAVEVQDLKNGATHYWSLEKLKQRLEQMREMYDRAGEMASSNQEDGEGPLTGSDPFYDRFHWFKLVGRAFVYLSNLLYSVPLVHRVAVVTEKGEVRGFLRVGV 884          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kif1aa (kinesin family member 1Aa [Source:ZFIN;Acc:ZDB-GENE-100913-3])

HSP 1 Score: 430.254 bits (1105), Expect = 3.414e-128
Identity = 272/681 (39.94%), Postives = 373/681 (54.77%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGA--NKGIVPVICDELFKKM-EINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSD--IRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKK--------KTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSD-------------------EVSELRREIM-----EEFKAQMSANSEIIAAEDPKIWNARLEEAR----------KEVAIISKEEKNEADKRS--KLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIER---KNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKENKNLPKL-------IDWEYAQNEIAHADGF 1976
            M+  SVKVAVRVRPFN RE  + +K  I M GNTT I NP+   + K F FDYSYWSH    ED N           YASQ+ V+ D+G+ +L +AF GYN  +FAYGQTG+GKSY+M+G      +GI+P++C++LF K+ + N+ +SM Y V  S +EIY E VRDLL+ +   KG L VR+ P  G +V+ L K+ V SY +I+  M+ G  +RTVA TNMN TSSR+H V  I F Q    + +D    K S ++LVDLAGSERADSTGA G RLKEGANINKSL+ LG VISALA++ +G          ++ +PYRDSVLT LL+  LGGNS+T M+AALSPADINYDETL TLRYADRAKQI+  A++NE+P  +L+RELK E  RLK  L +  L   +  + + ++                    +S L   IM     EE   ++    +II AE  + W  +L               E+ +  +E+       S  K  HL+NLNEDP +S  +++Y+ + +T + R                              + +    IVL G  I + H         N  +  + P   GA+T +NG  +T    L   +RI+ G  H++ F  PE  ++ ++           +DW +AQ E+    G 
Sbjct:    1 MAGASVKVAVRVRPFNSREMSKESKCIIQMSGNTTTILNPKVPKETKSFNFDYSYWSHTS-PEDIN-----------YASQQLVYRDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGRQEKDQQGIIPLLCEDLFTKINDSNNDNSMSYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQRRHDSETDNTSEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVDSGANKNKKKKKVESFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDPNNRLVRELKDEVSRLKDLLYAQGLGDIIESKAVLTNAMTGMSPSPSLSALSSRAGSISSLHDRIMFSPGSEEAIERLKETEKII-AELNETWEEKLRRTEAIRMERSALLAEMGVAMREDGGTVGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGR-----------------------------EDAMRRQDIVLSGHFIKDEHCTFTSTTGPNGEAVILEPC-EGAETYVNGKKVTEPTVLRSGNRIILGKSHVFRFNHPEQARQARDRTPCAETPVEPVDWAFAQRELLEKQGI 636          

HSP 2 Score: 64.6994 bits (156), Expect = 5.355e-10
Identity = 45/156 (28.85%), Postives = 75/156 (48.08%), Query Frame = 3
Query: 2049 MISEVNAISEELEKSKTFEIILV--------PPN------AQDSKYGSAKRTAIMIKVMDNKNGNFWIWERGKFMSRRYLMQEMYQQFLEDKS-----LKETISSKDPFWEPTGEV-LIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSI 2456
             + E NAIS EL+K   F+ +L+        PP+      A+D +     RT + ++V D KNG    W   K   R  LM+EMY +  E  S         ++  DPF++      L+G A V+L  L + +    ++ I++ +G  +GF+ V++
Sbjct:  735 FLKEANAISVELKKKVQFQFVLLTDTLYSPLPPDLLPAEAAKDREKSPFPRTIVAVEVQDQKNGATHYWTLEKLRQRLDLMREMYDRAAEIPSTAIEDCDSVLTGGDPFYDRFPWFRLVGRAFVYLSNLLYPVPLVHRVAIVSEKGEVKGFLRVAV 890          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kif1ab (kinesin family member 1Ab [Source:ZFIN;Acc:ZDB-GENE-070912-480])

HSP 1 Score: 429.869 bits (1104), Expect = 4.315e-128
Identity = 274/679 (40.35%), Postives = 374/679 (55.08%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGA--NKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSD--IRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSN--------GKKKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNS---GNLPQTVN-IQGLS--------------SDEVSELRREIM-----EEFKAQMSANSEIIAAEDPKIWNARL----------EEARKEVAIISKEEKNEADKRS--KLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKN----EHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKENKNLPKL-------IDWEYAQNEIAHADG 1973
            M+  SVKVAVRVRPFN RE  + +K  I M GNTT I NP+   + K F FDYSYWSH    ED N           +A QK V++D+G+ +L +AF GYN  +FAYGQTG+GKSY+M+G      +GI+P++C++LF K+  N+ ++M Y V  S +EIY E VRDLL+   + KG L VR+ P  G +V+ L K+ V SY +I+  M+ G  +RTVA TNMN TSSR+H V  I F Q    + +D  + K S ++LVDLAGSERADSTGA G RLKEGANINKSL+ LG VISALA++ +         K ++ +PYRDSVLT LL+  LGGNS+T M+AALSPADINYDETL TLRYADRAKQI+  A++NE+P  +L+RELK E  RLK  L +   G++ +  N + G+S              +  +S L   IM     EE   ++    +II AE  + W  +L          E    E+ +  +E+       S  K  HL+NLNEDP +S  +++Y+ + +T + R                                     IVL G  I   H +         E    + P    A+T +NG  +T    L   +RI+ G  H++ F DPE  ++ +            +DW +AQ E+    G
Sbjct:    1 MAGASVKVAVRVRPFNSREIGKESKCIIQMSGNTTTILNPKQPKENKSFNFDYSYWSHTS-PEDIN-----------FACQKQVYKDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPLLCEDLFTKINDNNDNNMSYSVEVSYMEIYCERVRDLLN--PKNKGNLRVREHPLMGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKRHDSDTDNTLEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVDSLPNKNKKKKKAESFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDPNNRLVRELKEEVARLKDLLYAQGLGDIIEMTNAMTGMSPSPSLSALSALSSRAGSISSLHDRIMFSPGSEEAIERLKETEKII-AELNETWEEKLRRTEAIRMEREALLAEMGVAMREDGGTVGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITKVGREDASCR-----------------------------QDIVLSGHFIEEEHCLFTSSTGASGEGVVVLEPC-KDAETYVNGKRVTEPTVLRSGNRIIMGKSHVFRFNDPEQARQERERTPCAETPVEPVDWAFAQRELLEKQG 634          

HSP 2 Score: 60.077 bits (144), Expect = 1.610e-8
Identity = 44/167 (26.35%), Postives = 76/167 (45.51%), Query Frame = 3
Query: 2049 MISEVNAISEELEKSKTFEIILVPPN--------------AQDSKYGSAKRTAIMIKVMDNKNGNFWIWERGKFMSRRYLMQEMYQQFLEDKS-----LKETISSKDPFWEPTGEV-LIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSISPSTSNGRVID 2489
             + E NAIS EL+K   F+ +L+                 A+D +     RT + ++V D KNG    W   K   R  LM+EMY +  E  S         ++  DPF++      L+G A V+L  L + +    ++ I++ +G  +GF+ V++   +++    D
Sbjct:  735 FLKEANAISVELKKKVQFQFVLLTDTLYSPLPPDLLPPSIAKDREKRPFPRTIVAVEVQDQKNGATHYWTLEKLRQRLDLMREMYDRAAEVPSSAMEDCDHALTGGDPFYDRFPWFRLVGRAFVYLSNLLYPVPLVHRVAIVSEKGEVKGFLRVAVQAISADEEAPD 901          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: KIF1C (kinesin-like protein KIF1C [Source:NCBI gene;Acc:103042456])

HSP 1 Score: 421.394 bits (1082), Expect = 1.182e-127
Identity = 280/694 (40.35%), Postives = 370/694 (53.31%), Query Frame = 3
Query:  123 SVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDK-KVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGA--NKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQIT--QSNGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT--IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLK-----QALN-------------------------SGNLPQTVNI--------------QGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARLEEARK----------EVAIISKEEKNEADKRSK--LHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKNEHS----FTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVK---------ENKNLPKLIDWEYAQNEIAHADGF 1976
            SVKVAVRVRPFN RE  R AK  I MQG TT ITNP+   +  K FTFDYSYWSH             D PN  +A Q+ V+ D+G+ +L +AF GYN  +FAYGQTG+GKSY+M+G      +GI+P +C++LFK+   N+   + Y V  S +EIY E VRDLL+ ++   G L VR+ P  G +V+ L K+ V +Y +I   M+ G  +RTVA TNMN TSSR+H V  I F Q    Q    D  K S ++LVDLAGSERADS+GA G RLKEGANINKSL+ LG VISALAD+ + KKK    +PYRDSVLT LL+  LGGNS+T MIAALSPADINY+ETL TLRYADRAKQI+  AI+NE+P  +L+RELK E  RL+     Q L+                         +G  P T  +               GL+  E  ++   I +E   +    +E I AE  + W  +L +             E+ +  KE+       S     HL+NLNEDP +S  +++Y+ E +T   R+  K+                                I L G  I  +H +      H+     T+ P L GA+T +NG  +T    L   +RI+ G +H++ F  PE  +         E +  P  +DW YAQ E+    G 
Sbjct:    4 SVKVAVRVRPFNNRESSRDAKCVIQMQGKTTCITNPKQPKESAKNFTFDYSYWSH----------TTEDDPN--FACQRRVYLDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEPDQQGIIPQMCEDLFKRTSENTDPDLSYSVEVSYMEIYCERVRDLLNPKS--GGNLRVREHPIMGPYVEDLSKLAVTTYSDITHLMDCGNKARTVAATNMNETSSRSHAVFTIIFTQRRRDQLTSLDTEKVSKISLVDLAGSERADSSGAKGMRLKEGANINKSLTTLGKVISALADMQSSKKKKSEFIPYRDSVLTWLLKENLGGNSRTAMIAALSPADINYEETLSTLRYADRAKQIRCNAIINEDPNARLIRELKEEVNRLREILLTQGLSQLITAAGPEVNNNRVCPALPADPTPNGGPPSTTIVPEHSPAQDGDPTPDDGLNQSEFPKV--VISKEEAVERLRETEKIIAELNETWEEKLRKTESIRLERETLLAEMGVSIKEDGGTVGVFSPKGTPHLVNLNEDPLMSECLLYYIKEGVT---RVGQKDVD------------------------------IRLSGQFIKEQHCVFYCNTNHNGEVVVTLEP-LEGAETYVNGIEITEPMALKQGNRIVMGKNHVFRFNHPEQARLERERSSSMEQQGEP--VDWSYAQKELLENQGI 645          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009202.1 (pep scaffold:Pmarinus_7.0:GL476573:157904:241529:1 gene:ENSPMAG00000008319.1 transcript:ENSPMAT00000009202.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 632.098 bits (1629), Expect = 0.000e+0
Identity = 374/894 (41.83%), Postives = 522/894 (58.39%), Query Frame = 3
Query:  120 ESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENS-TDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEI---NSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSD-IRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNG-KKKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEADKRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPE--NVKENKNLPKLIDWEYAQNEIAHADGFGTENVKGLTKDXXXXXXXILEILPMISEVNAISEELEKSKTFEIILVPPNAQDSKYGSAKRTAIMIKVMDNKNGNFWIWERGKFMSRRYLMQEMYQQFLEDKSLKETISSKDPFWE-PTGEVLIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSISPSTSNGRVIDEDNFVDDPKSLLTRTYHFLIGIASVELHNAKYTIGIKVRFRIFKDEKSFETETSK-GSKSAVFNYNKVISFARITQEHLDYFLTGYITFRIFVNQ 2771
            E++KVAVRVRPFN+REK R A + I M+GNTT I  P +   D K FTFDYSYWSHD FV   NG+L P+  N ++A QK VF DLG+ +LENA+ GYNCSLFAYGQTGSGK+YS+VG  ANKGI+P+ C+ LF+ +E    ++++   ++V+ SM+EIYNE VRDLL+ ++  +GGL +R+    GFFV+ L  +PVGSY +I+SR+++GT +RT+A T+MNATSSRAHT+V ITF Q   S+G   ++KSS +N+VDLAGSERA +TGA  +RLKEG  IN+SLS LGNVI ALAD   G +K T++P+RDSVLTKLL+NALGGNSKT+MIAALSPAD+NY+ETL TLR+ DRAK I+ +A+VNE+P  +L+REL+ EN RL++ L+  +     N          E  R  ME     MS             W  RL   R       KEEK   +KR  + HL NLNEDP L+G++ H++ E    I   +GK E                               I+L G+ +   HA +  K+     I      A+  +NG  LT    L H DR+L G+  +Y+  DP+  +V    +  + + ++ AQ EIA   G     V G + D  ++ + +L +LP + E N I EEL K   FE++L    A +     A  T + +K+    +G  ++    +F+ RR+LMQEMYQ++L+     +    KDPFWE P   V +G   V LQ L+  L   +  P+L+  G ++G + V I P  S+G    +   V DP  L+ +  H LI I         +T     RF++F ++   E ET++  S +  +N+ K   F  +T+E LDY     +T  +   Q
Sbjct:    5 ENIKVAVRVRPFNEREKTRGASIIISMEGNTTRIIKPRSGDADVKTFTFDYSYWSHDGFVALDNGYLAPE--NEQFADQKRVFSDLGEGILENAWNGYNCSLFAYGQTGSGKTYSVVGGSANKGILPLFCERLFEDIERKQESAAEGTEFQVSLSMVEIYNEQVRDLLNPQSGRQGGLRIREKVDHGFFVENLLTVPVGSYGDIDSRIQEGTRNRTIAATHMNATSSRAHTIVAITFVQKAMSDGGHTLQKSSTINIVDLAGSERAGNTGAARERLKEGCMINQSLSTLGNVIKALADQGKGVQKSTVLPFRDSVLTKLLKNALGGNSKTIMIAALSPADVNYEETLSTLRFVDRAKAIRVQAVVNESPTSRLVRELQQENMRLQELLSQASYGALSNHSWNPCASSWEQNRREMEHMA--MS-------------WEQRLASERLAHQQKLKEEKELREKRKTIPHLWNLNEDPALNGLLCHFIPEGSLSIG--NGKSENPAG---------------------------IILHGVGVLPHHASVNNKD--GVIILAPSPEARVLINGCPLTQPALLNHNDRLLLGASQLYVLYDPKAVSVDSGGDHKQTVTFDKAQEEIACNSGL-CMAVGGNSSDDALIWEDLLSLLPALWEGNGIGEELGKGTRFEVVLT---ASEGHGKHAGLTQVRVKMTHLASGLEFLLRPREFLGRRFLMQEMYQRYLQGDDW-DLPRDKDPFWECPESTVSVGVVQVALQPLSHQLAVSETYPVLDCHGQKQGHLRVLIQPCDSDG--APKRQQVGDPNELIGKQLHLLIRILGARGIPEHFT-KTHCRFKLFCED---EDETAEVASSNPDYNFEKTFFFNPVTEEFLDYIAKSVLTIEVCGTQ 839          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009206.1 (pep scaffold:Pmarinus_7.0:GL476573:157919:195746:1 gene:ENSPMAG00000008319.1 transcript:ENSPMAT00000009206.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 489.96 bits (1260), Expect = 1.326e-161
Identity = 281/598 (46.99%), Postives = 372/598 (62.21%), Query Frame = 3
Query:  126 VKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENS-TDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKME-----INSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSD-IRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT----IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRREI-MEEFKAQMSANSEIIAAEDPK--------IWNARLEEARKEVAIISKEEKNEADKRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILF 1859
            +KVAVRVRPFN+REK R A + I M+GNTT I  P +   D K FTFDYSYWSHD FV   NG+L P+  N ++A QK VF DLG+ +LENA+ GYNCSLFAYGQTGSGK+YS+VG  ANKGI+P+ C+ LF+ +E     I    ++   V+ SM+EIYNE VRDLL+ ++  +GGL +R+    GFFV+ L  +PVGSY +I+SR+++GT +RT+A T+MNATSSRAHT+V ITF Q   S+G   ++KSS +N+VDLAGSERA +TGA  +RLKEG  IN+SLS LGNVI ALAD   G +K+    ++P+RDSVLTKLL+NALGGNSKT+MIAALSPAD+NY+ETL TLR+ DRAK I+ +A+VNE+P  +L+REL+ EN RL++ L+  ++    ++QG S       +      +F    S N    + E  +         W  RL   R       KEEK   +KR  + HL NLNEDP L+G++ H++ E    I   +GK E                               I+L G+ +   HA +   N+    I      A+  +NG  LT    L H D IL 
Sbjct:    2 IKVAVRVRPFNEREKTRGASIIISMEGNTTRIIKPRSGDADVKTFTFDYSYWSHDGFVALDNGYLAPE--NEQFADQKRVFSDLGEGILENAWNGYNCSLFAYGQTGSGKTYSVVGGSANKGILPLFCERLFEDIERNVEHITGDMALVCNVSLSMVEIYNEQVRDLLNPQSGRQGGLRIREKVDHGFFVENLLTVPVGSYGDIDSRIQEGTRNRTIAATHMNATSSRAHTIVAITFVQKAMSDGGHTLQKSSTINIVDLAGSERAGNTGAARERLKEGCMINQSLSTLGNVIKALADQGKGVQKSTALVLLPFRDSVLTKLLKNALGGNSKTIMIAALSPADVNYEETLSTLRFVDRAKAIRVQAVVNESPTSRLVRELQQENMRLQELLSQASVG---SVQGESWGGPCTTKCPCDPAKFSLLASWNPCASSWEQNRREMEHMAMSWEQRLASERLAHQQKLKEEKELREKRKTIPHLWNLNEDPALNGLLCHFIPEGSLSIG--NGKSENPAG---------------------------IILHGVGVLPHHASV--NNKDGVIILAPSPEARVLINGCPLTQPALLNHNDSILI 563          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: kif16bb (kinesin family member 16Bb [Source:ZFIN;Acc:ZDB-GENE-070424-241])

HSP 1 Score: 367.081 bits (941), Expect = 4.248e-108
Identity = 231/501 (46.11%), Postives = 302/501 (60.28%), Query Frame = 3
Query:  123 SVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITN---PENSTDK------KVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLS------NGKKKTI-VPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEADKRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLI 1577
            SVKVAVRVRP NQREK   AK  I M+G  T+ITN   PE ST        K FT+DYSY+S              D  + ++ASQ+ V++D+G  VL+ AF GYN  +FAYGQTGSGKSY+M+G   + G++P IC+ L++ +  + S    Y    S LEIYNE VRDLL +++     L VR+ P +G +V+ L K  V +Y ++E  ME G  +RT A T MN  SSR+H +  I F Q            S ++LVDLAGSERAD+TGATG RLKEG NINKSL  LGNVIS+LADLS       G+KK + VPYRDSVLT LL+++LGGNSKT+MIA +SPAD+NY ETL TLRYA+RAK I NK  +NE+   KL+REL+ E  RLK  L  GN    ++    S   +S      ME+   Q  A  E +  E    WN      R++   + KE        S+L HL+ +++D   +GII+++L E  T +
Sbjct:    3 SVKVAVRVRPMNQREKGLEAKFIIQMEGKKTVITNLKTPEGSTGDVSRERLKEFTYDYSYFS-------------VDKRSPQFASQEMVYKDIGMDVLDAAFEGYNACIFAYGQTGSGKSYTMMGNPGDLGLIPRICEGLYRGVSQHISSGASYRTEVSYLEIYNERVRDLLRRKSSKSFNLRVREHPKEGPYVEDLSKHLVQNYSDVEELMEAGNINRTTAATGMNDVSSRSHAIFTIKFTQAKFDAEMPRETVSKIHLVDLAGSERADATGATGVRLKEGGNINKSLVTLGNVISSLADLSLSSSSPQGRKKQVFVPYRDSVLTWLLKDSLGGNSKTIMIATISPADVNYGETLSTLRYANRAKNIINKPTINEDSNVKLIRELRAEIVRLKALLTQGNQNSLLD----SPTALS------MEQKLHQNEARVEELTKEWTNKWNETQNILREQTLALRKEGIG-VILDSELPHLIGIDDDLLSTGIILYHLKEGRTFV 479          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005274.1 (pep scaffold:Pmarinus_7.0:GL482849:195:11973:-1 gene:ENSPMAG00000004797.1 transcript:ENSPMAT00000005274.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 275.789 bits (704), Expect = 1.726e-84
Identity = 153/314 (48.73%), Postives = 205/314 (65.29%), Query Frame = 3
Query:  345 ASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGG---LPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMN--ATSSRAHTVVIITFDQITQSNGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT-IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALN 1268
            + Q+ VF  LG  +L+NAF GYN  +FAYGQTGSGKSYSM+G     G+ P +C  LF+++   S D   ++V  S +EIYNE VRDLL     PKGG   L VR+    G +V GL ++ V +++ + +  + G+  R          A+ ++      +T      ++G+   K S ++LVDLAGSERA  TGA GDRLKEG+NINKSLS LG VISALAD + GK K   VPYRDS LT LL++ LGGNS+T M+A +SPA  NY+ETL TLRYADRAK+I N A+VNE+P  +++REL+ E ++L+  LN
Sbjct:    1 SGQEVVFHALGDGILDNAFQGYNACIFAYGQTGSGKSYSMMGSAEQPGLTPRLCGALFERVSRLSRDDHSFKVEVSYMEIYNEKVRDLL----DPKGGRQSLKVREHKLLGPYVDGLSQLAVRTFQHVNNLYKIGSKFRPGHRVTSRELASCNQGWWGXTLTQTLTDLASGTSGEKVSRLSLVDLAGSERASKTGAAGDRLKEGSNINKSLSTLGLVISALADQAAGKNKNKFVPYRDSALTWLLKDNLGGNSRTAMVATVSPAADNYEETLSTLRYADRAKRIVNHAVVNEDPNARIIRELRDEVDKLRSQLN 310          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005277.1 (pep scaffold:Pmarinus_7.0:GL482849:207:11964:-1 gene:ENSPMAG00000004797.1 transcript:ENSPMAT00000005277.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 272.322 bits (695), Expect = 2.852e-83
Identity = 155/311 (49.84%), Postives = 201/311 (64.63%), Query Frame = 3
Query:  360 VFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGG---LPVRQTPFQGFFVQGLKKIPVGSY----KEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNG-SDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT-IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQAL 1265
            VF  LG  +L+NAF GYN  +FAYGQTGSGKSYSM+G     G+ P +C  LF+++   S D   ++V  S +EIYNE VRDLL     PKGG   L VR+    G +V GL ++ V ++    +E+ S  +      T+  T  +  S R  T      +  TQ+   +   K S ++LVDLAGSERA  TGA GDRLKEG+NINKSLS LG VISALAD + GK K   VPYRDS LT LL++ LGGNS+T M+A +SPA  NY+ETL TLRYADRAK+I N A+VNE+P  +++REL+ E ++L+  L
Sbjct:    3 VFHALGDGILDNAFQGYNACIFAYGQTGSGKSYSMMGSAEQPGLTPRLCGALFERVSRLSRDDHSFKVEVSYMEIYNEKVRDLL----DPKGGRQSLKVREHKLLGPYVDGLSQLAVRTFQVTSRELASCNQGWWGELTLTQTLTDLASGRPRTHWCSCTNTCTQTTRRTSGEKVSRLSLVDLAGSERASKTGAAGDRLKEGSNINKSLSTLGLVISALADQAAGKNKNKFVPYRDSALTWLLKDNLGGNSRTAMVATVSPAADNYEETLSTLRYADRAKRIVNHAVVNEDPNARIIRELRDEVDKLRSQL 309          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KIP3 (Kinesin-related antiparallel sliding motor protein; involved in mitotic spindle positioning; sliding activity promotes bipolar spindle assembly and maintenance of genome stability; inhibits spindle elongation, destabilizing late anaphase spindle microtubules that polymerize beyond the midzone [Source:SGD;Acc:S000003184])

HSP 1 Score: 213.386 bits (542), Expect = 5.653e-58
Identity = 126/316 (39.87%), Postives = 190/316 (60.13%), Query Frame = 3
Query:  345 ASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNG----SDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVE-------KLLRELKVENERLKQ 1259
            +SQ  V+++    +L++   G+N ++FAYG TG GK+Y++ G  +  GI+ +  +ELF K+  +  D   +E++ S LEIYNE +RDLL  E  P   L +R+       V  L      + +++   + QG  +RT + T  N  SSR+H V+ I    I Q+N     +     + ++++DLAGSERA +T   G RL EGANIN+SL  LGN I+AL  L++G +   +PYRDS LT+LL+ +LGGN KTVMI  +SP+  +YDETL TL+YA+RAK+IK K I N+  +        K++ E K + E L++
Sbjct:  163 SSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGTPSQPGIIFLAMEELFNKI-TDLKDEKDFEISLSYLEIYNERIRDLLKPET-PSKRLVIREDTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQI---HIMQTNKLVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALC-LNDGSRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTKIIRNQQSLSRHVGSYLKMITEQKRQIEELRE 472          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KIP1 (Kinesin-related motor protein; required for mitotic spindle assembly, chromosome segregation, and 2 micron plasmid partitioning; functionally redundant with Cin8p for chromosomal but not plasmid functions [Source:SGD;Acc:S000000159])

HSP 1 Score: 215.698 bits (548), Expect = 1.052e-57
Identity = 158/431 (36.66%), Postives = 224/431 (51.97%), Query Frame = 3
Query:  114 SDESVKVAVRVRPFNQRE---KDRLAKLTIDMQGNTTIITNPEN---STDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVG---------------YGANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQ--PKGGLPVRQTPF-------QGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSN-----GSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNEN------------PVEKLLRELKVENERLKQAL 1265
            SD ++ V VR R  N+RE   K  +   T+  QG   I++N  +   S+ KK + FD  + +                     + Q++VF    K+ ++    GYNC++FAYGQTG+GK+Y+M G                G + GI+P +  +LFK++   SS +  Y V  S LE+YNEN++DLLS      P    P RQ              V+G+++I + S  E  + + QG+  R VA T  N  SSR+HTV  IT + + Q +       +  K   +NLVDLAGSE  + +GA   R +E   INKSL  LG VI+AL D SN      +PYR+S LT+LLQ++LGG +KT +IA +SPA I+ +ET  TL YA RAK IKN   VN++             +EKL  +LK  N R KQ +
Sbjct:   49 SDSNIHVYVRCRSRNKREIEEKSSVVISTLGPQGKEIILSNGSHQSYSSSKKTYQFDQVFGAE--------------------SDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLLLGEHAGIIPRVLVDLFKEL---SSLNKEYSVKISFLELYNENLKDLLSDSEDDDPAVNDPKRQIRIFDNNNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSNH-----IPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQVNQSLSKDTCLKDYIQEIEKLRNDLK--NSRNKQGI 449          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KAR3 (Minus-end-directed microtubule motor; functions in mitosis and meiosis, localizes to the spindle pole body and localization is dependent on functional Cik1p, required for nuclear fusion during mating; potential Cdc28p substrate [Source:SGD;Acc:S000006345])

HSP 1 Score: 163.696 bits (413), Expect = 4.572e-42
Identity = 98/277 (35.38%), Postives = 155/277 (55.96%), Query Frame = 3
Query:  360 VFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPV-------RQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRA 1169
            VF+++G+ +++++  GYN  +FAYGQTGSGK+++M+  G   GI+P     +F  +    +    Y+V    +EIYNEN+ DLL  +   K    +            +   +  +    + S + +E  +++    R+ A T  N  SSR+H++ II         G+       +NLVDLAGSER + +   GDRL+E  NINKSLS LG+VI AL    + K+   +P+R+S LT LLQ +L G+SKT+M   +SP+  + +ETL +LR+A + 
Sbjct:  451 VFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTMLNPG--DGIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLLRSDNNNKEDTSIGLKHEIRHDQETKTTTITNVTSCKLESEEMVEIILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNAKTGA--HSYGTLNLVDLAGSERINVSQVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRH--IPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLRFASKV 720          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KIP2 (Kinesin-related motor protein involved in mitotic spindle positioning; stabilizes microtubules by targeting Bik1p to the plus end; functions as a microtubule polymerase and catastrophe inhibitor in vitro; Kip2p levels are controlled during the cell cycle [Source:SGD;Acc:S000006076])

HSP 1 Score: 158.303 bits (399), Expect = 2.353e-40
Identity = 131/428 (30.61%), Postives = 194/428 (45.33%), Query Frame = 3
Query:  201 QGNTTIITNPENSTDKKV--------FTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKK-MEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGG---------------------LPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISAL-ADLSNGKKKTI-------------------------VPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAK----QIKNKAIVN--------ENPVEKLLRELKVENERLKQALNSGNL 1280
             G+ T + +P   T+ K         F FD+ + SH   +E                    V+E   K +++   +G+N ++FAYG TGSGK+++M G     G++P+    LF   ME + +   +++V  S LEIYNE + DLL    +  G                      L +R     G  V GL +    S +E+   +  G  SR +  T+ NA SSR+H +V+I        NG+   +SS ++L DLAGSERA  TG   +R KEG+ INKSL  LG VIS L AD  N     I                         +PYRDS LT+LLQ AL G+S    I  +   +    ET+ TLR+A RAK     +  K+I++        +  +E L R+L+ +   + +  N  N+
Sbjct:  137 HGSNTFVRDPWFITNDKTIVHEEIGEFKFDHVFASHCTNLE--------------------VYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQELGLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLLESGLEESGSRISTPSRLYMSKSNSNGLGVELKIRDDSQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTNVKNGTS--RSSTLSLCDLAGSERA--TGQQ-ERRKEGSFINKSLLALGTVISKLSADKMNSVGSNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETMNTLRFASRAKNVALHVSKKSIISNGNNDGDKDRTIELLRRQLEEQRRMISELKNRSNI 539          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: CIN8 (Kinesin motor protein; involved in mitotic spindle assembly and chromosome segregation [Source:SGD;Acc:S000000787])

HSP 1 Score: 144.05 bits (362), Expect = 2.632e-35
Identity = 96/246 (39.02%), Postives = 143/246 (58.13%), Query Frame = 3
Query:  642 PVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKA-----IVNENPVEKLLREL-KVENERLKQALNSGNLPQTVNIQGLSSD------EVSELRREI 1343
            P  QT   G ++Q L++  + +  E  + +++G   R VA T MN  SSR+HT+  IT   + + +  ++ + S MNLVDLAGSE  + +GA   R KE  +IN+SL  LG VI+AL D S       +P+R+S LT+LLQ++LGGN+KT +IA +SPA +  +ET  TL YA +AK IKNK      I+ +  V+ +  EL K++++ L      G      + + L+SD      EV E +REI
Sbjct:  309 PNDQT--NGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTIT---LYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGH-----IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREI 544          

HSP 2 Score: 75.8702 bits (185), Expect = 2.886e-14
Identity = 57/206 (27.67%), Postives = 94/206 (45.63%), Query Frame = 3
Query:  123 SVKVAVRVRPFNQREKDRLAKLTI---DMQGNTTIITNPENST------DKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVG----YGAN----KGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLK 689
            ++ VAVR R  N+RE    + + +   D+ G+  I  N    T      + K +T D  +                 GP    ASQ  +F+++   + ++   GYNC++  YG T +GK+Y+M G    Y        GI+P +  +LF  +E+  +D   Y V  S +E+YNE ++DLL   +          T F G F++ L+
Sbjct:   36 NITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVF-----------------GPG---ASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQND---YVVKCSFIELYNEELKDLLDSNSNGSSN-----TGFDGQFMKKLR 213          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO35613 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL10])

HSP 1 Score: 977.622 bits (2526), Expect = 0.000e+0
Identity = 526/1039 (50.63%), Postives = 719/1039 (69.20%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPEN-STDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQG-FFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQS-NGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEADKRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKENKNLPKLIDWEYAQNEIAHADGFGTENVKGLTKDXXXXXXXILEILPMISEVNAISEELEKSKTFEIILVPPNAQDSKYGSAKRTAIMIKVMDNKNGNFWIWERGKFMSRRYLMQEMYQQFLEDKSLKETISSKDPFWEPTGEVLIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSISPSTSNGRVIDEDNFVDDPKSLLTRTYHFLIGIASVELHNAKYTIGIKVRFRIFKDEKSFETETSKGSKSAVFNYNKVISFARITQEHLDYFLTGYITFRIFVNQDDSNKNVIRLDLLDANSTMKRPENRRISVIP----------LVDASEEIMKLKTDLTIIXXXXXXXXXXXXXXXXXCNDFNSNSNGNYEAFHRATNAILFYGDNQ-KFRTDGMIIGNMVSYSNSKTNGMNDTNIDGTVKLDSQNSNSCI 3185
            MS ESVKVAVRVRPFN REKDR +K+ +DM    T I +PEN +   K FTFD+SYWSHD F ED NG+L P+ P  +YA Q+ VF+DLG  VL NAF G+NCSLFAYGQTG+GKSYSMVGYG NKGIVP+ CDELFK+M  N+  +++Y+V+FSMLEIYNE VRDLL K   PKGGL VRQ P +G F+VQ LKK+ VGSY+EIE R E+GT++RTVA T MNATSSRAHTVV I FDQI ++ +G + +KSSI+NLVDLAGSERADSTGATGDRLKEGANINKSLS LGNVISALADLS GKKK +VPYRDSVLTKLLQNALGGNSKT+MIAALSPADINYDETLGTLRYADRAK+IKNKA+VNENP++KL+RELK ENERLK+++  G +P  ++  G+S +E+  +R+++ EE KAQ++ N+E + +     W+ +L+++R E +  S E +    K + + H++NLNEDP LSG++ H++ ++   I     + +                              +IV  GLSI  +HA+I  K+    TI+P  +GAKTK+NG  LT E PL H DRILFGS+HMY   +P+N ++N+  P  +DW++AQ EIA A GF T +  G TK+QQ+ Q+Q+LE+LP++SE+NA+SEEL+K KTFE++LV   AQ    G+   T +M+K+ +  N N W+W+RGKF++RR+LMQEMYQ+F++ + +      +DPFWEP  +VLIGTANVFLQ+LA+ LDF+DK+   +Y+G+EE  I V++SP T  G+ +DED FVD+PK LL + +H+ + I S ++H A++  G+ ++++   DE+  +T+T   + S  FN +KV S   I+++HL++F  G ITF ++  Q+DS  +  RL      S M   E R++  I           +V A   + +LK +  ++ R+LERL+ K+++L+ +C+DF   S+ +Y+ F+R   A  FY   Q K++ + +   N +   N K +  N   +   +    + S +CI
Sbjct:    1 MSGESVKVAVRVRPFNSREKDRGSKVCLDMIDALTQIRDPENPNAPPKEFTFDFSYWSHDGFREDENGYLHPEDP--KYADQRKVFDDLGAGVLRNAFEGFNCSLFAYGQTGAGKSYSMVGYGVNKGIVPITCDELFKQMATNTDATVKYQVSFSMLEIYNEQVRDLLCKN-NPKGGLQVRQNPKEGSFYVQNLKKVAVGSYEEIERRTEEGTANRTVAATQMNATSSRAHTVVTIAFDQIMKNESGQETKKSSIINLVDLAGSERADSTGATGDRLKEGANINKSLSALGNVISALADLSLGKKKVLVPYRDSVLTKLLQNALGGNSKTIMIAALSPADINYDETLGTLRYADRAKKIKNKAVVNENPMDKLIRELKEENERLKKSMEGG-IP--LSAAGMSPEEIERMRKQMEEEIKAQLAMNNESMMS-----WDDKLQQSRDEGS--SSEVQEMQQKLNSVPHIVNLNEDPLLSGVVKHFIEQEEVTIGNKKAEPQP-----------------------------SIVFSGLSIQKQHAVITIKDSE-ITIKPGTSGAKTKVNGLPLTGETPLKHMDRILFGSNHMYYLFNPKNKEKNEGSPDRVDWDFAQKEIAEAKGFSTGSGSGQTKEQQLAQEQVLELLPLVSEINAVSEELDKQKTFEVVLVSGAAQ-GNIGTG--TKVMVKMKNLLNENVWLWDRGKFLNRRFLMQEMYQKFMDSEDIN-VPKEEDPFWEPPEDVLIGTANVFLQSLAYALDFDDKLTATDYKGSEEASIFVNVSPCTQTGKSLDEDYFVDEPKDLLGKPFHYKVTIRSADIHKARFNKGVYIKYKCLGDEEFTQTDTKANTLSPEFNNSKVFSIPSISEKHLEWFENGCITFMVYGRQEDSIPDP-RL------SKMTTKELRQMDHIKGPQMGPRTGTIVGADVNVSQLKAETILMKRQLERLQNKEKRLQNICDDFEKKSDKDYDKFYREIRAAAFYKPGQLKYKVNQL---NAL-MKNQKGSTANGGQVKTELPKAQEGSRACI 981          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO42435 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1C9])

HSP 1 Score: 622.854 bits (1605), Expect = 0.000e+0
Identity = 376/887 (42.39%), Postives = 528/887 (59.53%), Query Frame = 3
Query:  156 NQREKDRLAKLTIDMQGNTTIITNPE-NSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEI--NSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSN-GSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSN----GKKK-TIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEADKRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDP----ENVKENKNLPKLIDWEYAQNEIAHADGFGTENVKGLTKDXXXXXXXILEILPMISEVNAISEELEKSKTFEIILVPPNAQDSKYGSAKRTAIMIKVMDNKNGNFWIWERGKFMSRRYLMQEMYQQFLEDKSLKETISSKDPFWE-PTGEVLIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSISPSTSNG-RVIDEDNFVDDPKSLLTRTYHFLIGIASVELHNAKYTIGIKVRFRIFKDEKSFETETSKGSKSAVFNYNKVISFARITQEHLDYFLTGYITFRIFVNQ 2771
            N RE  R A L I+M GN+T I +P     + K F FD+SYWSHD F E++ G+L    P  RYA QK VF+DLG  VLENA+ GYNCSLFAYGQTGSGKSYSMVGYGANKGIVP+ C+ELFK++    N      Y+V  SMLEIYNE  RDLL+     KGGL VRQ P +GF+V+ L  +PV SY +I++R+ +GT +RTVA TNMNATSSRAHT+V I F Q  ++  G ++ K+S++NLVDLAGSERA+STGATGDRLKEG+ IN+SLS LGN I  L   S     G+K  +++P+RDSVLTKLL+NALGGNSKT+MIAALSPADINY+ETL TLR+ADRAK IK KA+VNE+P +KL+REL+ EN RL   +  G               V +  +E ME+ K               K W  RL E         ++E+ E + R    H  NLNEDPQLS +I H++      I         D                             I L GL I   HA +   + +   I P+ +GAK  +NG  +T E  L H DR++FGS ++++   P    +  K    L K I ++ AQ EIA   GF  +   G +K+  ++Q+ +++++PM++E  A++EEL K   FE++LV P A+  K G   RT + +++   ++   W+W+R KF +R++LMQEMYQ ++E +   +     DPFWE    +V+IG A V+LQ LA+ ++FE+ + I +++GNE G + V   P T +G   ID+D+F++DP+ L+ +   F + I        ++      +F  + D++  +T   +G+ +  +N+ K+ SF  +T++  DY +   +   ++  Q
Sbjct:   15 NSRENARNATLIINMVGNSTEIKDPAMPEAEPKKFAFDFSYWSHDAFKENAEGYLEATEP--RYADQKKVFDDLGVGVLENAWKGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPIFCEELFKEVNAKKNEGSKAEYQVALSMLEIYNEQTRDLLNPGGNKKGGLKVRQHPNRGFYVESLMTVPVSSYTDIDNRIGEGTRNRTVAATNMNATSSRAHTIVAINFIQKAKNEAGQNMTKTSVVNLVDLAGSERAESTGATGDRLKEGSAINQSLSTLGNCIKGLLSHSPTRALGRKMFSVIPFRDSVLTKLLKNALGGNSKTIMIAALSPADINYEETLSTLRFADRAKAIKTKAVVNESPTDKLIRELREENARLLDQIKKGG--------------VLKRNQEEMEQVK---------------KSWEERLLETEASYKAKEEQERREKEMRKTTAHFWNLNEDPQLSNMIAHFMHAGSHKIGSRKADPPAD-----------------------------ITLSGLGILTDHATVSNTS-NVLKILPS-SGAKLMVNGKPITMETELHHNDRVMFGSSNLFVVHHPVELGKACKSGVTLQK-ITYDMAQEEIAQNSGFDMDKAGGKSKEDLLLQEDLIQLVPMVNEATAMAEELGKKVRFEVMLVSPQARGLKEG---RTEVKVRMHSLEDDAEWVWDRNKFFNRKFLMQEMYQNYVEGEDWDKP-QELDPFWEDDETDVMIGRAIVYLQFLAYKIEFEESVAITDHKGNELGKLQVEAFPCTKSGNEDIDDDDFIEDPEELVGKELFFNLKIPYARGLPQRFGGKTFCKFMFYIDKEYTKTPVIEGTINPNYNFTKMFSFVPVTKQFQDYLVNSNLVIEVWGKQ 834          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO44751 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUT6])

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 362/782 (46.29%), Postives = 494/782 (63.17%), Query Frame = 3
Query:  156 NQREKDRLAKLTIDMQGNTTIITNPEN-STDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEINSSDSMR--YEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQ-SNGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEADKRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKENKNLPKLIDWEYAQNEIAHADGFGTENVKGLTKDXXXXXXX------ILEILPMISEVNAISEELEKSKTFEIILVPPNAQDSKYGSAKRTAIMIKVMDNKNGNFWIWERGKFMSRRYLMQEMYQQFLEDKSLKETISSKDPFWE-PTGEVLIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSISPST 2468
            N+RE+ R AKL ++M+G TT++T+P   + D K FTFDYSYWSHD F ED  G+L    PN  YA Q+ V+ED+GK+VL+NA+ GYN +LFAYGQTGSGKS+S+VGYGANKGIVP+ CDE+FK ++   ++  +  YEV FSMLEIYNE VRDLL+  +  K GL VRQ P +GF+ +GLK +PV SY+EIE RME GT +RTVA T MNATSSRAHT+V +TF Q ++ + G +  K+S++NLVDLAGSERADSTGATGDRLKEGA IN+SLS LGNVISAL D +NGK    VPYRDSVLT LL+NAL GNSKT MIAA+SPADINYDETL TLRYADRAKQIK  A VNE+P EKL+R+L+ +NE+L + L +      + +     DE   L             ANS    A++ +  N   E+  KE  + S++++ E  KR    HL NLN DPQL+G+IVH L +     +RI  K+     D                          IVL GL+I + H II  +     T+ P    AK  LNG  ++ E  L H DR++ GS ++++F  P+    +KN  +   +E AQ EIA   G   +  KG+       ++       ++++LPM+ + NAIS EL++   FE++L+   A+    G  +    M K +D   G  W+W R KF++R++LM+EMY+ + E +  +     +DPF E P  +V+IG  +V +++L + LD  +++ I +Y+G + G ++VSI+ ST
Sbjct:    2 NKRERARDAKLIVEMKGPTTMLTDPAAPNDDPKSFTFDYSYWSHDGFEEDDTGYLKGTQPN--YADQRRVYEDVGKTVLQNAWEGYNSTLFAYGQTGSGKSWSIVGYGANKGIVPIFCDEMFKGIDAKKAEGSQDQYEVLFSMLEIYNEKVRDLLNPSSS-KQGLRVRQHPKKGFYAEGLKTLPVSSYQEIEDRMEDGTRNRTVAATQMNATSSRAHTIVGVTFTQKSKNAAGEETAKTSVINLVDLAGSERADSTGATGDRLKEGAAINQSLSALGNVISALVDKANGKA-VRVPYRDSVLTSLLKNALAGNSKTAMIAAISPADINYDETLSTLRYADRAKQIKTTATVNEDPTEKLIRDLQEQNEKLMEMLKAAEKGGKITLTDDDDDEEEGLNM-----------ANS----AKEMEDMNKNWEDKVKESQLESRDKEEEKRKRQATPHLWNLNPDPQLTGMIVHLLDDGK---NRIGNKKADPPAD--------------------------IVLNGLNIQDVHCIINNEG-GKITVTPD-GDAKVLLNGEPVSEEEELHHFDRLMLGSSNLFVFHHPKEADNSKNKMEDFTYEMAQEEIARNSGIEVDESKGMRTGSGSRERTGRGEEDMVDLLPMVEQANAISMELDRKVAFEVVLMSAKARGESEGKPEPYVCM-KNLD--TGLEWLWPRNKFINRKFLMEEMYENYEEGEEWR-LPDERDPFTESPDAQVMIGCVDVSMESLGYVLDMREQLNIADYKGRDVGVLNVSIAAST 729          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO38591 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCK0])

HSP 1 Score: 389.423 bits (999), Expect = 5.877e-116
Identity = 268/673 (39.82%), Postives = 369/673 (54.83%), Query Frame = 3
Query:  126 VKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDKKV--------FTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGG---LPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVII-----TFDQITQSNGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKK----KTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLS-SDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARLEEARK---------EVAIISKEEKNEADKRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIE-RKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKENKNLP-KLIDWEYAQNEIAH---ADGFGTENVKGLTKDXXXXXXXILE 2039
            VKVAVRVRP N+RE D  +K+ +DM+ N TI+  P    D+K         F FD+ +WS              D   +++A+Q  V+E LG  VLENAF GYN  +FAYGQTGSGK+Y+M+G G +KGI+P +C  LF+ +  N +  + Y+V  S +EIYNE VRDLL     P+GG   L VR+    G +V+GL K+ V S+++IE+ M +G  SRTVA T MN  SSR+H V  I      +D  T+S G  + K   ++LVDLAGSERA  TGA GDRLKEG+NIN+SL  LG VIS+LA+ S GK        VPYRDSVLT LL++ LGGNSKTVM+A +SP+  NY+ETL TLRYADRAK+I N A+VNE+P  +++REL+ E ERLK  L S        I G    +E  EL  EI E     M + +E +  E    W  + ++  K         E   IS +      +++K  +L+NLN DP ++ ++V+YL E  + + R+                                    I L GL I   H  ++  +NE   T  P    A+T +NG  +     L H DRIL+G++H +    P     ++  P + +D+  AQ E+     A G   E+V+ L +  Q  +Q  LE
Sbjct:    5 VKVAVRVRPLNRREIDLGSKVVVDMEENQTILL-PSRGNDRKQAKVRMVHNFAFDHCFWS-------------IDAAKTKFAAQDKVYECLGSDVLENAFEGYNACIFAYGQTGSGKTYTMMGAGEDKGIIPRLCVNLFRGISQNDNHDITYKVEVSYIEIYNEKVRDLLC----PRGGSASLRVREHKVMGPYVEGLTKLVVSSFEDIEAIMMEGNKSRTVAATRMNTESSRSHAVFNILLARTEYDHQTESIGEKVSK---LSLVDLAGSERACKTGAEGDRLKEGSNINRSLVTLGQVISSLAEQSAGKHGKKGAHFVPYRDSVLTWLLKDNLGGNSKTVMVATISPSADNYEETLSTLRYADRAKKIVNHAVVNEDPNARIIRELREEVERLKHLLQS-------KIAGFPIQEETGEL--EIQE-----MISENENLMKECTMSWEQKEKQTEKIQQERHKALEDMGISIQSSGIGVEKNKF-YLVNLNADPAMNELLVYYLKEH-SKVGRLDANHTP-----------------------------DIQLGGLGILPEHCEMDIEENEVYLTPSP---NARTFVNGRDVKERTLLRHGDRILWGNNHFFRINCPRPPGSSEQQPEQQVDFMSAQQELMMHEIAQGPLQESVRALEEQYQADKQGALE 608          

HSP 2 Score: 67.3958 bits (163), Expect = 2.841e-11
Identity = 44/151 (29.14%), Postives = 75/151 (49.67%), Query Frame = 3
Query: 2031 ILEILPMISEVNAISEELEKSKTFEIILVPPNAQ----DSKYGSAKRTAIMIKVMDNKNGNFWIWERGKFMSRRYLMQEMYQQFLEDK-SLKETISSKDPFWEPTGEVLIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSISPST 2468
            +L+   ++ E N +SEE+ K   F + L  P +      S+ G +   AI++K   +K+    IW   K  ++ Y M+E+Y Q +E+     + +   D F+E     LIG  NVFL+ L  ++  E   PI++ +G   G + V +S  T
Sbjct:  681 VLKANTLVREANQLSEEMNKDTDFAVTLQIPTSSLTFGKSRSGYSSEVAIVVK---HKSRGTQIWSLDKLSNKIYDMRELYNQCIEEGVPFNDKVDDTDLFFEVECHTLIGVCNVFLECLLHDVSHEYAAPIISQQGEVCGRLKVEVSRVT 828          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO33740 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRC2])

HSP 1 Score: 363.614 bits (932), Expect = 2.382e-113
Identity = 221/511 (43.25%), Postives = 300/511 (58.71%), Query Frame = 3
Query:  123 SVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITN---------PENSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEINSS--DSMRYEVTFSMLEIYNENVRDLLSKEAQPKGG--LPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADL-----SNGKKKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELR--REIMEEFK---AQMSANSEIIAAEDPKIWNARLEEARK---EVAIISKEEKNEADKRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLI 1577
            SVKVAVRVRP N RE +  AK  I+M+G  T I N          E     K F+FDYSYWS DE              +  + +Q+ VF+DLG  V++ AF GYN  +FAYGQTGSGK+Y+M+G+  + G++P IC+ +F +M  NS+  D + +    S LEIY E VRDLL    + +    L VR+ P +G +VQ L K  V  Y  IE  MEQG S R  A T MN  SSR+H +  + F Q           +S +NLVDLAGSERAD+TGATG+RLKEGANINKSL  LG VISALAD      S+G     +PYRDSVLT LL+++LGGNSKT+MIA +SPAD+NY ET+ TLRYA+RAK I NK  +NE+P  KL+R+L+ + E+LK  ++                 VS+L+  ++++ E +   A+  + +E    +    W  R +E +K   E  +  +EE       S L HL+ +++D   +GI V++L E  T +
Sbjct:    3 SVKVAVRVRPLNNRENNMGAKTIIEMEGKKTRIYNVKGTNVTGEGERKNYVKDFSFDYSYWSVDE-------------RSRHFVNQERVFKDLGTDVVKAAFEGYNACIFAYGQTGSGKTYTMMGHNGDTGLIPRICENMFHRMTENSNADDGVSFRTEVSYLEIYQERVRDLLRPPTKGRAAHSLRVREHPKEGPYVQDLTKHLVSDYAAIEHLMEQGNSHRVTASTGMNDVSSRSHAIFTMNFTQAKFDMELPCETASKINLVDLAGSERADATGATGERLKEGANINKSLVTLGTVISALADASTGHGSHGSHHKFIPYRDSVLTWLLKDSLGGNSKTIMIATISPADVNYAETMSTLRYANRAKNIMNKPTINEDPNVKLIRDLRSQIEKLKAMISP----------------VSQLKALKDLLGEAELAAAKKLSENEARVTQLTDKWKDRWKETQKLLQEREMKLQEEGVGIKMDSILPHLVLVDDDLLSTGITVYHLKEGKTTV 484          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: kif1b (kinesin family member 1B [Source:NCBI gene;Acc:101174185])

HSP 1 Score: 432.18 bits (1110), Expect = 1.144e-132
Identity = 280/693 (40.40%), Postives = 374/693 (53.97%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDK-KVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYG--ANKGIVPVICDELFKKM-EINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDI--RKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT-------IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSD-----------------------------EVSELRREIME----EFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEAD---------------KRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAII--ERK-NEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVK-ENKNLPKL------IDWEYAQNEIAHADGF 1976
            MS  SVKVAVRVRPFN RE  + +K  I MQGNTT I NP+   +  K F+FDYSYWSH            P+ P+  +ASQ  V+ D+GK +LE+AF GYN  +FAYGQTG+GKSY+M+G      +GI+P++C++LF+K+ E N+ + + Y V  S +EIY E VRDLL+   + KG L VR+ P  G +V+ L K+ V SY +I   M+ G  +RTVA TNMN TSSR+H V  I F Q    N +D+   K S ++LVDLAGSERADSTGA G RLKEGANINKSL+ LG VISALA++ N   K+        +PYRDSVLT LL+  LGGNS+T M+AALSPADINYDETL TLRYADRAK IK  A++NE+P  KL+R+LK E  RLK+ L +  L   ++I  +  D                              V+ ++  IM     E   +    SE I AE  + W  +L   RK  AI  + E   A+                  K  HL+NLNEDP +S  +++Y+ + +T + +   +                                 IVL G  I   H I   ER  N     +     G++T +NG  +     L   +RI+ G +H++ F  PE  + E +  P        +DW +AQ E+    G 
Sbjct:    1 MSGASVKVAVRVRPFNSREIGKESKCIIQMQGNTTTILNPKAPKEPAKTFSFDYSYWSH----------TTPEDPS--FASQNRVYNDIGKEMLEHAFEGYNVCIFAYGQTGAGKSYTMMGKQEEGQEGIIPMLCEDLFEKINEDNNKEELSYSVEVSYMEIYCERVRDLLN--PKNKGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQRKHDNQTDLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVDNCTSKSKKKKKSDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKNIKCNAVINEDPNNKLVRDLKDEVARLKELLRAQGLGDILDIDPMGDDYPGSGIKSPIGSLTASPSSGALCNQGGLQSVTSIQERIMSTPGGEEAIERLKESEKIIAELNETWEEKL---RKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAERR-----------------------------QDIVLSGAHIKEEHCIFRSERNANGDVIVMLVPCEGSETYVNGKRVEDAIQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPVEPVDWTFAQRELLEKQGI 647          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: kif1b (kinesin family member 1B [Source:NCBI gene;Acc:101174185])

HSP 1 Score: 442.58 bits (1137), Expect = 5.176e-132
Identity = 283/672 (42.11%), Postives = 378/672 (56.25%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDK-KVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYG--ANKGIVPVICDELFKKM-EINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDI--RKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT-IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNL--------------PQT---VNIQGLSSDEVSELRREIME----EFKAQMSANSEIIAAEDPKIWNARL----------EEARKEVAIISKEEKNEADKRS--KLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAII--ER-KNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVK-ENKNLP------KLIDWEYAQNEIAHADGF 1976
            MS  SVKVAVRVRPFN RE  + +K  I MQGNTT I NP+   +  K F+FDYSYWSH            P+ P+  +ASQ  V+ D+GK +LE+AF GYN  +FAYGQTG+GKSY+M+G      +GI+P++C++LF+K+ E N+ + + Y V  S +EIY E VRDLL+ +   KG L VR+ P  G +V+ L K+ V SY +I   M+ G  +RTVA TNMN TSSR+H V  I F Q    N +D+   K S ++LVDLAGSERADSTGA G RLKEGANINKSL+ LG VISALA++S  KKK+  +PYRDSVLT LL+  LGGNS+T M+AALSPADINYDETL TLRYADRAK IK  A++NE+P  KL+R+LK E  RLK+ L +  L              P +    N  GL S  V+ ++  IM     E   +    SE I AE  + W  +L          E    E+ +  +E+       S  K  HL+NLNEDP +S  +++Y+ + +T + +   +                                 IVL G  I   H I   ER  N     +     G++T +NG  +     L   +RI+ G +H++ F  PE  + E +  P      + +DW +AQ E+    G 
Sbjct:    1 MSGASVKVAVRVRPFNSREIGKESKCIIQMQGNTTTILNPKAPKEPAKTFSFDYSYWSH----------TTPEDPS--FASQNRVYNDIGKEMLEHAFEGYNVCIFAYGQTGAGKSYTMMGKQEEGQEGIIPMLCEDLFEKINEDNNKEELSYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQRKHDNQTDLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVSKKKKKSDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKNIKCNAVINEDPNNKLVRDLKDEVARLKELLRAQGLGDILDTPIGSLTASPSSGALCNQGGLQS--VTSIQERIMSTPGGEEAIERLKESEKIIAELNETWEEKLRKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAE-----------------------------RRQDIVLSGAHIKEEHCIFRSERNANGDVIVMLVPCEGSETYVNGKRVEDAIQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPVEPVDWTFAQRELLEKQGI 627          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: kif1b (kinesin family member 1B [Source:NCBI gene;Acc:101174185])

HSP 1 Score: 440.269 bits (1131), Expect = 1.534e-131
Identity = 280/684 (40.94%), Postives = 376/684 (54.97%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDK-KVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYG--ANKGIVPVICDELFKKM-EINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDI--RKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT-IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSD-----------------------------EVSELRREIME----EFKAQMSANSEIIAAEDPKIWNARL----------EEARKEVAIISKEEKNEADKRS--KLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAII--ER-KNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVK-ENKNLPKL------IDWEYAQNEIAHADGF 1976
            MS  SVKVAVRVRPFN RE  + +K  I MQGNTT I NP+   +  K F+FDYSYWSH            P+ P+  +ASQ  V+ D+GK +LE+AF GYN  +FAYGQTG+GKSY+M+G      +GI+P++C++LF+K+ E N+ + + Y V  S +EIY E VRDLL+   + KG L VR+ P  G +V+ L K+ V SY +I   M+ G  +RTVA TNMN TSSR+H V  I F Q    N +D+   K S ++LVDLAGSERADSTGA G RLKEGANINKSL+ LG VISALA++S  KKK+  +PYRDSVLT LL+  LGGNS+T M+AALSPADINYDETL TLRYADRAK IK  A++NE+P  KL+R+LK E  RLK+ L +  L   ++I  +  D                              V+ ++  IM     E   +    SE I AE  + W  +L          E    E+ +  +E+       S  K  HL+NLNEDP +S  +++Y+ + +T + +   +                                 IVL G  I   H I   ER  N     +     G++T +NG  +     L   +RI+ G +H++ F  PE  + E +  P        +DW +AQ E+    G 
Sbjct:    1 MSGASVKVAVRVRPFNSREIGKESKCIIQMQGNTTTILNPKAPKEPAKTFSFDYSYWSHT----------TPEDPS--FASQNRVYNDIGKEMLEHAFEGYNVCIFAYGQTGAGKSYTMMGKQEEGQEGIIPMLCEDLFEKINEDNNKEELSYSVEVSYMEIYCERVRDLLN--PKNKGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQRKHDNQTDLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVSKKKKKSDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKNIKCNAVINEDPNNKLVRDLKDEVARLKELLRAQGLGDILDIDPMGDDYPGSGIKSPIGSLTASPSSGALCNQGGLQSVTSIQERIMSTPGGEEAIERLKESEKIIAELNETWEEKLRKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAE-----------------------------RRQDIVLSGAHIKEEHCIFRSERNANGDVIVMLVPCEGSETYVNGKRVEDAIQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPVEPVDWTFAQRELLEKQGI 641          

HSP 2 Score: 54.299 bits (129), Expect = 8.538e-7
Identity = 43/159 (27.04%), Postives = 70/159 (44.03%), Query Frame = 3
Query: 2052 ISEVNAISEELEKSKTFEIILVPPNAQDSKYGSAK------------------RTAIMIKVMDNKNGNFWIWERGKFMSRRYLMQEMYQQFLEDKSLKE-----TISSKDPFWEPTGEV-LIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSI 2456
            + E NAIS EL+K   F+ +L+     D+ Y                      RT + ++V D KNG    W   K   R   M+EMY +  E  S  +     T++  DPF++      L+G A V+L  L + +    ++ I+  +G+  GF+ V +
Sbjct:  752 LKEANAISVELKKKVQFQFVLL----TDTLYSPLPPELLPPEPEKEREVRPFPRTVVAVEVQDLKNGATHYWSLEKLKQRLEQMREMYDRAGEMASTHQDDGEGTLTGSDPFYDRFHWFKLVGRAFVYLSNLLYPVPLIHRVAIVTEKGDVRGFLRVGV 906          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: kif1b (kinesin family member 1B [Source:NCBI gene;Acc:101174185])

HSP 1 Score: 439.884 bits (1130), Expect = 3.365e-131
Identity = 280/684 (40.94%), Postives = 377/684 (55.12%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDK-KVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYG--ANKGIVPVICDELFKKM-EINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDI--RKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT-IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSD-----------------------------EVSELRREIME----EFKAQMSANSEIIAAEDPKIWNARL----------EEARKEVAIISKEEKNEADKRS--KLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAII--ER-KNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVK-ENKNLP------KLIDWEYAQNEIAHADGF 1976
            MS  SVKVAVRVRPFN RE  + +K  I MQGNTT I NP+   +  K F+FDYSYWSH            P+ P+  +ASQ  V+ D+GK +LE+AF GYN  +FAYGQTG+GKSY+M+G      +GI+P++C++LF+K+ E N+ + + Y V  S +EIY E VRDLL+ +   KG L VR+ P  G +V+ L K+ V SY +I   M+ G  +RTVA TNMN TSSR+H V  I F Q    N +D+   K S ++LVDLAGSERADSTGA G RLKEGANINKSL+ LG VISALA++S  KKK+  +PYRDSVLT LL+  LGGNS+T M+AALSPADINYDETL TLRYADRAK IK  A++NE+P  KL+R+LK E  RLK+ L +  L   ++I  +  D                              V+ ++  IM     E   +    SE I AE  + W  +L          E    E+ +  +E+       S  K  HL+NLNEDP +S  +++Y+ + +T + +   +                                 IVL G  I   H I   ER  N     +     G++T +NG  +     L   +RI+ G +H++ F  PE  + E +  P      + +DW +AQ E+    G 
Sbjct:    1 MSGASVKVAVRVRPFNSREIGKESKCIIQMQGNTTTILNPKAPKEPAKTFSFDYSYWSH----------TTPEDPS--FASQNRVYNDIGKEMLEHAFEGYNVCIFAYGQTGAGKSYTMMGKQEEGQEGIIPMLCEDLFEKINEDNNKEELSYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQRKHDNQTDLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVSKKKKKSDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKNIKCNAVINEDPNNKLVRDLKDEVARLKELLRAQGLGDILDIDPMGDDYPGSGIKSPIGSLTASPSSGALCNQGGLQSVTSIQERIMSTPGGEEAIERLKESEKIIAELNETWEEKLRKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAE-----------------------------RRQDIVLSGAHIKEEHCIFRSERNANGDVIVMLVPCEGSETYVNGKRVEDAIQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPVEPVDWTFAQRELLEKQGI 641          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: kif1b (kinesin family member 1B [Source:NCBI gene;Acc:101174185])

HSP 1 Score: 434.106 bits (1115), Expect = 4.232e-129
Identity = 281/678 (41.45%), Postives = 375/678 (55.31%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDK-KVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYG--ANKGIVPVICDELFKKM-EINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDI--RKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT-------IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNL--------------PQT---VNIQGLSSDEVSELRREIME----EFKAQMSANSEIIAAEDPKIWNARL----------EEARKEVAIISKEEKNEADKRS--KLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAII--ER-KNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVK-ENKNLPKL------IDWEYAQNEIAHADGF 1976
            MS  SVKVAVRVRPFN RE  + +K  I MQGNTT I NP+   +  K F+FDYSYWSH            P+ P+  +ASQ  V+ D+GK +LE+AF GYN  +FAYGQTG+GKSY+M+G      +GI+P++C++LF+K+ E N+ + + Y V  S +EIY E VRDLL+ +   KG L VR+ P  G +V+ L K+ V SY +I   M+ G  +RTVA TNMN TSSR+H V  I F Q    N +D+   K S ++LVDLAGSERADSTGA G RLKEGANINKSL+ LG VISALA++ N   K+        +PYRDSVLT LL+  LGGNS+T M+AALSPADINYDETL TLRYADRAK IK  A++NE+P  KL+R+LK E  RLK+ L +  L              P +    N  GL S  V+ ++  IM     E   +    SE I AE  + W  +L          E    E+ +  +E+       S  K  HL+NLNEDP +S  +++Y+ + +T + +   +                                 IVL G  I   H I   ER  N     +     G++T +NG  +     L   +RI+ G +H++ F  PE  + E +  P        +DW +AQ E+    G 
Sbjct:    1 MSGASVKVAVRVRPFNSREIGKESKCIIQMQGNTTTILNPKAPKEPAKTFSFDYSYWSH----------TTPEDPS--FASQNRVYNDIGKEMLEHAFEGYNVCIFAYGQTGAGKSYTMMGKQEEGQEGIIPMLCEDLFEKINEDNNKEELSYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQRKHDNQTDLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVDNCTSKSKKKKKSDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKNIKCNAVINEDPNNKLVRDLKDEVARLKELLRAQGLGDILDTPIGSLTASPSSGALCNQGGLQS--VTSIQERIMSTPGGEEAIERLKESEKIIAELNETWEEKLRKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAE-----------------------------RRQDIVLSGAHIKEEHCIFRSERNANGDVIVMLVPCEGSETYVNGKRVEDAIQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPVEPVDWTFAQRELLEKQGI 633          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000050123.1 (SMESG000050123.1)

HSP 1 Score: 1762.66 bits (4564), Expect = 0.000e+0
Identity = 931/1052 (88.50%), Postives = 939/1052 (89.26%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEADKRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKENKNLPKLIDWEYAQNEIAHADGFGTENVKGLTKDXXXXXXXILEILPMISEVNAISEELEKSKTFEIILVPPNAQDSKYGSAKRTAIMIKVMDNKNGNFWIWERGKFMSRRYLMQEMYQQFLEDKSLKETISSKDPFWEPTGEVLIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSISPSTSNGRVIDEDNFVDDPKSLLTRTYHFLIGIASVELHNAKYTIGIKVRFRIFKDEKSFETETSKGSKSAVFNYNKVISFARITQEHLDYFLTGYITFRIFVNQDDSNKNVIRLDLLDANSTMKRPENRRISVIPLVDASEEIMKLKTDLTIIXXXXXXXXXXXXXXXXXCNDFNSNSNGNYEAFHRATNAILFYGDNQKFRTDGMIIGNMVSYSNSKTNGMNDTNIDGTVKLDSQNSNSCIRETIVXXXXXXXXXMGQKMAIPHDTQS 3266
            MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKME+NSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEADKRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKEE+DTDDEDLELQKKSK+KKKVKSKPEKIEMNTIVLKGLSISNRHAIIERK+EHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKENKNLPKLIDWEYAQNEIAHADGFGTENVKGLTK                                          D+K G               N   W  ERGKFMSRRYLMQEMYQQFLEDKSLKETISSKDPFWEPTGEVLIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSISPSTSNGRVIDEDNFVDDPKSLLTRTYHFLIGIASVELHNAKYTIGIKVRFRIFKDEKSFETETSKGSKSAVFNYNKVISFARITQEHLDYFLTGYITFRIFVNQDDSNKNVIRLDLLDANSTMKRPENRRISVIPLVDASEEIMKLKTDLTIITR                           E   R          ++K +        MVSYSNSKTNGMNDTNIDGTVKLDSQNSNSCIRETIVEEEETSE SMGQKMAIPHDTQS
Sbjct:    1 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEMNSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEADKRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKEEIDTDDEDLELQKKSKHKKKVKSKPEKIEMNTIVLKGLSISNRHAIIERKDEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKENKNLPKLIDWEYAQNEIAHADGFGTENVKGLTK----------------------------------------VMDNKNG---------------NFWIW--ERGKFMSRRYLMQEMYQQFLEDKSLKETISSKDPFWEPTGEVLIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSISPSTSNGRVIDEDNFVDDPKSLLTRTYHFLIGIASVELHNAKYTIGIKVRFRIFKDEKSFETETSKGSKSAVFNYNKVISFARITQEHLDYFLTGYITFRIFVNQDDSNKNVIRLDLLDANSTMKRPENRRISVIPLVDASEEIMKLKTDLTIITR-------------------------KLERLERK---------DRKLK--------MVSYSNSKTNGMNDTNIDGTVKLDSQNSNSCIRETIVEEEETSEISMGQKMAIPHDTQS 953          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000050123.1 (SMESG000050123.1)

HSP 1 Score: 1320.45 bits (3416), Expect = 0.000e+0
Identity = 681/685 (99.42%), Postives = 685/685 (100.00%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEADKRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKENKNLPKLIDWEYAQNEIAHADGFGTENVKGLTKDXXXXXXXILEILPMISEVNAISEELEKSKTFEIILVPPNAQDSKYGSAKRTA 2165
            MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKME+NSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEADKRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKEE+DTDDEDLELQKKSK+KKKVKSKPEKIEMNTIVLKGLSISNRHAIIERK+EHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKENKNLPKLIDWEYAQNEIAHADGFGTENVKGLTKDQQVVQQQILEILPMISEVNAISEELEKSKTFEIILVPPNAQDSKYGSAKRTA
Sbjct:    1 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEMNSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEADKRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKEEIDTDDEDLELQKKSKHKKKVKSKPEKIEMNTIVLKGLSISNRHAIIERKDEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKENKNLPKLIDWEYAQNEIAHADGFGTENVKGLTKDQQVVQQQILEILPMISEVNAISEELEKSKTFEIILVPPNAQDSKYGSAKRTA 685          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000017296.1 (SMESG000017296.1)

HSP 1 Score: 836.639 bits (2160), Expect = 0.000e+0
Identity = 460/998 (46.09%), Postives = 637/998 (63.83%), Query Frame = 3
Query:  111 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEINSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEADKRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIER-KNEHSFTIRPALAGAKTKLNGNTL--TSECPLTHKDRILFGSHHMYLFIDPENVKENKNLPKLIDWEYAQNEIAHADGFGTENVKGLTKDXXXXXXXILEILPMISEVNAISEELEKSKTFEIILVPPNAQDSKYGSAKRTAIMIKVMDNKNGNFWIWERGKFMSRRYLMQEMYQQFLEDKSLKETISSKDPFWEPTGEVLIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSISPSTSNGRVID-EDNFVDDPKSLLTRTYHFLIGIASVELHNAKYTIGIKVRFRIFKDEKSFETETSKGSKSAVFNYNKVISFARITQEHLDYFLTGYITFRIFVNQDDSNKNVIRLDLLDANSTMKRPENRRISVIPLVDASEEIMKLKTDLTIIXXXXXXXXXXXXXXXXXCNDFNSNSN--GNYEAFHRATNAILFYGDNQKFRTDGMIIG 3086
            M  ESVKVAVR+RPFNQREKDR AKL I M G TT I NP+++ + K F FDYSYWSHD F  DSN  ++PDGP+S YASQ+ VF DLG+ VL NA  GYNCSLFAYGQTGSGKSYSM+GY +NKGIVP IC+ELFK +E  S++S++Y V FSMLEIYNE +RDLL      KG L +R+    GFFVQ L K+PVGSY+++E RM QGTS+RT+A T MNATSSRAHTV+ + F+Q+ +S  +   KSS + L+DLAGSERADST ATGDRLKEGA+INKSLS LGNVI+ALAD ++G K T++PYRDSVLTKLL+NALGGNSKTVMIAALSPADINYDETL TLRYADR KQIKN AIVNENP+EK++REL+ ENERLK ALN G LP+ +N +G+S +++  LR EI E+ K  +   SEII  ++ + W A++E A  +      E+ ++  K +K  +++N+NEDPQL+G + +++     ++ ++    +                            +  + + G  I   HAI+ R   + + +I+P  +    K+NG  +    E  L+  DR++FGS ++Y+F +P   K   N   + DWE  Q EIA A+GF         KD+ +++ QI+EILPM+ EVNAIS+E+ K K F+++++P  AQ   +    +  +MI++      N W+ ER  F++RR+++QEMY++FL+ +++       DPFWEPT ++L+G A V+LQ L + +     + +++Y+G EEG IS+ I P   +G  +D +D F +D   LL + Y   I I  + L   ++  G KV+F I+  +K+FET+T+K S  + FN+ KVIS+  IT++HLDYF  G I F ++  Q DS            +   K P   +I     V    E  K+KT+  +      R  RK  +LK LC D+++       ++   R+ +AI F  +N KF+    II 
Sbjct:    1 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNVKAFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLNNAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIKSGNTSNTKSSTIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPLEKIIRELREENERLKLALN-GQLPKDINTKGMSEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNF---DEKNSKKSKVNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDS--------------------------VTPVKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNP-TAKNRSN--AVWDWESVQTEIAAAEGFD-------VKDRSILESQIIEILPMVFEVNAISQEMNKDKKFDVLIIPEQAQALSFKEEGKPKVMIRMTSVITSNTWLMERSHFINRRFIIQEMYEKFLDGENMDNIPCKDDPFWEPTSDILVGIAPVYLQNLLYGIGMTYNVNVMDYKGREEGTISIKIEPCDKDGVTLDSQDQFFEDSMQLLKKPYSVKISIDYLSLFKTRFIHGSKVKFNIYLIDKTFETDTNKKSLESYFNFEKVISWPSITKDHLDYFKDGTIIFCVYGIQKDSKH--------QPSGNNKTPNQTKIK----VSMEYERNKMKTENVLSQALANRQARKIERLKQLCLDWSNKPTEEQKFDPLLRSVSAICFSSEN-KFKVISTIIA 945          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000071604.1 (SMESG000071604.1)

HSP 1 Score: 407.142 bits (1045), Expect = 6.580e-126
Identity = 271/771 (35.15%), Postives = 434/771 (56.29%), Query Frame = 3
Query:  219 ITNPENSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEINSSDSM-----RYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDI--RKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKNEADKRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKN---EHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKENKNLPKLIDWEYAQNEIA-HADGF-GTENVKGLTKDXXXXXXXILEILPMISEVNAISEELEKSKTFEIILVPPNAQDSKYGSAKRTAIMIKVMDNKNGNFWIWERGKFMSRRYLMQEMYQQFLEDKSLKETISSKDPFW-EPTGEVLIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSISPSTSNGRVIDE 2492
            IT  +    ++ F FD S+WS D F+ D NG+  PD P+  Y  Q+ +FE LG+++L NA+ GYNC+LFAYGQTGSGK+YS++GY ANKGIVP++C+ELF  + I+S  S       ++V   +LE+YNEN++DLL+  +  K  L ++    +GF+  G   + V +YKEI  ++E    +RT+A TNMN TSSRAHTVV I F+Q T +N  +    K S+++LVDLAGSE+   +GA GDRL E   IN+SLS LG+ + AL++  N      VP+R+SVLTKLL NALGGNSKTV++A +SP + NY+ET+ TLR+A+RAK +   A +N +  +K+++ LK +N RL Q +      + +  +G+  + V   +  I+ + + Q+  NS+ + +E  + ++ +L++A+ E+    +EE+    K  +  H+ NLN+DP L+ +++++  + LT++                          + KS+   IE+N     GL+I  +HA  E +N   + +  IRP ++ +   +NG  +T+E  L H DRILFG+   + F DP  +         ID   A+ EI   +D F   EN + L +        + + LP + EVN +++E+ +   + +++   N     Y  +  + + ++V D    N +     +F  RR+++ +MY +F+E        SS DPF    +  V IG +++ L  L   L+  + + ILN++  E G + V I     N   I E
Sbjct:    5 ITKIKYEDKERQFKFDNSFWSTDGFIVDENGYAKPDLPS--YVDQRGLFEKLGRNILNNAWEGYNCTLFAYGQTGSGKTYSVMGYYANKGIVPIMCEELF--LGIDSKISTLKANENFQVLLGVLEVYNENLKDLLNPSS--KEYLSIKDNSEKGFYAHGQIMLRVNNYKEILQKIEFSNKNRTIASTNMNKTSSRAHTVVTIQFNQ-TMANDKNCLTTKKSLIHLVDLAGSEKVKKSGAEGDRLFEARKINQSLSFLGDCLRALSEKHNH-----VPFRNSVLTKLLMNALGGNSKTVLLATISPCESNYEETMSTLRFAERAKTVTTNAKINVSETDKIIKSLKEDNLRLLQIV------KELEERGIEKNSVENTK--IIAQLQDQIKRNSQEV-SEISRSYSEQLDQAKAELEKQKREEEIHKLKLKQHPHIYNLNDDPSLNKVLIYFFEKPLTIVG------------------SSKFIVDETKSEKIDIEIN-----GLNILPKHA--EFRNDCDQKTVFIRP-ISNSNISINGEQITNEIKLNHLDRILFGNSFFFFFYDPRIINATAVKEPTID--DARMEITKRSDDFKKMENDRLLEE--------LSKYLPFVEEVNTVAKEMNRKVIYNLVIFQENL--PGYNYSDESKVFVRVFDTNKRNEYFIGLDEFSDRRFVIMDMYNEFIEGVVDISNSSSTDPFLPNESYPVCIGFSSIILVPLVHYLNINEDLKILNFKCQEMGNLIVEIVLCEKNWNQIPE 716          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000071414.1 (SMESG000071414.1)

HSP 1 Score: 375.17 bits (962), Expect = 8.908e-109
Identity = 258/671 (38.45%), Postives = 366/671 (54.55%), Query Frame = 3
Query:  123 SVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGAN---KGIVPVICDELFKKME---INSSDS---MRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDI--RKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKT-------IVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELR-----------------REIMEEFKAQMSANSEIIAAEDPKIWNARL---EEARK-------EVAIISKEEKNEADKRS--KLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKXXXXXXXXXXXXQXXXXXXXXXXXXXXXIEMNTIVLKGLSISNRHAIIERKNEHSFTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENV---KENKNLPKL----IDWEYAQNEIAHADG 1973
            SVKVAVRVRPFN RE  R AK  I M+G+TT I  P +    K F FDYSY S           + P   +S + +Q+ V+ DLG+  LE+A  GYN  + AYGQTG+GKSYSM+G   +   +GI+P +C  LFK+++   +++SD    +++ +  S +EIY E VRDLL+   + K  L VR+ P  G +V+ L K  V S+++I   ++ G  SRTVA TNMN TSSR+H V  I   Q       ++   K S ++LVDLAGSERADSTGA G RLKEGANINKSL+ LG VISALA+LS+  K T        +P+RDSVLT LL+  LGGNSKT M+ A+SPADINY+ETL +LRYADRAKQI  KA++NE+P  +L+RELK E  +L++ L   N+     + G+   E+S +R                 ++++E+ +A     SE + AE  + W  +L   E+ RK       E+ I  K +       S  K  +L+NLNED  ++  +V+YL +  T + +                                 +M+ I L G  I   H +   + EH      A+  A+  +NG  +     L   DR++FG +H++ F +P      +E K + +     +DW +A  E+    G
Sbjct:    3 SVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPPKSFIFDYSYSS-----------ICP--TDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLN--PKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTRLVRELKEEVLKLREILKLENIEVGEGLSGIP--EISVIRECRSNSMISSQIIIQDNQDVIEKLRA-----SEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQ--------------------------PEIVNSSKMD-IHLSGDCIMPMHCVFNCEGEH--VTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQG 622          

HSP 2 Score: 53.9138 bits (128), Expect = 8.532e-7
Identity = 35/113 (30.97%), Postives = 60/113 (53.10%), Query Frame = 3
Query: 2157 RTAIMIKVMDNKNGNFWIWERGKFMSRRYLMQEMYQQFLED---------KSLKETISSKDPFWE--PTGEVLIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSISP 2462
            +T ++I+V D KNG    W   KF  R  L++E+YQ   E           S  E+++  DPF++  P  + L+G + VFL  L +N+    ++ ++N +G  +G + V+I P
Sbjct:  811 KTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQ-LVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQP 922          
The following BLAST results are available for this feature:
BLAST of Kinesin-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIF1B5.904e-13942.52kinesin family member 1B [Source:HGNC Symbol;Acc:H... [more]
KIF1B5.904e-13942.52kinesin family member 1B [Source:HGNC Symbol;Acc:H... [more]
KIF1B1.538e-13442.47kinesin family member 1B [Source:HGNC Symbol;Acc:H... [more]
KIF1C8.474e-13340.23kinesin family member 1C [Source:HGNC Symbol;Acc:H... [more]
KIF1B7.963e-12841.07kinesin family member 1B [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klp-60.000e+042.29Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
unc-1045.790e-12440.78Kinesin-like protein unc-104 [Source:UniProtKB/Sw... [more]
unc-1045.790e-12440.78Kinesin-like protein unc-104 [Source:UniProtKB/Sw... [more]
unc-1047.621e-12440.78Kinesin-like protein unc-104 [Source:UniProtKB/Sw... [more]
unc-1047.621e-12440.78Kinesin-like protein unc-104 [Source:UniProtKB/Sw... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-1041.963e-12440.39gene:FBgn0267002 transcript:FBtr0087079[more]
unc-1042.343e-12440.39gene:FBgn0267002 transcript:FBtr0113088[more]
unc-1042.343e-12440.39gene:FBgn0267002 transcript:FBtr0113087[more]
unc-1042.424e-12440.39gene:FBgn0267002 transcript:FBtr0346959[more]
unc-1043.079e-12440.39gene:FBgn0267002 transcript:FBtr0330003[more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif1b9.969e-14241.61kinesin family member 1B [Source:ZFIN;Acc:ZDB-GENE... [more]
kif1b9.969e-14241.61kinesin family member 1B [Source:ZFIN;Acc:ZDB-GENE... [more]
kif1b9.847e-13842.41kinesin family member 1B [Source:ZFIN;Acc:ZDB-GENE... [more]
kif1b1.491e-13742.41kinesin family member 1B [Source:ZFIN;Acc:ZDB-GENE... [more]
kif1ab1.292e-13140.75kinesin family member 1Ab [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnq40.000e+040.62potassium channel, voltage gated KQT-like subfamil... [more]
kif1c7.979e-13942.71kinesin family member 1C [Source:NCBI gene;Acc:779... [more]
kif1c4.242e-13541.69kinesin family member 1C [Source:NCBI gene;Acc:779... [more]
kif1c3.088e-13441.32kinesin family member 1C [Source:NCBI gene;Acc:779... [more]
kif1c6.352e-13341.57kinesin family member 1C [Source:NCBI gene;Acc:779... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kif280.000e+037.70kinesin family member 28 [Source:MGI Symbol;Acc:MG... [more]
Kif280.000e+037.70kinesin family member 28 [Source:MGI Symbol;Acc:MG... [more]
Kif1b1.926e-13842.37kinesin family member 1B [Source:MGI Symbol;Acc:MG... [more]
Kif1b9.462e-13442.43kinesin family member 1B [Source:MGI Symbol;Acc:MG... [more]
Kif1c3.439e-13240.23kinesin family member 1C [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|F8WLE0|KIF28_RAT0.000e+037.90Kinesin-like protein KIF28P OS=Rattus norvegicus O... [more]
sp|D3YXS5|KIF28_MOUSE0.000e+037.70Kinesin-like protein KIF28P OS=Mus musculus OX=100... [more]
sp|Q9NGQ2|KIF1_DICDI1.305e-13350.20Kinesin-related protein 1 OS=Dictyostelium discoid... [more]
sp|O43896|KIF1C_HUMAN4.069e-13240.23Kinesin-like protein KIF1C OS=Homo sapiens OX=9606... [more]
sp|O35071|KIF1C_MOUSE2.493e-13140.23Kinesin-like protein KIF1C OS=Mus musculus OX=1009... [more]
back to top
BLAST of Kinesin-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7U1730.000e+053.71Uncharacterized protein OS=Capitella teleta OX=283... [more]
A7SL100.000e+050.63Predicted protein OS=Nematostella vectensis OX=453... [more]
K1QTK90.000e+053.42Kinesin-related protein 1 OS=Crassostrea gigas OX=... [more]
A0A210QN170.000e+051.29Kinesin-like protein KLP6 OS=Mizuhopecten yessoens... [more]
A0A3Q0JQB00.000e+052.01kinesin-like protein KIF28P isoform X4 OS=Ciona in... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif1b7.199e-13741.80kinesin family member 1B [Source:NCBI gene;Acc:103... [more]
kif1b6.175e-13341.79kinesin family member 1B [Source:NCBI gene;Acc:103... [more]
kif1aa3.414e-12839.94kinesin family member 1Aa [Source:ZFIN;Acc:ZDB-GEN... [more]
kif1ab4.315e-12840.35kinesin family member 1Ab [Source:ZFIN;Acc:ZDB-GEN... [more]
KIF1C1.182e-12740.35kinesin-like protein KIF1C [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009202.10.000e+041.83pep scaffold:Pmarinus_7.0:GL476573:157904:241529:1... [more]
ENSPMAT00000009206.11.326e-16146.99pep scaffold:Pmarinus_7.0:GL476573:157919:195746:1... [more]
kif16bb4.248e-10846.11kinesin family member 16Bb [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000005274.11.726e-8448.73pep scaffold:Pmarinus_7.0:GL482849:195:11973:-1 ge... [more]
ENSPMAT00000005277.12.852e-8349.84pep scaffold:Pmarinus_7.0:GL482849:207:11964:-1 ge... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KIP35.653e-5839.87Kinesin-related antiparallel sliding motor protein... [more]
KIP11.052e-5736.66Kinesin-related motor protein; required for mitoti... [more]
KAR34.572e-4235.38Minus-end-directed microtubule motor; functions in... [more]
KIP22.353e-4030.61Kinesin-related motor protein involved in mitotic ... [more]
CIN82.632e-3539.02Kinesin motor protein; involved in mitotic spindle... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO356130.000e+050.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424350.000e+042.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447510.000e+046.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385915.877e-11639.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337402.382e-11343.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif1b1.144e-13240.40kinesin family member 1B [Source:NCBI gene;Acc:101... [more]
kif1b5.176e-13242.11kinesin family member 1B [Source:NCBI gene;Acc:101... [more]
kif1b1.534e-13140.94kinesin family member 1B [Source:NCBI gene;Acc:101... [more]
kif1b3.365e-13140.94kinesin family member 1B [Source:NCBI gene;Acc:101... [more]
kif1b4.232e-12941.45kinesin family member 1B [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Kinesin-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000050123.10.000e+088.50SMESG000050123.1[more]
SMESG000050123.10.000e+099.42SMESG000050123.1[more]
SMESG000017296.10.000e+046.09SMESG000017296.1[more]
SMESG000071604.16.580e-12635.15SMESG000071604.1[more]
SMESG000071414.18.908e-10938.45SMESG000071414.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014167 ID=SMED30014167|Name=Kinesin-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3353bp
CGATCTTGACAATTGTTTAGTTACTTAAAATAGACTTAAAAAGCTATTTA
ACATTTAAACTACTGAATTAGATTTTAAGTTATCGCAGAAGTTCGAAAAT
TTTCATTGAAATGTCAGACGAATCAGTAAAGGTTGCCGTTCGAGTTCGGC
CATTTAATCAAAGAGAAAAGGACAGGTTAGCGAAATTAACTATAGACATG
CAAGGAAATACAACGATAATAACGAATCCCGAAAATTCAACTGATAAAAA
AGTTTTCACTTTCGATTATTCTTATTGGTCTCATGATGAATTTGTGGAAG
ATTCAAACGGCTTTCTAATTCCCGACGGACCGAATTCTCGATATGCTAGT
CAGAAAAGTGTTTTTGAAGACCTAGGGAAAAGCGTGTTAGAAAATGCTTT
CATTGGCTACAATTGCTCGTTATTTGCATATGGTCAAACCGGGTCGGGAA
AATCGTACTCTATGGTTGGATATGGAGCTAATAAAGGTATTGTTCCAGTC
ATTTGTGACGAACTCTTCAAGAAAATGGAAATAAATTCATCTGATTCAAT
GAGATATGAGGTAACATTTTCAATGTTAGAGATTTACAATGAAAATGTTC
GAGATTTACTTTCAAAAGAAGCTCAACCGAAAGGAGGATTACCAGTTAGA
CAAACTCCATTTCAAGGATTTTTTGTTCAAGGTCTCAAAAAAATTCCCGT
TGGATCATATAAAGAAATTGAATCAAGAATGGAGCAAGGCACGTCTAGTC
GGACAGTAGCCATGACCAACATGAACGCTACCAGCAGTAGGGCGCATACA
GTTGTCATCATAACATTCGATCAAATAACCCAATCCAATGGATCAGATAT
CAGAAAAAGTTCAATAATGAATTTAGTGGATTTAGCTGGATCCGAAAGAG
CAGACAGTACTGGAGCAACTGGAGACCGACTGAAAGAAGGCGCAAATATA
AATAAATCTTTATCGGTTTTGGGCAATGTAATCTCGGCTCTTGCCGACTT
AAGTAATGGAAAAAAGAAAACAATTGTACCATATCGTGATTCAGTGCTGA
CGAAATTGTTGCAGAATGCTCTCGGAGGAAACAGTAAAACTGTAATGATT
GCCGCTCTATCTCCAGCCGATATCAATTACGATGAAACTCTTGGGACTTT
GCGATATGCAGATCGGGCAAAACAGATAAAGAATAAAGCCATTGTCAATG
AAAATCCCGTGGAAAAATTGTTGAGAGAATTAAAGGTTGAAAACGAAAGA
TTGAAACAAGCACTTAATTCAGGAAATTTACCCCAAACTGTTAATATTCA
AGGATTAAGTTCTGATGAAGTAAGTGAATTACGCCGAGAAATCATGGAAG
AATTCAAAGCTCAAATGAGTGCTAATTCAGAAATTATTGCAGCTGAAGAC
CCCAAAATCTGGAATGCGAGGCTAGAAGAAGCACGAAAAGAGGTTGCAAT
AATTTCTAAAGAAGAAAAGAATGAAGCAGATAAAAGATCTAAATTACATC
ATTTGTTGAATCTCAATGAAGACCCTCAGTTATCAGGAATTATTGTTCAT
TATTTGACGGAAAAATTGACTCTTATATCCCGAATAAGCGGAAAAGAAGA
AATGGACACTGATGACGAGGACCTTGAATTACAGAAAAAAAGTAAAAACA
AAAAGAAAGTCAAGTCAAAACCAGAGAAAATAGAAATGAACACTATTGTG
TTGAAGGGTCTCAGTATAAGTAATCGACACGCTATTATAGAAAGAAAAAA
TGAGCATTCTTTCACAATCAGACCGGCATTGGCTGGGGCGAAAACTAAAT
TGAATGGTAATACATTAACAAGCGAGTGCCCCTTGACTCATAAAGATCGA
ATTTTATTTGGTTCTCATCATATGTACTTGTTCATTGATCCTGAAAATGT
TAAGGAGAATAAAAATCTCCCAAAATTAATTGACTGGGAGTATGCTCAAA
ATGAAATTGCCCATGCCGATGGATTTGGAACAGAGAATGTCAAAGGTTTA
ACTAAAGATCAACAGGTAGTTCAGCAGCAAATACTAGAAATTTTACCAAT
GATATCCGAAGTTAATGCTATTTCCGAAGAACTTGAAAAATCGAAAACCT
TTGAAATCATTCTAGTACCACCCAACGCCCAAGATTCAAAATATGGATCT
GCTAAAAGAACAGCTATTATGATAAAAGTTATGGATAATAAAAATGGTAA
CTTCTGGATTTGGGAAAGAGGTAAATTTATGAGCCGTCGATACCTAATGC
AAGAAATGTATCAACAGTTTTTGGAAGATAAATCTCTAAAAGAAACTATT
AGTTCCAAAGATCCGTTTTGGGAACCAACTGGTGAAGTGTTGATAGGAAC
TGCTAATGTATTTTTACAAGCTTTGGCTTTTAATTTGGATTTTGAGGATA
AAATACCCATATTAAATTATGAAGGAAATGAAGAAGGGTTTATAAGTGTA
TCTATATCCCCGAGTACAAGCAATGGTCGTGTAATTGATGAAGATAATTT
TGTTGATGACCCAAAATCTTTACTGACCAGAACATATCACTTTTTGATTG
GAATAGCTTCAGTTGAACTCCACAATGCTAAGTATACTATCGGAATAAAA
GTTCGATTTAGAATTTTCAAGGATGAGAAATCATTTGAAACCGAAACCTC
AAAAGGATCTAAATCTGCGGTGTTCAACTATAATAAAGTCATTTCATTTG
CTAGAATCACACAAGAGCATCTTGACTACTTTCTTACCGGATACATTACA
TTCCGCATCTTTGTCAATCAGGATGATTCAAACAAAAATGTTATACGATT
GGACCTATTAGATGCAAATTCAACAATGAAGAGACCTGAAAATCGACGAA
TTTCCGTCATTCCTCTAGTGGATGCTTCTGAGGAGATTATGAAATTGAAG
ACAGATTTAACAATAATTACAAGGAAGTTAGAGAGATTGGAAAGGAAAGA
TCGAAAACTCAAGACTCTTTGCAATGACTTCAATTCGAATAGTAATGGAA
ATTATGAGGCGTTTCACAGAGCGACAAACGCGATCCTCTTTTATGGTGAT
AACCAAAAATTTAGAACAGATGGAATGATTATAGGAAATATGGTTTCTTA
TTCTAACAGTAAAACCAATGGTATGAACGATACAAACATAGATGGGACAG
TGAAATTGGATAGTCAAAATAGTAACTCGTGTATTCGGGAGACGATAGTA
GAGGAAGAAGAGACATCCGAAACAAGTATGGGTCAGAAAATGGCGATACC
TCATGATACTCAATCAAGTAAAGTTTGTGAGATTATGTAGCTCTTATATT
ACCTCTTTAAACACTGATCTTATTTTCTTAATAAATTTCTTGAAGAGATC
GGA
back to top

protein sequence of SMED30014167-orf-1

>SMED30014167-orf-1 ID=SMED30014167-orf-1|Name=SMED30014167-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1060bp
MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDKKVFT
FDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGY
NCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEINSSDSMRYE
VTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSY
KEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDIRKS
SIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNG
KKKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYA
DRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLS
SDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISK
EEKNEADKRSKLHHLLNLNEDPQLSGIIVHYLTEKLTLISRISGKEEMDT
DDEDLELQKKSKNKKKVKSKPEKIEMNTIVLKGLSISNRHAIIERKNEHS
FTIRPALAGAKTKLNGNTLTSECPLTHKDRILFGSHHMYLFIDPENVKEN
KNLPKLIDWEYAQNEIAHADGFGTENVKGLTKDQQVVQQQILEILPMISE
VNAISEELEKSKTFEIILVPPNAQDSKYGSAKRTAIMIKVMDNKNGNFWI
WERGKFMSRRYLMQEMYQQFLEDKSLKETISSKDPFWEPTGEVLIGTANV
FLQALAFNLDFEDKIPILNYEGNEEGFISVSISPSTSNGRVIDEDNFVDD
PKSLLTRTYHFLIGIASVELHNAKYTIGIKVRFRIFKDEKSFETETSKGS
KSAVFNYNKVISFARITQEHLDYFLTGYITFRIFVNQDDSNKNVIRLDLL
DANSTMKRPENRRISVIPLVDASEEIMKLKTDLTIITRKLERLERKDRKL
KTLCNDFNSNSNGNYEAFHRATNAILFYGDNQKFRTDGMIIGNMVSYSNS
KTNGMNDTNIDGTVKLDSQNSNSCIRETIVEEEETSETSMGQKMAIPHDT
QSSKVCEIM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005874microtubule
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000231vitelline gland
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036961Kinesin_motor_dom_sf
IPR027640Kinesin-like_fam
IPR001752Kinesin_motor_dom
IPR022140Kinesin-like_KIF1-typ
IPR000253FHA_dom
IPR027417P-loop_NTPase
IPR008984SMAD_FHA_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0003777microtubule motor activity
GO:0005524ATP binding
GO:0008017microtubule binding
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0003774motor activity
Vocabulary: biological process
TermDefinition
GO:0007018microtubule-based movement
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 941..975
NoneNo IPR availableCOILSCoilCoilcoord: 382..402
NoneNo IPR availableCOILSCoilCoilcoord: 453..473
NoneNo IPR availableGENE3DG3DSA:2.60.200.20coord: 478..617
e-value: 7.5E-26
score: 92.4
NoneNo IPR availablePANTHERPTHR24115:SF586KINESIN-LIKE PROTEINcoord: 46..512
coord: 539..902
IPR001752Kinesin motor domainPRINTSPR00380KINESINHEAVYcoord: 234..251
score: 48.56
coord: 321..342
score: 63.26
coord: 114..135
score: 65.91
coord: 267..285
score: 58.73
IPR001752Kinesin motor domainSMARTSM00129kinesin_4coord: 3..379
e-value: 5.5E-157
score: 537.5
IPR001752Kinesin motor domainPFAMPF00225Kinesincoord: 11..371
e-value: 1.5E-100
score: 336.3
IPR001752Kinesin motor domainPROSITEPS50067KINESIN_MOTOR_2coord: 5..371
score: 109.37
IPR036961Kinesin motor domain superfamilyGENE3DG3DSA:3.40.850.10coord: 1..382
e-value: 6.3E-136
score: 454.9
IPR000253Forkhead-associated (FHA) domainPFAMPF00498FHAcoord: 542..599
e-value: 3.5E-6
score: 27.3
IPR000253Forkhead-associated (FHA) domainCDDcd00060FHAcoord: 540..607
e-value: 7.92056E-6
score: 43.529
IPR022140Kinesin-like KIF1-typePFAMPF12423KIF1Bcoord: 721..762
e-value: 1.8E-6
score: 28.3
IPR027640Kinesin-like proteinPANTHERPTHR24115FAMILY NOT NAMEDcoord: 46..512
coord: 539..902
IPR008984SMAD/FHA domain superfamilySUPERFAMILYSSF49879SMAD/FHA domaincoord: 479..607
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 5..402