Glutamine synthetase

Overview
NameGlutamine synthetase
Smed IDSMED30014151
Length (bp)1576
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glutamine synthetase (SMED30014151) t-SNE clustered cells

Violin plots show distribution of expression levels for Glutamine synthetase (SMED30014151) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glutamine synthetase (SMED30014151) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glutamine synthetase (SMED30014151) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014151

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30014151SMESG000014849.1 Contig3768GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30014151SMESG000003831.1 Contig3768GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30014151SMESG000003831.1 dd_Smed_v4_1275_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014151SMESG000003831.1 dd_Smed_v4_1275_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30014151SMESG000003831.1 dd_Smed_v6_1275_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014151SMESG000003831.1 dd_Smed_v6_1275_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glutamine synthetase vs. Ensembl Human
Match: LGSN (lengsin, lens protein with glutamine synthetase domain [Source:HGNC Symbol;Acc:HGNC:21016])

HSP 1 Score: 152.91 bits (385), Expect = 7.280e-40
Identity = 118/428 (27.57%), Postives = 203/428 (47.43%), Query Frame = 2
Query:  170 DEVEFIQTITVDIHGFSRGKMFPREKLNDLFQNKEE-----VVGLLEVLGTRFEIPESLTELSENHYR-NILITPEKSSLRVAPWSKDSSLAMVFYDAYDKITNSPWPFNPRLLAKNKIKELEVMGMKLMIGVENEFRLFGK----GSRKPLTDSVQLLSQFHQATVVLPFARELKKVAKDFDIEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGMHINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAA--ADWAPN-NISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMIVAGIDGIKNKLDLF----EAGNGFHCE--KLPKTLAESLEVLKQDKVLTEGLGPKFVDWYVKVKQ 1396
            + ++F++    D+HG SR K  P       FQ K         G LEV+    +    +  +    +  +I++ PE S+ RV PW+  +  A V  D +  +T  P   +PR +AK ++  L+  G  L+     +F +FG      S+     ++  L+   Q     PF +EL           +S++     GQ+EI      GI+  D  +  R   K VA + N  A++    I     +   ++HSLW V  K   N+F  +     L+  GK WLAG+LKH+ ALS   +P+V+C +R +    D   +   +W Y+D S    +K     EK   IEN+L S+  N Y+ +A+ + AG+DG+ +  ++     E+ + +  E  ++P  L ++L  L++D+ L + LG  F+ ++V +K+
Sbjct:   83 NRLQFVRFEATDLHGVSRSKTIPAH----FFQEKVSHGVCMPRGYLEVIPNPKD--NEMNNIRATCFNSDIVLMPELSTFRVLPWADRT--ARVICDTF-TVTGEPLLTSPRYIAKRQLSHLQASGFSLLSAFIYDFCIFGVPEILNSKIISFPALTFLNNHDQ-----PFMQELVDGLYHTGANVESFSSSTRPGQMEISFLPEFGISSADNAFTLRTGVKEVARKYNYIASFF---IETGFCDSGILSHSLWDVDRK--KNMFCSTSGTEQLTITGKKWLAGLLKHSAALSCLMAPSVSCRKRYSKDRKDLKKSVPTTWGYNDNSCIFNIKCH--GEKGTRIENKLGSATANPYLVLAATVAAGLDGLHSSNEVLAGPDESTDFYQVEPSEIPLKLEDALVALEEDQCLRQALGETFIRYFVAMKK 489          
BLAST of Glutamine synthetase vs. Ensembl Celegans
Match: gln-3 (Glutamine synthetase [Source:UniProtKB/TrEMBL;Acc:H8ESF5])

HSP 1 Score: 53.1434 bits (126), Expect = 2.444e-7
Identity = 46/196 (23.47%), Postives = 84/196 (42.86%), Query Frame = 2
Query:  689 IEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKE-TANGMHINHSLWSVKDKGLSNLFWDSKNENSL---SDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPNNISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMI-VAGIDGIKNKLDLF 1261
            I+    N E   GQ E  +   EGI   D++W+ R   + VA+   + A++   PI  +    G H N S   +++ G  +    + N+ SL     +  +   G   + R L+             A+ D      S+    R+ ++R+  ST ++   Y E+R PSS C+ Y    +++    ++G + KL + 
Sbjct:  190 IQISGTNAEVMPGQWEFQVGPCEGIQMGDQLWVARYLLQRVAEEFGVIASFDCKPIKGDWNGAGCHTNFSTDKMRNPGGIDEIMSAINKLSLVHPQHIAYYDPHGGKDNERRLTGL--------HETASID----KFSYGVASRASSIRIPRSTDDDGYGYFEDRRPSSNCDPYTVTGALVRTVCLEGAERKLSMM 373          
BLAST of Glutamine synthetase vs. Ensembl Celegans
Match: gln-3 (Glutamine synthetase [Source:UniProtKB/TrEMBL;Acc:H8ESF5])

HSP 1 Score: 52.373 bits (124), Expect = 2.493e-7
Identity = 46/196 (23.47%), Postives = 84/196 (42.86%), Query Frame = 2
Query:  689 IEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKE-TANGMHINHSLWSVKDKGLSNLFWDSKNENSL---SDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPNNISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMI-VAGIDGIKNKLDLF 1261
            I+    N E   GQ E  +   EGI   D++W+ R   + VA+   + A++   PI  +    G H N S   +++ G  +    + N+ SL     +  +   G   + R L+             A+ D      S+    R+ ++R+  ST ++   Y E+R PSS C+ Y    +++    ++G + KL + 
Sbjct:   68 IQISGTNAEVMPGQWEFQVGPCEGIQMGDQLWVARYLLQRVAEEFGVIASFDCKPIKGDWNGAGCHTNFSTDKMRNPGGIDEIMSAINKLSLVHPQHIAYYDPHGGKDNERRLTGL--------HETASID----KFSYGVASRASSIRIPRSTDDDGYGYFEDRRPSSNCDPYTVTGALVRTVCLEGAERKLSMM 251          
BLAST of Glutamine synthetase vs. Ensembl Celegans
Match: gln-3 (Glutamine synthetase [Source:UniProtKB/TrEMBL;Acc:H8ESF5])

HSP 1 Score: 52.373 bits (124), Expect = 2.493e-7
Identity = 46/196 (23.47%), Postives = 84/196 (42.86%), Query Frame = 2
Query:  689 IEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKE-TANGMHINHSLWSVKDKGLSNLFWDSKNENSL---SDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPNNISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMI-VAGIDGIKNKLDLF 1261
            I+    N E   GQ E  +   EGI   D++W+ R   + VA+   + A++   PI  +    G H N S   +++ G  +    + N+ SL     +  +   G   + R L+             A+ D      S+    R+ ++R+  ST ++   Y E+R PSS C+ Y    +++    ++G + KL + 
Sbjct:   68 IQISGTNAEVMPGQWEFQVGPCEGIQMGDQLWVARYLLQRVAEEFGVIASFDCKPIKGDWNGAGCHTNFSTDKMRNPGGIDEIMSAINKLSLVHPQHIAYYDPHGGKDNERRLTGL--------HETASID----KFSYGVASRASSIRIPRSTDDDGYGYFEDRRPSSNCDPYTVTGALVRTVCLEGAERKLSMM 251          
BLAST of Glutamine synthetase vs. Ensembl Celegans
Match: gln-3 (Glutamine synthetase [Source:UniProtKB/TrEMBL;Acc:H8ESF5])

HSP 1 Score: 52.373 bits (124), Expect = 2.493e-7
Identity = 46/196 (23.47%), Postives = 84/196 (42.86%), Query Frame = 2
Query:  689 IEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKE-TANGMHINHSLWSVKDKGLSNLFWDSKNENSL---SDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPNNISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMI-VAGIDGIKNKLDLF 1261
            I+    N E   GQ E  +   EGI   D++W+ R   + VA+   + A++   PI  +    G H N S   +++ G  +    + N+ SL     +  +   G   + R L+             A+ D      S+    R+ ++R+  ST ++   Y E+R PSS C+ Y    +++    ++G + KL + 
Sbjct:   68 IQISGTNAEVMPGQWEFQVGPCEGIQMGDQLWVARYLLQRVAEEFGVIASFDCKPIKGDWNGAGCHTNFSTDKMRNPGGIDEIMSAINKLSLVHPQHIAYYDPHGGKDNERRLTGL--------HETASID----KFSYGVASRASSIRIPRSTDDDGYGYFEDRRPSSNCDPYTVTGALVRTVCLEGAERKLSMM 251          
BLAST of Glutamine synthetase vs. Ensembl Celegans
Match: gln-3 (Glutamine synthetase [Source:UniProtKB/TrEMBL;Acc:H8ESF5])

HSP 1 Score: 53.1434 bits (126), Expect = 2.667e-7
Identity = 46/196 (23.47%), Postives = 84/196 (42.86%), Query Frame = 2
Query:  689 IEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKE-TANGMHINHSLWSVKDKGLSNLFWDSKNENSL---SDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPNNISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMI-VAGIDGIKNKLDLF 1261
            I+    N E   GQ E  +   EGI   D++W+ R   + VA+   + A++   PI  +    G H N S   +++ G  +    + N+ SL     +  +   G   + R L+             A+ D      S+    R+ ++R+  ST ++   Y E+R PSS C+ Y    +++    ++G + KL + 
Sbjct:  193 IQISGTNAEVMPGQWEFQVGPCEGIQMGDQLWVARYLLQRVAEEFGVIASFDCKPIKGDWNGAGCHTNFSTDKMRNPGGIDEIMSAINKLSLVHPQHIAYYDPHGGKDNERRLTGL--------HETASID----KFSYGVASRASSIRIPRSTDDDGYGYFEDRRPSSNCDPYTVTGALVRTVCLEGAERKLSMM 376          
BLAST of Glutamine synthetase vs. Ensembl Zebrafish
Match: lgsn (lengsin, lens protein with glutamine synthetase domain [Source:ZFIN;Acc:ZDB-GENE-060312-26])

HSP 1 Score: 156.377 bits (394), Expect = 1.679e-40
Identity = 121/433 (27.94%), Postives = 202/433 (46.65%), Query Frame = 2
Query:  170 DEVEFIQTITVDIHGFSRGKMFPREKLNDLFQNKEEVVGLLEVLGTRFEIPESLTELS-------------ENHYRNILITPEKSSLRVAPWSKDSSLAMVFYDAYDKITNSPWPFNPRLLAKNKIKELEVMGMKLMIGVENEFRLFGK----GSRKPLTDSVQLLSQFHQATVVLPFARELKKVAKDFDIEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGMHINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPNN---ISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMIVAGIDGIKNKLD----LFEAGNGFHCEKLPKTLAESLEVLKQDKVLTEGLGPKFVDWYVKVKQ 1396
            + + F++    D+HG SR K  P       F +++ V G+         +P S  EL+              N   ++L+ P+ S+ ++ PW+  +  A +  D    IT  P   +PRL+AK  + +L+ MG  L      E  +FG     G +     +  LLS   Q     PF ++L K   +  ++ +S++   G GQ+EI  +   G++  D  + FR   K +A + +  AT+ T    +   N   ++HSLW     G  +LF     E  LS++G+ WL+G+L H+ ALS   +P ++C  +++       N    +   +D S    VK     E   +I+N+L S+  N YI +A+ I AG+DGIK  L+    L  A N      +P  L ++L  L +D V+   LG  FV +++ +KQ
Sbjct:  247 ENLSFVRFEATDLHGVSRSKTVPAR-----FFHEKAVYGI--------PMPRSYLELTLSPQINEVDHASAVNFSSDVLLVPDLSTFQILPWADQT--ARLICDPC-TITGVPLRTSPRLIAKMMLGQLQSMGFSLHSSFTYECCIFGSPEHVGPKAVFFPATTLLSNNDQ-----PFLQQLVKGMYNMGVDVESFSSANGPGQMEICFKPRFGMDAADNAYTFRTGIKEMARKYDYIATFFTY---ENIQNSGLLSHSLWDAS--GRRSLFHSGNGE--LSEIGRKWLSGLLHHSAALSCLLAPGISCRTQISKGKKDSKNHVYATCGCNDNSCDFNVKIHGGRE--THIDNKLASAMANPYIVLAATIAAGLDGIKRNLNAEQVLSRAPNQQKQFVIPVKLDDALLALAEDSVICGALGEPFVQYFIAMKQ 649          
BLAST of Glutamine synthetase vs. Ensembl Xenopus
Match: pkn2 (protein kinase N2 [Source:Xenbase;Acc:XB-GENE-995298])

HSP 1 Score: 166.777 bits (421), Expect = 3.570e-45
Identity = 124/434 (28.57%), Postives = 207/434 (47.70%), Query Frame = 2
Query:  170 DEVEFIQTITVDIHGFSRGKMFPREKLNDLFQNKEEVVGLLEVLGTRFEIPESLTELSENHYR------NILITPEKSSLRVAPWSKDSSLAMVFYDAYDKITNSPWPFNPRLLAKNKIKELEVMGMKLMIGVENEFRLFGKGSRKPLTDSVQLLSQFHQATVVLP----FARELKKVAKDFDIEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGMHINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPN---NISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMIVAGIDGIKNKLDLFEAGN------GFHCEKLPKTLAESLEVLKQDKVLTEGLGPKFVDWYVKVKQ---ETE 1405
            +++ FI+    D+HGF R K+ P    +      E+ V  + V  +  E   +  +   +H +      +I++ P+ S+ RV PW++ +    V  DAY  + +S   + PR LAK  + +L+  G  L      EF +FG        DS +++  F  AT+V      F +EL           +S+      GQ+EI  +   G+   D  + FR   K VA +    +++    +     +G+  +HSLW     G  NLF D      L+D+G+ WL+G+L H+ ALS   +P V+C +  A     P      ++ ++D S +  VK   ++    YIEN+L S+A N Y+ +A+ + AG+DGI+  LDLF   N       F    +P  + ++L  LK+D+ +   LG  F+ +++ VKQ   ETE
Sbjct:   41 EDIHFIRFEVADLHGFPRSKIIPERFFH------EKAVSGIHVSRSYLEPNMNPIDSEADHKKAIYFNSDIVLKPDLSTFRVLPWAEKT--GKVICDAYTIMGDSLLTY-PRYLAKQLLMQLQESGFSLHASFNYEFCIFGVAET---VDSKKVV--FPAATLVTDNDQLFLQELFDGMYYIGGNIESFCSSSTPGQMEISFQPEYGLTAADNAFTFRAALKEVAKKYGYISSFCN-DVGGIYNSGV-FSHSLWD--SSGTKNLFIDGNQIQELTDIGRKWLSGLLFHSAALSCLVAPGVSCRKHFAKGAKDPQESIGATYGFNDNSCSYNVKCHCSS--GTYIENKLCSAAANPYLVLAATVAAGLDGIRRGLDLFIDTNRKFSPHQFKMHSVPMKMEDALSALKEDRYIRAALGDVFIHYFIAVKQHELETE 454          
BLAST of Glutamine synthetase vs. Ensembl Xenopus
Match: avpr1b (arginine vasopressin receptor 1B [Source:Xenbase;Acc:XB-GENE-481094])

HSP 1 Score: 162.54 bits (410), Expect = 1.169e-43
Identity = 123/434 (28.34%), Postives = 206/434 (47.47%), Query Frame = 2
Query:  170 DEVEFIQTITVDIHGFSRGKMFPREKLNDLFQNKEEVVGLLEVLGTRFEIPESLTELSENHYR------NILITPEKSSLRVAPWSKDSSLAMVFYDAYDKITNSPWPFNPRLLAKNKIKELEVMGMKLMIGVENEFRLFGKGSRKPLTDSVQLLSQFHQATVVLP----FARELKKVAKDFDIEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGMHINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPN---NISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMIVAGIDGIKNKLDLFEAGN------GFHCEKLPKTLAESLEVLKQDKVLTEGLGPKFVDWYVKVKQ---ETE 1405
            +++ FI+    D++GF R K+ P    +      E+ V  + V  +  E   +  +   +H +      +I++ P+ S+ RV PW++ +    V  DAY  + +S    +PR LAK  + +L+  G  L      EF +FG        DS +++  F  AT+V      F +EL           +S+      GQ+EI  +   G+   D  + FR   K VA +    +++    +     +G+  +HSLW     G  NLF D      L D+G+ WL+G+L H+ ALS   +P V+C +  A     P      ++ ++D S +  VK   ++    YIEN+L S+A N Y+ +A+ + AG+DGI+  LDLF   N       F    +P  + ++L  LK+D+ +   LG  F+ +++ VKQ   ETE
Sbjct:   41 EDIHFIRFEVADLYGFPRSKIIPERFFH------EKAVSGIHVSRSYLEPNMNPIDSEADHKKAIYFNSDIVLKPDLSTFRVLPWAEKT--GKVICDAYTIMGDSLLT-SPRYLAKQLLMQLQESGFSLHASFNYEFCIFGVAET---VDSKKVV--FPAATLVTDNDQLFLQELFDGMYYIGGNIESFCSSSTPGQMEISFQPEYGLTAADNAFTFRAALKEVAKKYGYISSFCN-DVGGIYNSGV-FSHSLWD--SSGTKNLFIDGNQIQELPDIGRKWLSGLLFHSAALSCLVAPGVSCRKHFAKGAKDPQESIGATYGFNDNSCSYNVKCHCSS--GTYIENKLCSAAANPYLVLAATVAAGLDGIRRGLDLFIDTNRKFSPHQFKMHSVPMKMEDALSALKEDRYIRAALGDVFIHYFIAVKQHELETE 454          
BLAST of Glutamine synthetase vs. Ensembl Mouse
Match: Lgsn (lengsin, lens protein with glutamine synthetase domain [Source:MGI Symbol;Acc:MGI:2672844])

HSP 1 Score: 166.007 bits (419), Expect = 1.829e-44
Identity = 127/431 (29.47%), Postives = 211/431 (48.96%), Query Frame = 2
Query:  170 DEVEFIQTITVDIHGFSRGKMFPREKLNDLFQNKEEVVGLLEVLGTRFEIPESLTELSENHYR------NILITPEKSSLRVAPWSKDSSLAMVFYDAYDKITNSPWPFNPRLLAKNKIKELEVMGMKLMIGVENEFRLFGK----GSRKPLTDSVQLLSQFHQATVVLPFARELKKVAKDFDIEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGMHINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAA-----ADWAPNNISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMIVAGIDGIKNKLDLFEAGNG-----FHCE--KLPKTLAESLEVLKQDKVLTEGLGPKFVDWYVKVKQ 1396
            + ++F++    D+HG SR K  P +     FQ  E+V+  + +     E+  +  +   NH R      +I++ PE S+ RV PW++ +  A V  D +  +T  P   +PR +AK ++++L+  G  L+     +F +FG      S+     +  LLS   Q     PF +EL +         +S++     GQ+EI      GI+  D  +  R   + VA R N  A+   L I     N   ++HS+W V   G +N+F        L+  GK WLAG+LKH+ ALS   +P VNC +R         D  P   +W Y+D S A+ +K     EK   IEN+L S+  N Y+ +A+ + AG+DG+++  D   AG+      +  E  ++P  + ++L  L+QD+ L + LG  F+ ++V +K+
Sbjct:  137 NHLQFVRFEATDLHGVSRSKSIPAQ----FFQ--EKVIHGVFMPRGYLELMPNPKDNEVNHIRATCFNSDIVLMPELSTFRVLPWAERT--ARVICDTF-TVTGEPLLTSPRYIAKRQLRQLQDAGFCLLSAFIYDFCIFGVPEVINSKTISFPASTLLSNHDQ-----PFMQELVEGLYQTGANVESFSSSTRPGQMEICFLPEFGISSADNAFTLRTGLQEVARRYNYIAS---LVIETGFCNSGILSHSIWDVG--GKTNMFCSGSGVERLTLTGKKWLAGLLKHSAALSCLMAPAVNCRKRYCKDSRDLKDSVPT--TWGYNDNSCALNIKCH--GEKGTQIENKLGSATANPYLVLAATVAAGLDGLQSS-DGAAAGSDESQDLYQPEPSEIPLKMEDALAALEQDECLKQALGETFIRYFVAMKK 543          
BLAST of Glutamine synthetase vs. UniProt/SwissProt
Match: sp|Q9UY99|GLN1A_PYRAB (Glutamine synthetase OS=Pyrococcus abyssi (strain GE5 / Orsay) OX=272844 GN=glnA PE=3 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 7.967e-48
Identity = 137/463 (29.59%), Postives = 223/463 (48.16%), Query Frame = 2
Query:  143 IMSNHTKLPDEVEFIQTITVDIHGFSRGKMFPREKLNDLFQNKEEVVGLLEVLGTRFEIPESLTELSENHYRNILITPEKSSLRVAPWSKDSSLAMVFYDAYDKITNSPWPFNPRLLAKNKIKELEVMGMKLMIGVENEFRLFGK-GSRKPLTDSVQLLSQFHQATVVLPFARELKKVAKDFDIEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGMHINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPNNISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMIVAGIDGIKNKLD--------LFEAGNG----FHCEKLPKTLAESLEVLKQDKVLTEGLGPKFVDW--YVKVKQETEVDLFKSVNI--HDVGLTELEFHKYFHL 1480
            + S  T+ P   +F+Q I VDI+G  +G   P  +L +  ++           G  F+   S+         +++   +  +    PW    ++A V+   Y      P+  +PR + K  I++L  MG+K  IG E EF LF K GS +     V                RE+ +    F +  +  + E G  Q EI  R  E +   D +  F+   K VA+   L+AT+M  PI     NGMH++ SLW    K   N+F   K E  LS+   H++ G+LKH +AL+A  +PTVN Y+R+     AP  ISW Y +RS  +RV     N  +  IE R P  + N Y A A++++AG+DGIK+K++        ++E   G       + LP +L E+L+ L++DKV+ E LG  + ++  Y + + E+ ++  ++ ++      +TE E  +YF +
Sbjct:    6 VKSGATRSP---KFVQLIFVDINGMPKGMEIPASRLQEAIED-----------GISFD-GSSVPGFQGIEDSDLIFKADPDTYVEVPWD---NVARVY--GYIYKDGKPYGADPRGVLKRVIEKLAEMGIKAYIGPEPEFYLFKKNGSWELEIPDVGGYFDILTLDKAKDIKREIAEYMPSFGLVPEVLHHEVGKAQHEIDFRYDEALKTADNIISFKYIVKAVAEVHGLYATFMPKPIYGMPGNGMHLHISLW----KEGENIF---KGEEGLSETALHFIGGLLKHAKALTAITNPTVNSYKRLVPGYEAPVYISWGYKNRSALIRVPAFWGNGAR--IEYRCPDPSANPYFAFAAILMAGLDGIKHKVEPFAYVEENVYEMDEGKRKELGIDTLPGSLGEALDELEKDKVVREALGEAYKNFIEYKRKEWESYLEYLEAKHLPKDTKRVTEWELERYFFI 439          
BLAST of Glutamine synthetase vs. UniProt/SwissProt
Match: sp|O58097|GLN1A_PYRHO (Glutamine synthetase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=glnA PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 1.926e-47
Identity = 133/452 (29.42%), Postives = 218/452 (48.23%), Query Frame = 2
Query:  176 VEFIQTITVDIHGFSRGKMFPREKLNDLFQNKEEVVGLLEVLGTRFEIPESLTELSENHYRNILITPEKSSLRVAPWSKDSSLAMVFYDAYDKITNSPWPFNPRLLAKNKIKELEVMGMKLMIGVENEFRLFGK-GSRKPLTDSVQLLSQFHQATVVLPFARELKKVAKDFDIEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGMHINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPNNISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMIVAGIDGIKNKLDLF------------EAGNGFHCEKLPKTLAESLEVLKQDKVLTEGLGPKFVDW--YVKVKQETEVDLFKSVNI--HDVGLTELEFHKYFHL 1480
            ++F+Q I VDI+G  +G   P  +L +  +            G  F+   S+         +++   + S+    PW    ++A V+   Y      P+  +PR + +  ++ LE +G+K+ IG E EF LF K GS +     V                RE+ +    F +  +  + E G  Q EI  R  E +   D +  F+   K VA+   L+AT+M  PI     NGMH++ SLW    K   N+F   K E  LS+   +++ G+LKH +AL+A  +PTVN Y+R+     AP  ISW Y +RS  +RV     N  +  IE R P  + N Y+A A++++AG+DGIK+K++ F            +       + LP+ L E+L+ L++DKV+ E LG  + ++  Y + + E  +D  ++ N+      +TE E  +YF +
Sbjct:   18 IKFVQLIFVDINGMPKGMEVPITRLEEAIEE-----------GIAFD-GSSVPGFQGIEDSDLVFKADPSTYVEVPWD---NVARVY--GYIYKDGKPYEADPRGVLRRTLERLEKLGIKVYIGPEPEFYLFKKNGSWELEIPDVGGYFDILTLDKAKDIKREIAEYMPYFGLTPEVLHHEVGKAQHEIDFRHDEALKTADNIVSFKYIVKAVAEMHGLYATFMPKPIYGMPGNGMHLHISLW----KDGENIF---KGEEGLSETALYFIGGLLKHAKALAAVTNPTVNSYKRLVPGYEAPVYISWGYKNRSALIRVPAFWGNGAR--IEYRCPDPSANSYLAFAAILMAGLDGIKHKIEPFAYVEENVYEMDEKRREEIGIDMLPENLGEALDELERDKVVKEALGGAYRNFVGYKRKEWEEYLDYLEAKNLPKDTKNVTEWELERYFFI 443          
BLAST of Glutamine synthetase vs. UniProt/SwissProt
Match: sp|Q05907|GLN1A_PYRFU (Glutamine synthetase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=glnA PE=3 SV=2)

HSP 1 Score: 173.711 bits (439), Expect = 2.615e-47
Identity = 138/467 (29.55%), Postives = 212/467 (45.40%), Query Frame = 2
Query:  143 IMSNHTKLPDEVEFIQTITVDIHGFSRGKMFPREKLNDLFQNKEEVVGLLEVLGTRFEIPESLTELSENHYRNILITPEKSSLRVAPWSKDSSLAMVFYDAYDKITNSPWPFNPRLLAKNKIKELEVMGMKLMIGVENEFRLFGK-GSRKPLTDSVQLLSQFHQATVVLPFARELKKVAKDFDIEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGMHINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPNNISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMIVAGIDGIKNKLDLF------------EAGNGFHCEKLPKTLAESLEVLKQDKVLTEGLGP--------KFVDWYVKVKQETEVDLFKSVNIHDVGLTELEFHKYFHL 1480
            I  +  K   +++F+Q + VDI+G  +G   P  +L +   +           G  F+   S+         +++   +  +    PW   + +    Y       N P+  +PR + K  ++ELE  G K  IG E EF LF K G+ +     V                RE+ +    F +  +  + E G  Q EI  R  E +   D +  F+  +K VA+   L+AT+M  P+     NGMH++ SLW    K   N+F     E  LS++  H++ GILKH +AL+A  +PTVN Y+R+  +  AP  ISW Y +RS  +RV       K   IE R P  + N Y A A+++ AG+DGIK+K+D F            E       E LP +L E+LE L++DKV+ E LG         K+ +W   ++   E  + K        +TE E  +YF L
Sbjct:    3 ISVSMNKFDSKIKFVQLVFVDINGMPKGMEIPASRLEEAVTD-----------GISFD-GSSVPGFQGIEDSDLVFKADPDTYVEVPWDNVARVYGFIYK-----DNKPYGADPRGILKRALEELEKEGYKAYIGPEPEFYLFKKNGTWELEIPDVGGYFDILTLDKARDIRREIAEYMPSFGLIPEVLHHEVGKAQHEIDFRYDEALKTADNIVSFKYITKAVAEMHGLYATFMPKPLFGFPGNGMHLHISLW----KDGENVF---MGEEGLSEIALHFIGGILKHAKALTAVTNPTVNSYKRLVPSYEAPVYISWGYRNRSALIRVPAFWG--KGARIEYRCPDPSANPYFAFAAVLKAGLDGIKHKIDPFAYVEENVYEMSEEKRKELGIETLPGSLGEALEELEKDKVVKEALGDAYKNFINYKWKEWESYLEYLEEKHMPKDTK----KVTEWELERYFFL 439          
BLAST of Glutamine synthetase vs. UniProt/SwissProt
Match: sp|A9ZPH9|GMAS_METMY (Glutamate--methylamine ligase OS=Methylovorus mays OX=184077 PE=1 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 2.541e-45
Identity = 127/448 (28.35%), Postives = 206/448 (45.98%), Query Frame = 2
Query:  176 VEFIQTITVDIHGFSRGKMFPREKLNDLFQNKEEVVGLLEVLGTRFEIPESLTELSENHYRNILITPEKSSLRVAPWSKDSSLAMVFYDAYDKITNSPWPFNPRLLAKNKIKELEVMGMKLMIGVENEFRLFGK---GSRKPLTDSVQL---LSQFHQATVVLPFARELKKVAKDFDIEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGMHINHSLWSVKDKGLSNLFWDSKNEN--SLSDVGKHWLAGILKHTRALSAFFSPTVNCYRR------VAAADWAPNNISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMIVAGIDGIKNKLD----------------LFEAGNGFHCEKLPKTLAESLEVLKQDKVLTEGLGPKFVDWYVKVKQETEVDLFKSVN 1429
            V+++    VDIHG ++ K  P   LND+        G   + GT    P            + +   E S+L + PW      A +  D +  +   P+ F+ R++ K +I  L   G  L  G+E EF L  K   G+  P  DS  L      +   T   PF  +L +   +  ++    + E  +GQ EI     + +   D   MF+  +  +A+ L +  ++M  P S    NGMH++ S+      G  +LF D  + +   LS +  H+L GIL H  AL+A  +PTVN Y+R      ++ A WAP  I++  ++RS  +R+           +E RLP  +CN Y+A A++I AG+DG+  +LD                L E G G     LP+ L E+L+ L+ D+V+ + +GP     +V++K+   VD  + V+
Sbjct:   16 VKYVLAQFVDIHGVAKVKSVPASHLNDILTTGAGFAGG-AIWGTGIA-PNG---------PDYMAIGELSTLSLIPWQP--GYARLVCDGH--VNGKPYEFDTRVVLKQQIARLAEKGWTLYTGLEPEFSLLKKDEHGAVHPFDDSDTLQKPCYDYKGITRHSPFLEKLTESLVEVGLDIYQIDHEDANGQFEINYTYADCLKSADDYIMFKMAASEIANELGIICSFMPKPFSNRPGNGMHMHMSI----GDGKKSLFQDDSDPSGLGLSKLAYHFLGGILAHAPALAAVCAPTVNSYKRLVVGRSLSGATWAPAYIAYGNNNRSTLVRIPYGR-------LELRLPDGSCNPYLATAAVIAAGLDGVARELDPGTGRDDNLYDYSLEQLAEFGIGI----LPQNLGEALDALEADQVIMDAMGPGLSKEFVELKRMEWVDYMRHVS 433          
BLAST of Glutamine synthetase vs. UniProt/SwissProt
Match: sp|P36687|GLN1A_PYRWO (Glutamine synthetase OS=Pyrococcus woesei OX=2262 GN=glnA PE=3 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 3.454e-45
Identity = 127/419 (30.31%), Postives = 192/419 (45.82%), Query Frame = 2
Query:  143 IMSNHTKLPDEVEFIQTITVDIHGFSRGKMFPREKLNDLFQNKEEVVGLLEVLGTRFEIPESLTELSENHYRNILITPEKSSLRVAPWSKDSSLAMVFYDAYDKITNSPWPFNPRLLAKNKIKELEVMGMKLMIGVENEFRLFGK-GSRKPLTDSVQLLSQFHQATVVLPFARELKKVAKDFDIEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGMHINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPNNISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMIVAGIDGIKNKLDLF------------EAGNGFHCEKLPKTLAESLEVLKQDKVLTEGLG 1360
            I  +  K   +++F+Q + VDI+G  +G   P  +L +   +           G  F+   S+         +++   +  +    PW   + +    Y       N P+  +PR + K  ++ELE  G K  IG E EF LF K G+ +     V                RE+ +    F +  +  + E G  Q EI  R  E +   D +  F+  +K VA+   L+AT+M  P+     NGMH++ SL     K   N+F     E  LS++  H++ GILKH +AL A  +PTVN Y+R+     AP  ISW Y +RS  +RV       K   IE R P  + N Y A A+++ AG+DGIK+K+D F            E       E LP +L E+LE L++DKV+ E LG
Sbjct:    3 ISVSMNKFDSKIKFVQLVFVDINGMPKGMEIPASRLEEAVTD-----------GISFD-GSSVPGFQGIEDSDLVFKADPDTYVEVPWDNVARVYGFIYK-----DNKPYGADPRGILKRALEELEKEGYKAYIGPEPEFYLFKKNGTWELEIPDVGGYFDILTLDKARDIRREIAEYMPSFGLIPEVLHHEVGKAQHEIDFRYDEALKTADNIVSFKYITKAVAEMHGLYATFMPKPLFGFPGNGMHLHISL----SKDGENVFM---GEEGLSEIALHFIGGILKHAKALIAVTNPTVNSYKRLVPGYEAPVYISWGYRNRSALIRVPAFWG--KGARIEYRCPDPSANPYFAFAAVLKAGLDGIKHKIDPFAYVEENVYEMSEEKRKELGIETLPGSLGEALEELEKDKVVKEALG 395          
BLAST of Glutamine synthetase vs. TrEMBL
Match: R7VIP4 (Gln-synt_C domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_219831 PE=3 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 1.681e-70
Identity = 145/424 (34.20%), Postives = 219/424 (51.65%), Query Frame = 2
Query:  170 DEVEFIQTITVDIHGFSRGKMFPREKLNDLFQNKEEVVGLLEVLGTRFEIPESLTELSENHYRNILITPEKSSLRVAPWSKDS--SLAMVFYD-AYDKITNSPWPFNPRLLAKNKIKELEVMGMKLMIGVENEFRLFGKGSRKPLTDSVQLLSQFHQATVVLPFARELKKVAKDFDIEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGMHINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPNNISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMIVAGIDGIKNKLDLFEAGNGFHCEKLPKTLAESLEVLKQDKVLTEGLGPKFVDWYVKVKQETEVDLFKSVNI 1432
            D+ +FI+    D HG SR +M PR  +    Q+   V   +  LG    +   L     N + N    P+  +LR  PW  D    +  +  D         P P  PR +AK +++ L  MG++L    E E  LF   + KP        + F Q +       E+  + K   ++ +S+ +EYG+ Q E+PL    GI   D +++FR   K +  +  + AT+MT P      NG H NHSLW+  D+   + F  + + + LS + + WL G++KH  AL A + PTVNCYRR+    WAPN   W  D+R  + RVK  ++     +IENR+PS+ACN Y+AIA+ I AGIDGI+       A +    +K P+TL E+LE L++DKV+T+ LG  F+ WYV +KQE E+    + ++
Sbjct:    9 DDFDFIRFCWSDTHGISRARMIPRRNVAKFMQSGVGVFQGILALGADSGLYIDLPH--NNGWPNSYAMPDLKTLRPIPWVNDGVHRVGQMLCDLTLPNTGGMPMPNCPRSMAKKQVERLRTMGLELYSSFETEMTLFDLATGKPKVPDAGFTTTF-QMSKEENLLMEIDDLLKAASVDVESYQIEYGASQFEMPLAPCFGIEPADMMFVFRNGLKEICHKRGVDATFMTKPCPSNICNGGHYNHSLWTAGDR--KSAFASADDSDGLSQIFRQWLGGLIKHAPALCAIYCPTVNCYRRLNQP-WAPNKADWGIDNRLPSFRVKVGSS----PFIENRIPSAACNPYLAIAATIAAGIDGIQTGSTCPPAMDP-SAQKFPRTLQEALEFLQEDKVMTDALGEPFMQWYVPMKQELEIKRLPNTDV 421          
BLAST of Glutamine synthetase vs. TrEMBL
Match: A0A5J4NYP7 (Gln-synt_C domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0002093 PE=3 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 3.057e-66
Identity = 156/487 (32.03%), Postives = 254/487 (52.16%), Query Frame = 2
Query:  149 SNHTKLP---DEVE---FIQTITVDIHGFSRGKMFPREKLNDLFQNKEEVVGLLEVLGTRFEI---PESLTELSENHYRNILITPEKSSLRVAPWS---KDSSLAMVFYDAYDKITNSPWPFNPRLLAKNKIKEL-EVMGMKLMIGVENEFRLF-GKGSRKPLT----------DSVQLLS-----------QFHQATVVLPFARELKKVAKDFDIEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGMHINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPNNISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMIVAGIDGIKNKLDLFEAGNGF----HCE----KLPKTLAESLEVLKQDKVLTEGLGPKFVDWYVKVKQETEVDLFKSVNIHDVGLTELEFHKYFHL 1480
            ++ T LP   DE+    F++    D++G    K+ P    + +  N  E+   +  +G RFEI   PE L +  EN Y    + P+ S+    PW+   ++ ++  +  +  +    +    +PR +A+  + EL +   ++L  G E EFR+F  +G ++             DSVQ  S           +    +V  PF  +L +  K   ++ + +  E+G+ Q+EIPL    GI   D  ++F++  + VA   N+  ++MT+PI  E A+G H NHSLW  K     N+ +D++N+  LS + ++W+ G++ H  AL+A  SPTVNCYRR    ++ P +I W+ +DR VA+RVK    +E + YIENRL SSA   Y  +A+ + AG+DGI+ KL+  + G        CE    KLPKTL E++E LK DK+L   LG +FVDW+++ KQ  ++     V+I       L + +Y +L
Sbjct:    8 TDETNLPAKEDELHRYNFVRLYLADMNGIQLSKVVPSRHADKILSNHCEIYSGVLQMGPRFEINLVPEILEKKHENGY----LVPDISTCHPCPWACRHQNINVCGIVCE-INWQDGTVVQGHPRTVARRLLSELAQKHNLELFSGFEPEFRVFRSEGFQEACAFPTANSSDKQDSVQFKSPKPYSNVFDMYRSGALSVYEPFLFDLDQQLKAARVDAEEFTHEHGTAQLEIPLIPQYGIRSADSYFIFKQAVREVAKGHNMRVSFMTMPILNEAASGCHFNHSLWDRKTG--RNVLFDAENDEKLSQLSRYWIGGLIAHMPALTALCSPTVNCYRRF-NGNFTPTSIDWDINDRFVALRVK--NVDENRTYIENRLCSSASCSYHVLAATVAAGMDGIERKLEPPKRGKKTVAEEGCEPDRLKLPKTLREAIESLKADKILVNRLGTQFVDWFIRTKQYGDLQTLADVDIESDSERILAYERYEYL 484          
BLAST of Glutamine synthetase vs. TrEMBL
Match: R7T6B1 (Gln-synt_C domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_171217 PE=3 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 4.617e-66
Identity = 135/420 (32.14%), Postives = 231/420 (55.00%), Query Frame = 2
Query:  179 EFIQTITVDIHGFSRGKMFPREKLNDLFQNKEEV-VGLLEVLGTRFEIPESLTELSENHYRNILITPEKSSLRVAPWS--KDSSLAMVFYDAYDKITNSPWPFNPRLLAKNKIKELEV-MGMKLMIGVENEFRLFGKGSRKPLTD-----SVQLLSQFHQATVVLPFARELKKVAKDFDIEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGMHINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPNNISWNYDDRSVAMRVKTSTANEKQN-YIENRLPSSACNIYIAIASMIVAGIDGIKNKLDLFEAGNGFHCEKLPKTLAESLEVLKQDKVLTEGLGPKFVDWYVKVKQETEV 1408
            ++++    D+HG SR K+ P+  +  ++++   V  G L   GTR E+P S  E+    + N+ + P+  +  V PW+  KD+ +A V  + Y   T      + R +A+  + +L+   G+K  +G E EF L    ++KP+ +     + +L+++F       PF  +++ +  +  ++ + +  EY SGQ E P     G+N VD  ++ ++  K ++      A +MT PI    ANG+H NHSLW   D   +N F+D K+E+ +S+  +HW+ GI KH +AL A   PT NCYRR+    WAP+  +W  D+R  + R K     +KQN Y+ENRLP+ + N Y+ +A+ I AG+DG++N+++   A N  +  ++  +L ++L  L+QD+VL E LG   V W+   K+  E+
Sbjct:   23 DYLRFTWTDMHGISRSKVVPKRHVQHMWEHGAIVFCGELSRFGTRSEVP-SHAEVIALEFGNMKVIPDPGTFHVVPWAGGKDARIAEVICEGYWIQTGKRHEVDTRHIARRMLDQLQSEFGLKCFMGWEYEFFLLDPKTQKPVYEGFDIYATELIAKFE------PFLCKVESMLANIGVDIEYYVSEYASGQFEFPTVPKFGLNAVDMGFLLKKGVKEMSALEGFKAAFMTQPIRDLAANGLHFNHSLW---DGAGNNAFFDCKSEDKMSETFRHWIGGIFKHFKALVALCCPTTNCYRRLYQP-WAPDTENWGIDNRMASFRAKNY---DKQNTYLENRLPTGSANPYLVVAATIAAGMDGLRNRIEP-PAQNDRNAPRVTGSLEKALVDLEQDEVLKEALGEVLVRWFTLEKRSIEI 427          
BLAST of Glutamine synthetase vs. TrEMBL
Match: A0A5J4NY10 (Gln-synt_C domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0002091 PE=3 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 8.031e-64
Identity = 156/490 (31.84%), Postives = 246/490 (50.20%), Query Frame = 2
Query:  149 SNHTKLPD------EVEFIQTITVDIHGFSRGKMFPREKLNDLFQNKEEVVGLLEVLGTRFEI---PESLTELSENHYRNILITPEKSSLRVAPWSKDSSLAMVFYDAYDKITNSPWP------FNPRLLAKNKIKEL-EVMGMKLMIGVENEFRLF-----------GKGSR---------KPLTDSVQLLSQFHQA--TVVLPFARELKKVAKDFDIEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGMHINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPNNISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMIVAGIDGIKNKLDLFEAGNGFHCE-----KLPK---TLAESLEVLKQDKVLTEGLGPKFVDWYVKVKQETEVDLFKSVNIHDVGLTELEFHKYFHL 1480
            +N    PD      + +F++ I+ D++G   GK+ P   +  +  N+ E+ G +  +G RFEI   PE L +  EN Y    + P+  +    PW+   S ++V       I    W        +PR +A+  + EL +   ++L  G E EFR+F              SR         KPL     L   +     +V  PF  +L    K  +++   +  EYGS Q+E PL    GI   D  ++F++  +  A   N+  ++MT P+  E ANG H NHSLW  +  G  N+ +D++N+++LS V  HW+ G++ H  AL+A  SPTVNCYRR    ++ P +I W+ +DR VA+RVK    +E + YIENRL SSA   Y  +A+ + AG+DGI+ KL+  E G     +      +PK   TL E+L  L+ D VL   LG +FVDW+++ KQ  ++     +++ +     L + +Y +L
Sbjct:    8 TNEAPFPDGSDKLKDYDFVRLISPDLNGIHLGKLVPTRHVRRILSNRCEIYGGILTMGPRFEIHMVPEILEKRHENGY----LVPDMVTCHPCPWASTQSNSLVC----GIICEMNWQDGTVIQGHPRTVARRLLSELAQKHNLQLFSGFEPEFRVFRPEGFQEACTVPTDSRHEEHESYLSKPLKPYSNLFDMYRCGALSVYEPFLIDLDHKLKAANVDVQDFMHEYGSSQLETPLMPQHGIQAADSYFIFKQAIRETAKLHNMAVSFMTKPLLNELANGCHYNHSLWD-RTTG-RNVLFDAQNDDNLSSVAMHWIGGLIAHMPALTALCSPTVNCYRRF-NGNFTPTSIDWDINDRFVALRVK--NVDENRTYIENRLCSSASCSYHVLAATVAAGMDGIERKLEPPERGKKTMADDERETDIPKLPTTLTEALTTLQADTVLINRLGVQFVDWFIRTKQHADLLTLSHIDVEEDSERMLAYERYEYL 484          
BLAST of Glutamine synthetase vs. TrEMBL
Match: A0A0B7BF42 (Gln-synt_C domain-containing protein OS=Arion vulgaris OX=1028688 GN=ORF179914 PE=3 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 8.204e-63
Identity = 140/432 (32.41%), Postives = 213/432 (49.31%), Query Frame = 2
Query:  170 DEVEFIQTITVDIHGFSRGKMFPREKLNDLFQNKEEVVGLLEVLGTRFEIPESLTELSENHYRNILITPEKSSLRVAPW--SKDSSLAMVFYDAYDKITNSPWPFNPRLLAKNKIKELEVMGMKLMIGVENEFRLFGKGSRKPLTDSVQLLSQFHQATVVLPFARELKKVAKDFDIEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGMHINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPNNISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMIVAGIDGIKNKLDLFEAGNGFHCEK-----------LPKTLAESLEVLKQDKVLTEGLGPKFVDWYVKVKQETEVDLFKSV 1426
            D+ + +     D+ G SRGK      +  L ++  E      VLG   E P +L   +        + P+ S+LR   W  S    +  V  D YD +       +PR +A  ++  L+ +G  +M   E E+ L+ KG+  PL    + L+   +    LPF  +         I  ++   E   GQIE  ++   GIN  D V   R  +K V D++    T+MT P     ++G H NHSLW++  K   N F+D  NEN  SD+ +HW+AG++ H  AL+A  +PTVNC+ R+      PN   WNY+DR   +RVK  + N    +IE R PSSACN Y+ +A ++ AG DGI  KL+  +    +  +K           LPKTL E+L+ L+QD +LT  +G  F+  YV + +E +++  K V
Sbjct:   34 DDYDAVLFTVCDVFGRSRGKFAFGPNIQQLVKHGLETAHTTCVLGFHSETPVTLPRYNRTKDTTCQMLPDISTLRPLSWLCSNGRKVGHVLCDLYD-LKGHHDISSPRAIALKQLNNLKDLGFVIMTAFEAEYILYHKGTLNPLGGDYKELTNMTRLDTDLPFLYDHMTELLASGIPVETQMEESVPGQIEYSMQPQYGINMADAVHRLRYITKSVCDKIGFTPTFMTKPKYVGDSSGFHFNHSLWTLDGK---NAFYDPTNENKCSDIIRHWIAGLIHHGPALTALMNPTVNCFERLHHM-LTPNYNIWNYNDRHARLRVKNKSKN---IHIEERTPSSACNPYLCLAGLVAAGADGIARKLEAPQP-QAYRPQKTDGDTVKVGDSLPKTLEEALQALEQDTILTRAIGEDFIQEYVALCKEFQLEKLKDV 456          
BLAST of Glutamine synthetase vs. Ensembl Cavefish
Match: lgsn (lengsin, lens protein with glutamine synthetase domain [Source:NCBI gene;Acc:103040170])

HSP 1 Score: 167.933 bits (424), Expect = 1.191e-44
Identity = 132/460 (28.70%), Postives = 215/460 (46.74%), Query Frame = 2
Query:   89 DRTVTINHMNCVYLYLFRIMSNHTKLPDEVEFIQTITVDIHGFSRGKMFPREKLNDLFQNKEEVVGLLEVLGTRFEIPESLTELS-------------ENHYRNILITPEKSSLRVAPWSKDSSLAMVFYDAYDKITNSPWPFNPRLLAKNKIKELEVMGMKLMIGVENEFRLFGK----GSRKPLTDSVQLLSQFHQATVVLPFARELKKVAKDFDIEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGM-HINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWA--PNNISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMIVAGIDGIKNKLDLFEAGNGFHCEK----LPKTLAESLEVLKQDKVLTEGLGPKFVDWYVKVKQ 1396
            D + T +H +  +LY   ++       + V F++    D+HG SR KM P       + +++ V G+         +P S  EL+              N   ++L+ P+ S+ RV PWS+ +  A V  D    +T  P   +PRL+AK  + +L+ MG  L      E  + G     G +     +  LLS        LPF ++L +       + D++    G GQ+EI  +   GI   D  + FR   K +A + N   T++T     ET N +  ++HSLW     G  +LF  S  E  LSD+GK WL G+L H+ ALS   +P + C  +++    +  P   +   +D S +  VK     E   +I+NRL S+  N YI +A+ I AG+DGIK  L + +  N    ++    +P  L ++LE L +D V+   LG  F+ +++ +K+
Sbjct:  224 DSSHTESHGSQNFLYELDLIKQQISR-ENVGFVRFEATDLHGVSRSKMVPAR-----YFHEKAVYGV--------PMPRSYLELTLSPKDNEVDHPSAANFSSDVLLVPDLSTFRVLPWSEQT--ARVICDPC-TVTGVPLRTSPRLIAKLMLGQLQSMGFSLHSSFTYECCILGAPERLGPKVVFFPATTLLSNHD-----LPFLQQLVRAMYHMGADVDNFASASGPGQMEICFKPKFGIEAADSAFTFRTGIKEMARKHNYIVTFLT----DETLNNLGQLSHSLWDAN--GRKSLFHSSTGE--LSDIGKKWLGGLLHHSPALSCLLAPGIGCRSQLSKGRDSKHPLYATCGCNDNSCSFNVKIHGGREM--HIDNRLGSAMANPYIVLAATIAAGLDGIKRNLSIEQGLNRAPNQQKQVVIPVKLEDALEALAEDAVIRGSLGEPFIQYFIAMKR 651          
BLAST of Glutamine synthetase vs. Ensembl Cavefish
Match: lgsn (lengsin, lens protein with glutamine synthetase domain [Source:NCBI gene;Acc:103040170])

HSP 1 Score: 168.318 bits (425), Expect = 1.329e-44
Identity = 132/460 (28.70%), Postives = 215/460 (46.74%), Query Frame = 2
Query:   89 DRTVTINHMNCVYLYLFRIMSNHTKLPDEVEFIQTITVDIHGFSRGKMFPREKLNDLFQNKEEVVGLLEVLGTRFEIPESLTELS-------------ENHYRNILITPEKSSLRVAPWSKDSSLAMVFYDAYDKITNSPWPFNPRLLAKNKIKELEVMGMKLMIGVENEFRLFGK----GSRKPLTDSVQLLSQFHQATVVLPFARELKKVAKDFDIEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGM-HINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWA--PNNISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMIVAGIDGIKNKLDLFEAGNGFHCEK----LPKTLAESLEVLKQDKVLTEGLGPKFVDWYVKVKQ 1396
            D + T +H +  +LY   ++       + V F++    D+HG SR KM P       + +++ V G+         +P S  EL+              N   ++L+ P+ S+ RV PWS+ +  A V  D    +T  P   +PRL+AK  + +L+ MG  L      E  + G     G +     +  LLS        LPF ++L +       + D++    G GQ+EI  +   GI   D  + FR   K +A + N   T++T     ET N +  ++HSLW     G  +LF  S  E  LSD+GK WL G+L H+ ALS   +P + C  +++    +  P   +   +D S +  VK     E   +I+NRL S+  N YI +A+ I AG+DGIK  L + +  N    ++    +P  L ++LE L +D V+   LG  F+ +++ +K+
Sbjct:  258 DSSHTESHGSQNFLYELDLIKQQISR-ENVGFVRFEATDLHGVSRSKMVPAR-----YFHEKAVYGV--------PMPRSYLELTLSPKDNEVDHPSAANFSSDVLLVPDLSTFRVLPWSEQT--ARVICDPC-TVTGVPLRTSPRLIAKLMLGQLQSMGFSLHSSFTYECCILGAPERLGPKVVFFPATTLLSNHD-----LPFLQQLVRAMYHMGADVDNFASASGPGQMEICFKPKFGIEAADSAFTFRTGIKEMARKHNYIVTFLT----DETLNNLGQLSHSLWDAN--GRKSLFHSSTGE--LSDIGKKWLGGLLHHSPALSCLLAPGIGCRSQLSKGRDSKHPLYATCGCNDNSCSFNVKIHGGREM--HIDNRLGSAMANPYIVLAATIAAGLDGIKRNLSIEQGLNRAPNQQKQVVIPVKLEDALEALAEDAVIRGSLGEPFIQYFIAMKR 685          
BLAST of Glutamine synthetase vs. Ensembl Nematostella
Match: EDO25869 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TDH3])

HSP 1 Score: 92.8189 bits (229), Expect = 5.592e-21
Identity = 74/294 (25.17%), Postives = 130/294 (44.22%), Query Frame = 2
Query:  374 PEKSSLRVAPWSKDSSLAMVFYDAYDKITNSPWPFNPRLLAKNKIKELEVMGMKLMIGVENEFRLFGK-----GSRKPLTDSVQLLSQFHQATVVL------PFARELKKVAKDFDIEFDSWNLEYGSGQIEIPL-RAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGMHINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPNNISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMI 1219
            P   SL + PW + +    +    +        P +PR +    I  L+  G   ++ VE EF L  K     G  +P   +  +  Q  Q   V       PF  +L    +   +   +   EY  GQ+E+ L   ++ +  VD+   ++   K VA++  + A +M  P   +  +GMH++ SL    D+  +NL   +  +   + + KH + G++       A F P  N YRR  A  +AP   SW  ++R+V+ RV    A  K  ++E+R+  +  N Y+A A+++
Sbjct:   11 PIPGSLTLQPW-RSTPTGQLQVSMHPTQGLPAAPADPRHVLVRAIDRLKADGYHPVMAVELEFYLLDKNRDANGRPQPALQANGVRPQAPQVYGVYELEQLQPFLDDLYSACEVQGLPVRTAISEYAPGQVELTLEHRFDALQAVDEGVRYKRLVKGVANKHGMQACFMAKPFGDQAGSGMHMHVSL---ADEHGNNLM--ASEDPHGTPLLKHAIGGMMATLNDALAIFCPNANSYRRFQANSYAPLAKSWGVNNRTVSFRVPGGPA--KSRHVEHRICGADANPYLAAAAIL 296          
BLAST of Glutamine synthetase vs. Ensembl Medaka
Match: lgsn (lengsin, lens protein with glutamine synthetase domain [Source:NCBI gene;Acc:101162898])

HSP 1 Score: 156.377 bits (394), Expect = 1.087e-40
Identity = 119/433 (27.48%), Postives = 202/433 (46.65%), Query Frame = 2
Query:  170 DEVEFIQTITVDIHGFSRGKMFPREKLNDLFQNKEEVVGLLEVLGTRFEIPESLTELS-------------ENHYRNILITPEKSSLRVAPWSKDSSLAMVFYDAYDKITNSPWPFNPRLLAKNKIKELEVMGMKLMIGVENEFRLFGK----GSRKPLTDSVQLLSQFHQATVVLPFARELKKVAKDFDIEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGMHINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPNNI---SWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMIVAGIDGIKNKL----DLFEAGNGFHCEKLPKTLAESLEVLKQDKVLTEGLGPKFVDWYVKVKQ 1396
            + + F++    D+HG SR K  P    ++     + V G+         +P S  EL+              N   ++L+ P+ S+ ++ PW++ +  A V  D    +T SP   +PRL+AK  + +L+ +G  L      E  + G     G +  L  +  LLS        LPF ++L         + DS     G GQ+EI LR   GI+  D  + FR   K +A +L+  A++ T        N   ++HSLW     G  +LF   +    LS++G+ WLAG+L H+ ALS   SP + C   +A     P  +   +   +D S +  +K+    E   +++N+L S+  N YI +A+ + AG+DGI+  L     L +A +      +P  + ++LE L++D V+   LG  FV +++ +K+
Sbjct:  212 ENINFVRFEATDLHGVSRSKTVPVRHFHE-----KAVYGV--------PMPRSYLELTLSPKSNEVDHASTANFSSDVLLIPDLSTFKLLPWAEQT--ARVICDPC-TVTGSPLWTSPRLIAKQLLGQLQSLGFSLHSSFTYECCVLGAPERIGPKTLLFPATTLLSNHD-----LPFFQQLVDSMYCMGADIDSIASASGPGQMEINLRPEFGISAADSAFTFRTGIKEMARKLSYIASFFT---DDGLYNAGVLSHSLWDAN--GRRSLFHGGEKPGELSEIGRKWLAGLLTHSAALSCLMSPGLGCRNHMAKTIKDPKRLLYATCGCNDNSSSFNIKSHGGRE--THVDNKLGSAMANPYIVLAATVAAGLDGIRRNLTVESSLTKAPSQQKDFSIPIKMDDALEALEEDHVIRSALGEPFVQYFIAMKK 616          
BLAST of Glutamine synthetase vs. Planmine SMEST
Match: SMESG000003831.1 (SMESG000003831.1)

HSP 1 Score: 946.421 bits (2445), Expect = 0.000e+0
Identity = 456/456 (100.00%), Postives = 456/456 (100.00%), Query Frame = 2
Query:  113 MNCVYLYLFRIMSNHTKLPDEVEFIQTITVDIHGFSRGKMFPREKLNDLFQNKEEVVGLLEVLGTRFEIPESLTELSENHYRNILITPEKSSLRVAPWSKDSSLAMVFYDAYDKITNSPWPFNPRLLAKNKIKELEVMGMKLMIGVENEFRLFGKGSRKPLTDSVQLLSQFHQATVVLPFARELKKVAKDFDIEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGMHINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPNNISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMIVAGIDGIKNKLDLFEAGNGFHCEKLPKTLAESLEVLKQDKVLTEGLGPKFVDWYVKVKQETEVDLFKSVNIHDVGLTELEFHKYFHL 1480
            MNCVYLYLFRIMSNHTKLPDEVEFIQTITVDIHGFSRGKMFPREKLNDLFQNKEEVVGLLEVLGTRFEIPESLTELSENHYRNILITPEKSSLRVAPWSKDSSLAMVFYDAYDKITNSPWPFNPRLLAKNKIKELEVMGMKLMIGVENEFRLFGKGSRKPLTDSVQLLSQFHQATVVLPFARELKKVAKDFDIEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGMHINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPNNISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMIVAGIDGIKNKLDLFEAGNGFHCEKLPKTLAESLEVLKQDKVLTEGLGPKFVDWYVKVKQETEVDLFKSVNIHDVGLTELEFHKYFHL
Sbjct:    1 MNCVYLYLFRIMSNHTKLPDEVEFIQTITVDIHGFSRGKMFPREKLNDLFQNKEEVVGLLEVLGTRFEIPESLTELSENHYRNILITPEKSSLRVAPWSKDSSLAMVFYDAYDKITNSPWPFNPRLLAKNKIKELEVMGMKLMIGVENEFRLFGKGSRKPLTDSVQLLSQFHQATVVLPFARELKKVAKDFDIEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGMHINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPNNISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMIVAGIDGIKNKLDLFEAGNGFHCEKLPKTLAESLEVLKQDKVLTEGLGPKFVDWYVKVKQETEVDLFKSVNIHDVGLTELEFHKYFHL 456          
BLAST of Glutamine synthetase vs. Planmine SMEST
Match: SMESG000003831.1 (SMESG000003831.1)

HSP 1 Score: 922.539 bits (2383), Expect = 0.000e+0
Identity = 445/445 (100.00%), Postives = 445/445 (100.00%), Query Frame = 2
Query:  146 MSNHTKLPDEVEFIQTITVDIHGFSRGKMFPREKLNDLFQNKEEVVGLLEVLGTRFEIPESLTELSENHYRNILITPEKSSLRVAPWSKDSSLAMVFYDAYDKITNSPWPFNPRLLAKNKIKELEVMGMKLMIGVENEFRLFGKGSRKPLTDSVQLLSQFHQATVVLPFARELKKVAKDFDIEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGMHINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPNNISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMIVAGIDGIKNKLDLFEAGNGFHCEKLPKTLAESLEVLKQDKVLTEGLGPKFVDWYVKVKQETEVDLFKSVNIHDVGLTELEFHKYFHL 1480
            MSNHTKLPDEVEFIQTITVDIHGFSRGKMFPREKLNDLFQNKEEVVGLLEVLGTRFEIPESLTELSENHYRNILITPEKSSLRVAPWSKDSSLAMVFYDAYDKITNSPWPFNPRLLAKNKIKELEVMGMKLMIGVENEFRLFGKGSRKPLTDSVQLLSQFHQATVVLPFARELKKVAKDFDIEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGMHINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPNNISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMIVAGIDGIKNKLDLFEAGNGFHCEKLPKTLAESLEVLKQDKVLTEGLGPKFVDWYVKVKQETEVDLFKSVNIHDVGLTELEFHKYFHL
Sbjct:    1 MSNHTKLPDEVEFIQTITVDIHGFSRGKMFPREKLNDLFQNKEEVVGLLEVLGTRFEIPESLTELSENHYRNILITPEKSSLRVAPWSKDSSLAMVFYDAYDKITNSPWPFNPRLLAKNKIKELEVMGMKLMIGVENEFRLFGKGSRKPLTDSVQLLSQFHQATVVLPFARELKKVAKDFDIEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGMHINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPNNISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMIVAGIDGIKNKLDLFEAGNGFHCEKLPKTLAESLEVLKQDKVLTEGLGPKFVDWYVKVKQETEVDLFKSVNIHDVGLTELEFHKYFHL 445          
BLAST of Glutamine synthetase vs. Planmine SMEST
Match: SMESG000003829.1 (SMESG000003829.1)

HSP 1 Score: 547.74 bits (1410), Expect = 0.000e+0
Identity = 264/442 (59.73%), Postives = 336/442 (76.02%), Query Frame = 2
Query:  164 LPDEVEFIQTITVDIHGFSRGKMFPREKLNDLFQNKEEVVGLLEVLGTRFEIPESLTELSENHYRNILITPEKSSLRVAPWSKDSSLAMVFYDAYDKITNSPWPFNPRLLAKNKIKELEVMGMKLMIGVENEFRLFGKGSRKPLTDSVQLLSQFHQATVVLPFARELKKVAKDFDIEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGMHINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPNNISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMIVAGIDGIKNKLDLFEAGNGFHCEKLPKTLAESLEVLKQDKVLTEGLGPKFVDWYVKVKQETEVDLFKSVNIH---DVGLTELEFHKYFHL 1480
            +P EV+FIQ I +DI+G SRGK+FP  KL+DL + KEE++ ++ ++GT  EI  S+ E+S  HY N  +  +KS++RVAPWS+D SLAMVF D YD++ NSP P NPRLLAK KI ELE M +KL+IG+ENEFR+F K  +K + +S++  SQFHQ T    + +EL K  K  DI  DSWN E GSGQIEIPL + EGI G+DK WMF+E SKYVAD++ L A+YMT+PI  E+ NG HINHSLW+  +KG +N  W+ +  + LS++GK+WLAGILKH+R LSA +SPTVNCYRR+ +A +AP+ ISWNY DRSVAMRVKTS   EK NYIENR+PSSACNIY+A+A MIVAGIDGIKNKL L E GNG HCE+LP TL+E+L  LK DKVL EGLG KFVDWYVKVK+ET+V + K  ++H   + G+++ EF KYF +
Sbjct:   10 VPPEVQFIQVIHIDINGISRGKVFPIGKLSDLLRKKEEIICIIGMIGTNSEIISSIKEIS--HYENARLVLDKSTIRVAPWSQDCSLAMVFADVYDRVGNSPLPINPRLLAKCKINELEAMDLKLVIGIENEFRIFNKTDKKFVQNSMKHYSQFHQITESYSYIKELNKDLKKCDILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAESGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMIVAGIDGIKNKLQLPEHGNGSHCERLPTTLSEALSALKDDKVLVEGLGAKFVDWYVKVKEETDVKVLKDSDLHNNTEEGISQ-EFIKYFDI 448          
BLAST of Glutamine synthetase vs. Planmine SMEST
Match: SMESG000003836.1 (SMESG000003836.1)

HSP 1 Score: 542.347 bits (1396), Expect = 0.000e+0
Identity = 246/441 (55.78%), Postives = 330/441 (74.83%), Query Frame = 2
Query:  164 LPDEVEFIQTITVDIHGFSRGKMFPREKLNDLFQNKEEVVGLLEVLGTRFEIPESLTELSENHYRNILITPEKSSLRVAPWSKDSSLAMVFYDAYDKITNSPWPFNPRLLAKNKIKELEVMGMKLMIGVENEFRLFGKGSRKPLTDSVQLLSQFHQATVVLPFARELKKVAKDFDIEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGMHINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPNNISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMIVAGIDGIKNKLDLFEAGNGFHCEKLPKTLAESLEVLKQDKVLTEGLGPKFVDWYVKVKQETEVDLFKSVNIHDVGLTEL--EFHKYFHL 1480
            L   VEFIQ ITVDI+G +RGK++P EKL+DL + K+EVVGLLE+LGT+ EIP++++EL+ NH+ N L+ P+++S+R  PWS DSSLAM FYD YD++ N PWPFNPRL A+ ++ ELE MG K  IGVENEFRLF K +RKP T  +    QF Q+T  LP+ + L K+ K  +IE DSW+LEYG GQIE+PL+ Y G+ GVD  W F+E SKYVA+   + A+YM +P++++  NG+HINHSLW   ++  +N  W   +++ +S++ +HWLAG+LKH++AL AFF+PTVNCYRR+  A+WAPN ISWNY DR+VA RVK S+  EK NYIENRLPSSACNIY+AIA MIVAGIDGIKNK+ L +  N FH E LP++L E+L+ L +D+VL  G+G KF+DW++K K ET+V + ++V++       L  EF KYF+L
Sbjct:   10 LSKNVEFIQAITVDINGIARGKVYPVEKLSDLLEGKQEVVGLLEILGTKSEIPQTISELTRNHFENELLVPDQTSIRGCPWSDDSSLAMFFYDTYDRVKNVPWPFNPRLAARKQLNELEKMGFKFFIGVENEFRLFDKHTRKPFTQEICFDHQFTQSTTALPYMKGLCKILKRMNIEMDSWHLEYGLGQIEVPLKVYSGMEGVDNAWFFKELSKYVANDFGMIASYMCVPLARDAGNGLHINHSLWIKTNESFTNAMWAKSDKDEMSEIAQHWLAGLLKHSKALCAFFNPTVNCYRRILMANWAPNKISWNYRDRTVAFRVKASSNQEKVNYIENRLPSSACNIYLAIAGMIVAGIDGIKNKIKLPDPANIFHGEDLPRSLPEALDELSKDQVLINGMGEKFIDWFIKAKLETDVFVLRNVDLESQTEEALQQEFDKYFNL 450          
BLAST of Glutamine synthetase vs. Planmine SMEST
Match: SMESG000003832.1 (SMESG000003832.1)

HSP 1 Score: 476.093 bits (1224), Expect = 4.768e-165
Identity = 231/441 (52.38%), Postives = 313/441 (70.98%), Query Frame = 2
Query:  164 LPDEVEFIQTITVDIHGFSRGKMFPREKLNDLFQNKEEVVGLLEVLGTRFEIPESLTELSENHYRNILITPEKSSLRVAPWSKDSSLAMVFYDAYDKITNSPWPFNPRLLAKNKIKELEVMGMKLMIGVENEFRLFGKGSRKPLTDSVQLLSQFHQATVVLPFARELKKVAKDFDIEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGMHINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPNNISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMIVAGIDGIKNKLDLFEAGNGFHCEKLPKTLAESLEVLKQDKVLTEGLGPKFVDWYVKVKQETEVDLFKSVNIHDVGLT--ELEFHKYFHL 1480
            L  +++FIQ + VDI+G  RGKMF  EKL DL  N+EE+  L+++ GT  E+P+S+ + S     N+++ P++ +L++ PW K+S++ MVF D YDK T  P PFNPRL+ KNK++EL  +G +++IGVE+EF LF K S++P          F Q T+ LP+A  +++ A +  IEF+S+NLE G GQIE PL AY GI  VDKVW+F+E SKYVA+ L L A+YMT P++ + ANGMHINHSLW   D    N+F +S  EN LS++GKHWLAG+LKH++ALS  FSPTVNCYRR+ AA      I+WNY DR VAMRVK S   EK N+IENRLPSSA NIY+A+A MIVAG+DGIKN L+L    N  + EKLP++L+E+LE+ + DKVL EGLG  FVD+++K K +T+V++ K V+I+D+     + E  KYFHL
Sbjct:   14 LSQKIQFIQAVVVDINGIGRGKMFSIEKLADLMNNREEITYLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNSKEPFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPTVNCYRRIRAAVDTTKEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIVAGMDGIKNGLELPPINNT-NSEKLPESLSEALEIFQADKVLVEGLGKDFVDFFIKSKFDTDVNILKDVDINDITPNGFQKEKEKYFHL 453          
The following BLAST results are available for this feature:
BLAST of Glutamine synthetase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
LGSN7.280e-4027.57lengsin, lens protein with glutamine synthetase do... [more]
back to top
BLAST of Glutamine synthetase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gln-32.444e-723.47Glutamine synthetase [Source:UniProtKB/TrEMBL;Acc... [more]
gln-32.493e-723.47Glutamine synthetase [Source:UniProtKB/TrEMBL;Acc... [more]
gln-32.493e-723.47Glutamine synthetase [Source:UniProtKB/TrEMBL;Acc... [more]
gln-32.493e-723.47Glutamine synthetase [Source:UniProtKB/TrEMBL;Acc... [more]
gln-32.667e-723.47Glutamine synthetase [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of Glutamine synthetase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamine synthetase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lgsn1.679e-4027.94lengsin, lens protein with glutamine synthetase do... [more]
back to top
BLAST of Glutamine synthetase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pkn23.570e-4528.57protein kinase N2 [Source:Xenbase;Acc:XB-GENE-9952... [more]
avpr1b1.169e-4328.34arginine vasopressin receptor 1B [Source:Xenbase;A... [more]
back to top
BLAST of Glutamine synthetase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Lgsn1.829e-4429.47lengsin, lens protein with glutamine synthetase do... [more]
back to top
BLAST of Glutamine synthetase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UY99|GLN1A_PYRAB7.967e-4829.59Glutamine synthetase OS=Pyrococcus abyssi (strain ... [more]
sp|O58097|GLN1A_PYRHO1.926e-4729.42Glutamine synthetase OS=Pyrococcus horikoshii (str... [more]
sp|Q05907|GLN1A_PYRFU2.615e-4729.55Glutamine synthetase OS=Pyrococcus furiosus (strai... [more]
sp|A9ZPH9|GMAS_METMY2.541e-4528.35Glutamate--methylamine ligase OS=Methylovorus mays... [more]
sp|P36687|GLN1A_PYRWO3.454e-4530.31Glutamine synthetase OS=Pyrococcus woesei OX=2262 ... [more]
back to top
BLAST of Glutamine synthetase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7VIP41.681e-7034.20Gln-synt_C domain-containing protein OS=Capitella ... [more]
A0A5J4NYP73.057e-6632.03Gln-synt_C domain-containing protein OS=Paragonimu... [more]
R7T6B14.617e-6632.14Gln-synt_C domain-containing protein OS=Capitella ... [more]
A0A5J4NY108.031e-6431.84Gln-synt_C domain-containing protein OS=Paragonimu... [more]
A0A0B7BF428.204e-6332.41Gln-synt_C domain-containing protein OS=Arion vulg... [more]
back to top
BLAST of Glutamine synthetase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lgsn1.191e-4428.70lengsin, lens protein with glutamine synthetase do... [more]
lgsn1.329e-4428.70lengsin, lens protein with glutamine synthetase do... [more]
back to top
BLAST of Glutamine synthetase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamine synthetase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamine synthetase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO258695.592e-2125.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glutamine synthetase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lgsn1.087e-4027.48lengsin, lens protein with glutamine synthetase do... [more]
back to top
BLAST of Glutamine synthetase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003831.10.000e+0100.00SMESG000003831.1[more]
SMESG000003831.10.000e+0100.00SMESG000003831.1[more]
SMESG000003829.10.000e+059.73SMESG000003829.1[more]
SMESG000003836.10.000e+055.78SMESG000003836.1[more]
SMESG000003832.14.768e-16552.38SMESG000003832.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014151 ID=SMED30014151|Name=Glutamine synthetase|organism=Schmidtea mediterranea sexual|type=transcript|length=1576bp
AAAATTTGTTATTGGATTTTCACTTTCAATATTTAATCATTAAACCAATG
TGCATCTCTCTCTCTCTCTATCATTTAACTCGAACCTTGACCGAACTGTT
ACTATAAATCATATGAATTGTGTTTATTTGTATTTGTTCAGAATTATGTC
AAATCATACTAAACTACCGGACGAGGTCGAATTTATTCAAACAATAACTG
TGGATATTCATGGATTTTCTAGAGGAAAAATGTTTCCTAGAGAAAAACTA
AATGATTTATTTCAAAATAAAGAAGAAGTAGTCGGCCTGCTGGAAGTCCT
GGGAACAAGATTTGAAATACCTGAATCTCTCACAGAATTATCAGAAAACC
ATTATAGAAACATTCTCATAACTCCAGAGAAGTCTAGTTTAAGAGTGGCA
CCTTGGAGTAAAGATTCGTCATTGGCAATGGTTTTCTATGATGCGTATGA
TAAAATAACAAATTCACCTTGGCCTTTTAATCCTCGGTTATTAGCAAAAA
ATAAAATAAAAGAACTAGAAGTAATGGGTATGAAGCTAATGATTGGGGTT
GAAAACGAATTCAGGCTGTTTGGTAAAGGAAGTAGAAAACCTTTGACGGA
TTCTGTGCAGTTGTTAAGCCAATTTCATCAAGCTACAGTTGTCCTACCCT
TTGCTAGAGAATTAAAGAAAGTAGCGAAAGATTTCGATATCGAATTCGAT
AGTTGGAATTTGGAATATGGTTCTGGTCAAATAGAAATCCCTTTGAGAGC
TTATGAAGGAATAAATGGGGTTGACAAAGTATGGATGTTTCGAGAAACAT
CAAAATACGTTGCGGACAGACTAAACCTGCATGCTACGTATATGACTTTG
CCAATTAGTAAAGAAACTGCCAACGGTATGCATATTAATCACTCATTATG
GTCAGTAAAAGATAAAGGCCTTTCAAATTTATTTTGGGACTCAAAGAATG
AAAATTCTTTATCAGATGTAGGTAAACACTGGCTCGCCGGAATTTTAAAA
CACACAAGGGCGCTCAGTGCTTTCTTTTCCCCAACAGTCAACTGCTACCG
TCGGGTGGCCGCGGCAGATTGGGCTCCTAATAATATTTCATGGAATTACG
ATGACAGGTCTGTTGCAATGAGAGTCAAAACCTCAACAGCAAATGAAAAA
CAAAATTATATTGAAAACCGACTTCCAAGTTCAGCTTGTAACATTTATAT
AGCTATTGCTAGCATGATTGTTGCCGGAATCGACGGAATTAAAAACAAAT
TAGATCTTTTTGAGGCCGGAAACGGATTCCATTGTGAGAAGTTACCAAAG
ACTCTAGCTGAATCTCTTGAAGTTCTTAAGCAAGATAAAGTATTGACTGA
AGGATTGGGACCTAAATTTGTTGATTGGTATGTAAAGGTCAAACAAGAGA
CGGAAGTCGATTTGTTTAAATCAGTGAACATTCACGATGTTGGTCTGACC
GAATTAGAGTTCCATAAATATTTTCATCTGTGAGTTCCAATATGAAAGAA
TTCATGGATAATTTAATTTGTCCAATTTCATGAATTAAAACAATCAATTA
GCACAATTTTGGCAACTATAAATATG
back to top

protein sequence of SMED30014151-orf-1

>SMED30014151-orf-1 ID=SMED30014151-orf-1|Name=SMED30014151-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=457bp
MNCVYLYLFRIMSNHTKLPDEVEFIQTITVDIHGFSRGKMFPREKLNDLF
QNKEEVVGLLEVLGTRFEIPESLTELSENHYRNILITPEKSSLRVAPWSK
DSSLAMVFYDAYDKITNSPWPFNPRLLAKNKIKELEVMGMKLMIGVENEF
RLFGKGSRKPLTDSVQLLSQFHQATVVLPFARELKKVAKDFDIEFDSWNL
EYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISK
ETANGMHINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRA
LSAFFSPTVNCYRRVAAADWAPNNISWNYDDRSVAMRVKTSTANEKQNYI
ENRLPSSACNIYIAIASMIVAGIDGIKNKLDLFEAGNGFHCEKLPKTLAE
SLEVLKQDKVLTEGLGPKFVDWYVKVKQETEVDLFKSVNIHDVGLTELEF
HKYFHL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0016874ligase activity
GO:0046872metal ion binding
GO:0004356glutamate-ammonia ligase activity
GO:0003824catalytic activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR008146Gln_synth_cat_dom
IPR008147Gln_synt_b-grasp
IPR014746Gln_synth/guanido_kin_cat_dom
Vocabulary: biological process
TermDefinition
GO:0006807nitrogen compound metabolic process
GO:0006542glutamine biosynthetic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008146Glutamine synthetase, catalytic domainSMARTSM01230Gln_synt_C_2coord: 16..267
e-value: 6.7E-65
score: 231.6
IPR008146Glutamine synthetase, catalytic domainPFAMPF00120Gln-synt_Ccoord: 18..332
e-value: 5.7E-76
score: 255.7
NoneNo IPR availableGENE3DG3DSA:3.30.590.10coord: 13..342
e-value: 9.4E-88
score: 296.1
NoneNo IPR availablePANTHERPTHR43407:SF1LENGSINcoord: 2..349
NoneNo IPR availablePANTHERPTHR43407FAMILY NOT NAMEDcoord: 2..349
IPR014746Glutamine synthetase/guanido kinase, catalytic domainSUPERFAMILYSSF55931Glutamine synthetase/guanido kinasecoord: 16..349