Ras-related protein Rab-3

Overview
NameRas-related protein Rab-3
Smed IDSMED30014149
Length (bp)976
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ras-related protein Rab-3 (SMED30014149) t-SNE clustered cells

Violin plots show distribution of expression levels for Ras-related protein Rab-3 (SMED30014149) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ras-related protein Rab-3 (SMED30014149) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ras-related protein Rab-3 (SMED30014149) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014149

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30014149SMESG000034019.1 SmedASXL_001374SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30014149SMESG000034019.1 dd_Smed_v4_5920_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30014149SMESG000034019.1 dd_Smed_v4_5920_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30014149SMESG000034019.1 dd_Smed_v6_5920_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30014149SMESG000034019.1 OX_Smed_1.0.05429ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ras-related protein Rab-3 vs. Ensembl Human
Match: RAB3C (RAB3C, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:30269])

HSP 1 Score: 337.806 bits (865), Expect = 8.137e-117
Identity = 162/207 (78.26%), Postives = 180/207 (86.96%), Query Frame = 2
Query:  113 TDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPNDCQC 733
            +DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKT+ + +K++KLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDW TQIKTYSWDNAQV+LVGNK D++ ERVIS +RG+ L  QLG EFFETSAK+N++VK  FERLVDIICDKMSESL+TDP+I     + TRL +      PN C C
Sbjct:   23 SDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAIT-AAKQNTRLKETPPPPQPN-CAC 227          
BLAST of Ras-related protein Rab-3 vs. Ensembl Human
Match: RAB3B (RAB3B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9778])

HSP 1 Score: 333.183 bits (853), Expect = 4.005e-115
Identity = 159/207 (76.81%), Postives = 181/207 (87.44%), Query Frame = 2
Query:  113 TDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPNDCQC 733
            +DQNFDYMFKLLIIGNSSVGKTSFLFRYADD+FT AFVSTVGIDFKVKT+ R +K+VKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDW TQIKTYSWDNAQV+LVGNK D++ ERV+  ++G+ LA QLG +FFE SAKEN+ V+  FERLVD ICDKMS+SLDTDPS++ + +K TRL+D T   L  +C C
Sbjct:   15 SDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTVYRHEKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNAQVILVGNKCDMEEERVVPTEKGQLLAEQLGFDFFEASAKENISVRQAFERLVDAICDKMSDSLDTDPSMLGS-SKNTRLSD-TPPLLQQNCSC 219          
BLAST of Ras-related protein Rab-3 vs. Ensembl Human
Match: RAB3A (RAB3A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9777])

HSP 1 Score: 332.798 bits (852), Expect = 7.009e-115
Identity = 160/208 (76.92%), Postives = 180/208 (86.54%), Query Frame = 2
Query:  113 TDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPN-DCQC 733
            +DQNFDYMFK+LIIGNSSVGKTSFLFRYADDSFT AFVSTVGIDFKVKTI R DK++KLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDW TQIKTYSWDNAQV+LVGNK D++ ERV+S +RGRQLA  LG EFFE SAK+N++VK  FERLVD+IC+KMSESLDT    V    +G +L+D+  +  P+ DC C
Sbjct:   15 SDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQ--QVPPHQDCAC 220          
BLAST of Ras-related protein Rab-3 vs. Ensembl Human
Match: RAB3D (RAB3D, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9779])

HSP 1 Score: 311.612 bits (797), Expect = 1.491e-106
Identity = 150/207 (72.46%), Postives = 170/207 (82.13%), Query Frame = 2
Query:  113 TDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPNDCQC 733
             DQNFDYMFKLL+IGNSSVGKTSFLFRYADDSFT AFVSTVGIDFKVKT+ R DK++KLQIWDTAGQERYRTITTAYYRGAMGF+LMYDI N+ESF AVQDW TQIKTYSWDNAQV+LVGNK DL+ ERV+  + GR+LA  LG EFFE SAKEN++VK VFERLVD+IC+KM+ESL  +PS  +  N       +     P+ C C
Sbjct:   15 ADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLVDVICEKMNESL--EPSSSSGSNGKGPAVGDAPAPQPSSCSC 219          
BLAST of Ras-related protein Rab-3 vs. Ensembl Human
Match: RAB3D (RAB3D, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9779])

HSP 1 Score: 311.612 bits (797), Expect = 1.491e-106
Identity = 150/207 (72.46%), Postives = 170/207 (82.13%), Query Frame = 2
Query:  113 TDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPNDCQC 733
             DQNFDYMFKLL+IGNSSVGKTSFLFRYADDSFT AFVSTVGIDFKVKT+ R DK++KLQIWDTAGQERYRTITTAYYRGAMGF+LMYDI N+ESF AVQDW TQIKTYSWDNAQV+LVGNK DL+ ERV+  + GR+LA  LG EFFE SAKEN++VK VFERLVD+IC+KM+ESL  +PS  +  N       +     P+ C C
Sbjct:   15 ADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLVDVICEKMNESL--EPSSSSGSNGKGPAVGDAPAPQPSSCSC 219          
BLAST of Ras-related protein Rab-3 vs. Ensembl Celegans
Match: rab-3 (Ras-related protein Rab-3 [Source:UniProtKB/Swiss-Prot;Acc:Q94986])

HSP 1 Score: 345.895 bits (886), Expect = 2.755e-120
Identity = 169/214 (78.97%), Postives = 184/214 (85.98%), Query Frame = 2
Query:   95 SANSKDTDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRL-ADETNKALPNDCQC 733
             A     DQNFDYMFKLLIIGNSSVGKTSFLFRY DDSFTSAFVSTVGIDFKVKT+ R DK+VKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFN+VQDW TQIKTYSW+NAQVVLVGNK D+D ERV+S+DRGRQLA QLGLEFFETSAKEN++VK+VFE+LV+IICDKM+ESLD DP     P KG +L A+ T K     C C
Sbjct:   23 GATPGQPDQNFDYMFKLLIIGNSSVGKTSFLFRYCDDSFTSAFVSTVGIDFKVKTVFRGDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNSVQDWCTQIKTYSWENAQVVLVGNKCDMDSERVVSMDRGRQLADQLGLEFFETSAKENINVKAVFEKLVEIICDKMAESLDKDPQ--QQP-KGQKLEANPTQKPAQQQCNC 233          
BLAST of Ras-related protein Rab-3 vs. Ensembl Celegans
Match: rab-3 (Ras-related protein Rab-3 [Source:UniProtKB/Swiss-Prot;Acc:Q94986])

HSP 1 Score: 344.739 bits (883), Expect = 4.043e-120
Identity = 169/214 (78.97%), Postives = 184/214 (85.98%), Query Frame = 2
Query:   95 SANSKDTDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRL-ADETNKALPNDCQC 733
             A     DQNFDYMFKLLIIGNSSVGKTSFLFRY DDSFTSAFVSTVGIDFKVKT+ R DK+VKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFN+VQDW TQIKTYSW+NAQVVLVGNK D+D ERV+S+DRGRQLA QLGLEFFETSAKEN++VK+VFE+LV+IICDKM+ESLD DP     P KG +L A+ T K     C C
Sbjct:    9 GATPGQPDQNFDYMFKLLIIGNSSVGKTSFLFRYCDDSFTSAFVSTVGIDFKVKTVFRGDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNSVQDWCTQIKTYSWENAQVVLVGNKCDMDSERVVSMDRGRQLADQLGLEFFETSAKENINVKAVFEKLVEIICDKMAESLDKDPQ--QQP-KGQKLEANPTQKPAQQQCNC 219          
BLAST of Ras-related protein Rab-3 vs. Ensembl Celegans
Match: rab-8 (RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5EFC1])

HSP 1 Score: 206.068 bits (523), Expect = 1.315e-65
Identity = 97/187 (51.87%), Postives = 136/187 (72.73%), Query Frame = 2
Query:  119 QNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNK 679
            + +DY+FKLL+IG+S VGKT  LFR++DDSF ++F+ST+GIDFK++TI    KK+KLQIWDTAGQER+RTITTAYYRGAMG IL+YDITNE SF  +++W+  I+ ++  + + +++GNK D++  R +S DRG QLA + G +F ETSAK NL++   F  L   I  KM ++       V+N  +
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCVLFRFSDDSFNNSFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIILVYDITNERSFENIKNWIRNIEEHAASDVERMIIGNKCDIEERREVSRDRGEQLAIEYGTKFLETSAKANLNIDEAFFTLARDIKSKMEQNEMRAGGSVSNTGR 189          
BLAST of Ras-related protein Rab-3 vs. Ensembl Celegans
Match: rab-8 (RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5EFC1])

HSP 1 Score: 206.068 bits (523), Expect = 1.315e-65
Identity = 97/187 (51.87%), Postives = 136/187 (72.73%), Query Frame = 2
Query:  119 QNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNK 679
            + +DY+FKLL+IG+S VGKT  LFR++DDSF ++F+ST+GIDFK++TI    KK+KLQIWDTAGQER+RTITTAYYRGAMG IL+YDITNE SF  +++W+  I+ ++  + + +++GNK D++  R +S DRG QLA + G +F ETSAK NL++   F  L   I  KM ++       V+N  +
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCVLFRFSDDSFNNSFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIILVYDITNERSFENIKNWIRNIEEHAASDVERMIIGNKCDIEERREVSRDRGEQLAIEYGTKFLETSAKANLNIDEAFFTLARDIKSKMEQNEMRAGGSVSNTGR 189          
BLAST of Ras-related protein Rab-3 vs. Ensembl Celegans
Match: rab-10 (Ras-related protein Rab-10 [Source:UniProtKB/Swiss-Prot;Acc:Q94148])

HSP 1 Score: 200.29 bits (508), Expect = 1.809e-63
Identity = 93/188 (49.47%), Postives = 133/188 (70.74%), Query Frame = 2
Query:  125 FDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTR 688
            +D +FKLL+IG+S VGKT  L+R++DD+F + F+ST+GIDFK+KTI  + KK+KLQIWDTAGQER+ TITT+YYRGAMG +L+YDITN +SF+ +  W+  I  ++ ++   +++GNK D+   RV+S +RG ++A   G+ F ETSAK N+HV + F  L + I  KM +S D       NP +  R
Sbjct:    6 YDMLFKLLLIGDSGVGKTCILYRFSDDAFNTTFISTIGIDFKIKTIELKGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNAKSFDNIAKWLRNIDEHASEDVVKMILGNKCDMSDRRVVSRERGEKIAQDHGISFHETSAKLNVHVDTAFYDLAEAILAKMPDSTDEQSRDTVNPVQPQR 193          
BLAST of Ras-related protein Rab-3 vs. Ensembl Fly
Match: Rab3 (gene:FBgn0005586 transcript:FBtr0473383)

HSP 1 Score: 352.829 bits (904), Expect = 3.453e-123
Identity = 167/207 (80.68%), Postives = 185/207 (89.37%), Query Frame = 2
Query:  113 TDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPNDCQC 733
             DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKT+ R DK+VKLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNE+SFN+VQDWVTQIKTYSWDNAQV+LVGNK D++ +RVIS +RGRQLA QLG+EFFETSAKEN++VK+VFERLVDIICDKMSESLD DP++V    KG RL D+       +C C
Sbjct:   14 ADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVISFERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESLDADPTLVGGGQKGQRLTDQPQGTPNANCNC 220          
BLAST of Ras-related protein Rab-3 vs. Ensembl Fly
Match: Rab3 (gene:FBgn0005586 transcript:FBtr0088257)

HSP 1 Score: 352.829 bits (904), Expect = 3.453e-123
Identity = 167/207 (80.68%), Postives = 185/207 (89.37%), Query Frame = 2
Query:  113 TDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPNDCQC 733
             DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKT+ R DK+VKLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNE+SFN+VQDWVTQIKTYSWDNAQV+LVGNK D++ +RVIS +RGRQLA QLG+EFFETSAKEN++VK+VFERLVDIICDKMSESLD DP++V    KG RL D+       +C C
Sbjct:   14 ADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVISFERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESLDADPTLVGGGQKGQRLTDQPQGTPNANCNC 220          
BLAST of Ras-related protein Rab-3 vs. Ensembl Fly
Match: Rab10 (gene:FBgn0015789 transcript:FBtr0077337)

HSP 1 Score: 201.83 bits (512), Expect = 4.868e-64
Identity = 92/184 (50.00%), Postives = 136/184 (73.91%), Query Frame = 2
Query:  119 QNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMS--ESLDTDPSIV 664
            + +D +FKLL+IG+S VGKT  LFR++DD+FTS F+ST+GIDFK+KT+  R KK+KLQIWDTAGQER+ TITT+YYRGAMG +L+YDITNE+SF  +  W+  I  ++ ++ + +++GNK D+  +RV++ +RG  +A + G+ F ETSAK N++++  F  L + I DK S  ES +    ++
Sbjct:    4 KTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRVVNKERGEAIAREHGIRFMETSAKSNINIERAFCELAEAILDKTSGRESAENQERVI 187          
BLAST of Ras-related protein Rab-3 vs. Ensembl Fly
Match: Rab8 (gene:FBgn0262518 transcript:FBtr0308833)

HSP 1 Score: 200.29 bits (508), Expect = 2.660e-63
Identity = 94/188 (50.00%), Postives = 138/188 (73.40%), Query Frame = 2
Query:  119 QNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKG 682
            + +DY+FKLL+IG+S VGKT  LFR+++D+F + F+ST+GIDFK++TI   +KK+KLQIWDTAGQER+RTITTAYYRGAMG +L+YDIT E+SF  +++W+  I+  +  + + +L+GNK +L  +R +S +RG QLA + G++F ETSAK +++V+  F  L   I  K  + ++      NNP KG
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRME-----ANNPPKG 185          
BLAST of Ras-related protein Rab-3 vs. Ensembl Fly
Match: Rab8 (gene:FBgn0262518 transcript:FBtr0074921)

HSP 1 Score: 200.29 bits (508), Expect = 2.660e-63
Identity = 94/188 (50.00%), Postives = 138/188 (73.40%), Query Frame = 2
Query:  119 QNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKG 682
            + +DY+FKLL+IG+S VGKT  LFR+++D+F + F+ST+GIDFK++TI   +KK+KLQIWDTAGQER+RTITTAYYRGAMG +L+YDIT E+SF  +++W+  I+  +  + + +L+GNK +L  +R +S +RG QLA + G++F ETSAK +++V+  F  L   I  K  + ++      NNP KG
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRME-----ANNPPKG 185          
BLAST of Ras-related protein Rab-3 vs. Ensembl Zebrafish
Match: rab3c (RAB3C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-040718-263])

HSP 1 Score: 332.413 bits (851), Expect = 4.538e-115
Identity = 154/209 (73.68%), Postives = 178/209 (85.17%), Query Frame = 2
Query:  107 KDTDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPNDCQC 733
            +++DQNFDYMFKLLIIGNSSVGKTSFLFRYADD+FTSAFVSTVGIDFKVKT+ + DK++KLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESF AVQDW TQIKTYSWDNAQV+L GNK D++ ER++S+D GR LA QLG EFFETSAK+N++VK  F+RLVDIICDKMS++L+ DP+         RL +      P+DC C
Sbjct:   11 ENSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTSAFVSTVGIDFKVKTVYKNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFAAVQDWATQIKTYSWDNAQVILAGNKCDMEEERIVSVDSGRLLAEQLGFEFFETSAKDNINVKQTFDRLVDIICDKMSDTLEADPAAAGG-TPSARLTETPAPPQPSDCSC 218          
BLAST of Ras-related protein Rab-3 vs. Ensembl Zebrafish
Match: rab3c (RAB3C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-040718-263])

HSP 1 Score: 332.413 bits (851), Expect = 4.538e-115
Identity = 154/209 (73.68%), Postives = 178/209 (85.17%), Query Frame = 2
Query:  107 KDTDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPNDCQC 733
            +++DQNFDYMFKLLIIGNSSVGKTSFLFRYADD+FTSAFVSTVGIDFKVKT+ + DK++KLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESF AVQDW TQIKTYSWDNAQV+L GNK D++ ER++S+D GR LA QLG EFFETSAK+N++VK  F+RLVDIICDKMS++L+ DP+         RL +      P+DC C
Sbjct:   11 ENSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTSAFVSTVGIDFKVKTVYKNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFAAVQDWATQIKTYSWDNAQVILAGNKCDMEEERIVSVDSGRLLAEQLGFEFFETSAKDNINVKQTFDRLVDIICDKMSDTLEADPAAAGG-TPSARLTETPAPPQPSDCSC 218          
BLAST of Ras-related protein Rab-3 vs. Ensembl Zebrafish
Match: rab3c (RAB3C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-040718-263])

HSP 1 Score: 332.413 bits (851), Expect = 6.593e-115
Identity = 154/209 (73.68%), Postives = 178/209 (85.17%), Query Frame = 2
Query:  107 KDTDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPNDCQC 733
            +++DQNFDYMFKLLIIGNSSVGKTSFLFRYADD+FTSAFVSTVGIDFKVKT+ + DK++KLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESF AVQDW TQIKTYSWDNAQV+L GNK D++ ER++S+D GR LA QLG EFFETSAK+N++VK  F+RLVDIICDKMS++L+ DP+         RL +      P+DC C
Sbjct:   17 ENSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTSAFVSTVGIDFKVKTVYKNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFAAVQDWATQIKTYSWDNAQVILAGNKCDMEEERIVSVDSGRLLAEQLGFEFFETSAKDNINVKQTFDRLVDIICDKMSDTLEADPAAAGG-TPSARLTETPAPPQPSDCSC 224          
BLAST of Ras-related protein Rab-3 vs. Ensembl Zebrafish
Match: rab3ab (RAB3A, member RAS oncogene family, b [Source:ZFIN;Acc:ZDB-GENE-041210-268])

HSP 1 Score: 325.865 bits (834), Expect = 2.554e-112
Identity = 156/210 (74.29%), Postives = 178/210 (84.76%), Query Frame = 2
Query:  107 KDTDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPN-DCQC 733
            + +DQNFDYMFK+LIIGNSSVGKTSFLFRYADDSFT AFVSTVGIDFKVKTI R DK++KLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESF AVQDW TQIKTYSWDNAQV+LVGNK D++ ERV++ +RGRQL+  LG E+FE SAK+N++VK  FERLVDIIC+KMSESLD     V    +G +L ++   A P+ DC C
Sbjct:   13 ESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFAAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVASERGRQLSEHLGFEYFEASAKDNINVKQTFERLVDIICEKMSESLDAADPAVTGAKQGPQLTEQ--PAAPHQDCAC 220          
BLAST of Ras-related protein Rab-3 vs. Ensembl Zebrafish
Match: rab3da (RAB3D, member RAS oncogene family, a [Source:ZFIN;Acc:ZDB-GENE-080722-14])

HSP 1 Score: 324.709 bits (831), Expect = 6.091e-112
Identity = 156/206 (75.73%), Postives = 179/206 (86.89%), Query Frame = 2
Query:  116 DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPNDCQC 733
            DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKT+ R +K+VKLQIWDTAGQERYRTITTAYYRGAMGF+LMYDITN++SF AVQDW TQIKTYSWDNAQV+LVGNK DL+ +R+++ + G++LA++LG +FFE SAK+N++VK VFERLVDIICDKM+ESLDTDPSI+ N  KG  L D         C C
Sbjct:   19 DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVYRNEKRVKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDITNQDSFYAVQDWATQIKTYSWDNAQVILVGNKCDLEDDRLVAREDGQRLANELGFQFFEASAKDNINVKQVFERLVDIICDKMNESLDTDPSILTN-QKGPSLQDTPPDGQSGGCGC 223          
BLAST of Ras-related protein Rab-3 vs. Ensembl Xenopus
Match: rab3a (RAB3A, member RAS oncogene family [Source:NCBI gene;Acc:549180])

HSP 1 Score: 335.109 bits (858), Expect = 7.704e-116
Identity = 162/210 (77.14%), Postives = 181/210 (86.19%), Query Frame = 2
Query:  107 KDTDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPN-DCQC 733
            + +DQNFDYMFK+LIIGNSSVGKTSFLFRYADDSFT AFVSTVGIDFKVKTI R DK++KLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDW TQIKTYSWDNAQV+LVGNK D++ ERV+S +RGRQLA  LG EFFE SAK+N++VK  FERLVDIIC+KMSESLDT    V    +G +L D+  +A P+ DC C
Sbjct:   13 ESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLAEHLGFEFFEASAKDNINVKQTFERLVDIICEKMSESLDTADPAVTGAKQGPQLTDQ--QAPPHQDCAC 220          
BLAST of Ras-related protein Rab-3 vs. Ensembl Xenopus
Match: rab3b (RAB3B, member RAS oncogene family [Source:NCBI gene;Acc:100101786])

HSP 1 Score: 326.635 bits (836), Expect = 1.460e-112
Identity = 159/208 (76.44%), Postives = 175/208 (84.13%), Query Frame = 2
Query:  113 TDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLA-DETNKALPNDCQC 733
            +DQNFDYMFKLLIIGNSSVGKTSFLFRYADD+FTSAFVSTVGIDFKVKT+ R DK+VKLQIWDTAGQERYRTITTAYYRGAMGFILMYDIT+E S+NAVQDW TQIKTYSWDNAQV+LVGNK D++ ERVI+ ++G+ LA QLG EFFE SAKEN+ VK VFERLVDIICDKMSESLDTD      P  G  L   +T   +   C C
Sbjct:   15 SDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTSAFVSTVGIDFKVKTVYRNDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITSESSYNAVQDWATQIKTYSWDNAQVILVGNKCDMEEERVIAPEKGKHLADQLGFEFFEASAKENIQVKQVFERLVDIICDKMSESLDTD-----QPPGGKNLRFTDTAPPIHQKCSC 217          
BLAST of Ras-related protein Rab-3 vs. Ensembl Xenopus
Match: RAB3C (RAB3C, member RAS oncogene family [Source:NCBI gene;Acc:100496123])

HSP 1 Score: 321.627 bits (823), Expect = 2.173e-110
Identity = 162/210 (77.14%), Postives = 180/210 (85.71%), Query Frame = 2
Query:  107 KDT-DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPNDCQC 733
            KDT DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKT+ + +K++KLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDW TQIKTYSWDNAQV+LVGNK D++ ERVIS +RG+ LA QLG EFFE SAK+N++VK  FERLVDIICDKMSE+++TD +        TRL D+     PN C C
Sbjct:   20 KDTSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDERVISAERGKHLAEQLGFEFFEASAKDNINVKQTFERLVDIICDKMSENIETDAAATAAKQT-TRLTDKAPPQQPN-CGC 227          
BLAST of Ras-related protein Rab-3 vs. Ensembl Xenopus
Match: RAB3C (RAB3C, member RAS oncogene family [Source:NCBI gene;Acc:100496123])

HSP 1 Score: 320.857 bits (821), Expect = 2.605e-110
Identity = 162/210 (77.14%), Postives = 180/210 (85.71%), Query Frame = 2
Query:  107 KDT-DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPNDCQC 733
            KDT DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKT+ + +K++KLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDW TQIKTYSWDNAQV+LVGNK D++ ERVIS +RG+ LA QLG EFFE SAK+N++VK  FERLVDIICDKMSE+++TD +        TRL D+     PN C C
Sbjct:   12 KDTSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDERVISAERGKHLAEQLGFEFFEASAKDNINVKQTFERLVDIICDKMSENIETDAAATAAKQT-TRLTDKAPPQQPN-CGC 219          
BLAST of Ras-related protein Rab-3 vs. Ensembl Xenopus
Match: tekt1 (tektin 1 [Source:Xenbase;Acc:XB-GENE-5929242])

HSP 1 Score: 315.079 bits (806), Expect = 5.356e-108
Identity = 153/207 (73.91%), Postives = 175/207 (84.54%), Query Frame = 2
Query:  113 TDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPNDCQC 733
             DQ+FDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKT+ R +K+VKLQIWDTAGQERYRTITTAYYRGAMGF+LMYDI+N ESFNAVQDW TQIKTYSWDNAQV+LVGNK DL+ +RVI  + GR+LA +LG EFFE SAK+N++VK VFERLVDIIC+KM+ESL+  P     P+   +L++   K   N C C
Sbjct:   15 ADQSFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVYRNEKRVKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDISNLESFNAVQDWATQIKTYSWDNAQVLLVGNKCDLEDDRVIPAEDGRKLAEELGFEFFEASAKDNINVKQVFERLVDIICEKMNESLENGPV----PSGTAQLSESAPKEHSN-CSC 216          
BLAST of Ras-related protein Rab-3 vs. Ensembl Mouse
Match: Rab3c (RAB3C, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1914545])

HSP 1 Score: 335.495 bits (859), Expect = 4.175e-116
Identity = 160/207 (77.29%), Postives = 180/207 (86.96%), Query Frame = 2
Query:  113 TDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPNDCQC 733
            +DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKT+ + +K++KLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDW TQIKTYSWDNAQV+L GNK D++ ERV+S +RG++L  QLG EFFETSAK+N++VK  FERLVDIICDKMSESL+TDP+I     + TRL +      PN C C
Sbjct:   23 SDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILAGNKCDMEDERVVSTERGQRLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAIT-AAKQSTRLKETPPPPQPN-CGC 227          
BLAST of Ras-related protein Rab-3 vs. Ensembl Mouse
Match: Rab3c (RAB3C, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1914545])

HSP 1 Score: 334.724 bits (857), Expect = 9.133e-116
Identity = 160/207 (77.29%), Postives = 180/207 (86.96%), Query Frame = 2
Query:  113 TDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPNDCQC 733
            +DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKT+ + +K++KLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDW TQIKTYSWDNAQV+L GNK D++ ERV+S +RG++L  QLG EFFETSAK+N++VK  FERLVDIICDKMSESL+TDP+I     + TRL +      PN C C
Sbjct:   21 SDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILAGNKCDMEDERVVSTERGQRLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAIT-AAKQSTRLKETPPPPQPN-CGC 225          
BLAST of Ras-related protein Rab-3 vs. Ensembl Mouse
Match: Rab3a (Ras-related protein Rab-3A [Source:UniProtKB/Swiss-Prot;Acc:P63011])

HSP 1 Score: 334.339 bits (856), Expect = 1.282e-115
Identity = 161/208 (77.40%), Postives = 180/208 (86.54%), Query Frame = 2
Query:  113 TDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPN-DCQC 733
            +DQNFDYMFK+LIIGNSSVGKTSFLFRYADDSFT AFVSTVGIDFKVKTI R DK++KLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDW TQIKTYSWDNAQV+LVGNK D++ ERV+S +RGRQLA  LG EFFE SAK+N++VK  FERLVD+IC+KMSESLDT    V    +G +L D+  +A P+ DC C
Sbjct:   15 SDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLTDQ--QAPPHQDCAC 220          
BLAST of Ras-related protein Rab-3 vs. Ensembl Mouse
Match: Rab3a (Ras-related protein Rab-3A [Source:UniProtKB/Swiss-Prot;Acc:P63011])

HSP 1 Score: 334.339 bits (856), Expect = 1.282e-115
Identity = 161/208 (77.40%), Postives = 180/208 (86.54%), Query Frame = 2
Query:  113 TDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPN-DCQC 733
            +DQNFDYMFK+LIIGNSSVGKTSFLFRYADDSFT AFVSTVGIDFKVKTI R DK++KLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDW TQIKTYSWDNAQV+LVGNK D++ ERV+S +RGRQLA  LG EFFE SAK+N++VK  FERLVD+IC+KMSESLDT    V    +G +L D+  +A P+ DC C
Sbjct:   15 SDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLTDQ--QAPPHQDCAC 220          
BLAST of Ras-related protein Rab-3 vs. Ensembl Mouse
Match: Rab3a (RAB3A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:97843])

HSP 1 Score: 334.339 bits (856), Expect = 1.282e-115
Identity = 161/208 (77.40%), Postives = 180/208 (86.54%), Query Frame = 2
Query:  113 TDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPN-DCQC 733
            +DQNFDYMFK+LIIGNSSVGKTSFLFRYADDSFT AFVSTVGIDFKVKTI R DK++KLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDW TQIKTYSWDNAQV+LVGNK D++ ERV+S +RGRQLA  LG EFFE SAK+N++VK  FERLVD+IC+KMSESLDT    V    +G +L D+  +A P+ DC C
Sbjct:   15 SDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLTDQ--QAPPHQDCAC 220          
BLAST of Ras-related protein Rab-3 vs. UniProt/SwissProt
Match: sp|P25228|RAB3_DROME (Ras-related protein Rab-3 OS=Drosophila melanogaster OX=7227 GN=Rab3 PE=1 SV=1)

HSP 1 Score: 352.829 bits (904), Expect = 3.462e-122
Identity = 167/207 (80.68%), Postives = 185/207 (89.37%), Query Frame = 2
Query:  113 TDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPNDCQC 733
             DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKT+ R DK+VKLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNE+SFN+VQDWVTQIKTYSWDNAQV+LVGNK D++ +RVIS +RGRQLA QLG+EFFETSAKEN++VK+VFERLVDIICDKMSESLD DP++V    KG RL D+       +C C
Sbjct:   14 ADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVISFERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESLDADPTLVGGGQKGQRLTDQPQGTPNANCNC 220          
BLAST of Ras-related protein Rab-3 vs. UniProt/SwissProt
Match: sp|Q94986|RAB3_CAEEL (Ras-related protein Rab-3 OS=Caenorhabditis elegans OX=6239 GN=rab-3 PE=1 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 5.143e-119
Identity = 169/214 (78.97%), Postives = 184/214 (85.98%), Query Frame = 2
Query:   95 SANSKDTDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRL-ADETNKALPNDCQC 733
             A     DQNFDYMFKLLIIGNSSVGKTSFLFRY DDSFTSAFVSTVGIDFKVKT+ R DK+VKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFN+VQDW TQIKTYSW+NAQVVLVGNK D+D ERV+S+DRGRQLA QLGLEFFETSAKEN++VK+VFE+LV+IICDKM+ESLD DP     P KG +L A+ T K     C C
Sbjct:    9 GATPGQPDQNFDYMFKLLIIGNSSVGKTSFLFRYCDDSFTSAFVSTVGIDFKVKTVFRGDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNSVQDWCTQIKTYSWENAQVVLVGNKCDMDSERVVSMDRGRQLADQLGLEFFETSAKENINVKAVFEKLVEIICDKMAESLDKDPQ--QQP-KGQKLEANPTQKPAQQQCNC 219          
BLAST of Ras-related protein Rab-3 vs. UniProt/SwissProt
Match: sp|Q96E17|RAB3C_HUMAN (Ras-related protein Rab-3C OS=Homo sapiens OX=9606 GN=RAB3C PE=1 SV=1)

HSP 1 Score: 337.806 bits (865), Expect = 3.907e-116
Identity = 162/207 (78.26%), Postives = 180/207 (86.96%), Query Frame = 2
Query:  113 TDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPNDCQC 733
            +DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKT+ + +K++KLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDW TQIKTYSWDNAQV+LVGNK D++ ERVIS +RG+ L  QLG EFFETSAK+N++VK  FERLVDIICDKMSESL+TDP+I     + TRL +      PN C C
Sbjct:   23 SDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAIT-AAKQNTRLKETPPPPQPN-CAC 227          
BLAST of Ras-related protein Rab-3 vs. UniProt/SwissProt
Match: sp|P10949|RAB3C_BOVIN (Ras-related protein Rab-3C OS=Bos taurus OX=9913 GN=RAB3C PE=2 SV=3)

HSP 1 Score: 337.421 bits (864), Expect = 6.461e-116
Identity = 162/207 (78.26%), Postives = 180/207 (86.96%), Query Frame = 2
Query:  113 TDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPNDCQC 733
            +DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKT+ + +K++KLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDW TQIKTYSWDNAQV+LVGNK D++ ERVIS +RG+ L  QLG EFFETSAK+N++VK  FERLVDIICDKMSESL+TDP+I     + TRL +      PN C C
Sbjct:   23 SDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAIT-AAKQNTRLKETPPPPQPN-CGC 227          
BLAST of Ras-related protein Rab-3 vs. UniProt/SwissProt
Match: sp|P62824|RAB3C_RAT (Ras-related protein Rab-3C OS=Rattus norvegicus OX=10116 GN=Rab3c PE=1 SV=1)

HSP 1 Score: 335.495 bits (859), Expect = 2.920e-115
Identity = 160/207 (77.29%), Postives = 180/207 (86.96%), Query Frame = 2
Query:  113 TDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPNDCQC 733
            +DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKT+ + +K++KLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDW TQIKTYSWDNAQV+L GNK D++ ERV+S +RG++L  QLG EFFETSAK+N++VK  FERLVDIICDKMSESL+TDP+I     + TRL +      PN C C
Sbjct:   23 SDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILAGNKCDMEDERVVSTERGQRLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAIT-AAKQSTRLKETPPPPQPN-CGC 227          
BLAST of Ras-related protein Rab-3 vs. TrEMBL
Match: A0A1S3H6N1 (ras-related protein Rab-3 isoform X5 OS=Lingula unguis OX=7574 GN=LOC106152563 PE=4 SV=1)

HSP 1 Score: 365.155 bits (936), Expect = 1.909e-124
Identity = 177/222 (79.73%), Postives = 198/222 (89.19%), Query Frame = 2
Query:   89 VMSANSKDT-------DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPNDCQC 733
            +M A++ D+       DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKT+ R+DK+VKLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESFNAVQDWVTQIKTYSWDNAQVVLVGNK DL+ ERV+S +RG+QLA QLGLEFFETSAKEN++VK+VFERLVDIIC+KMSESLD+DP+IV+N   GTRL +  N+   N CQC
Sbjct:    6 IMMASANDSKWQKDAADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRQDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKCDLEDERVVSTERGKQLADQLGLEFFETSAKENINVKAVFERLVDIICEKMSESLDSDPTIVSNQRGGTRLTETPNQQASN-CQC 226          
BLAST of Ras-related protein Rab-3 vs. TrEMBL
Match: Q25389 (Rab3 OS=Doryteuthis pealeii OX=1051067 PE=4 SV=2)

HSP 1 Score: 363.999 bits (933), Expect = 4.979e-124
Identity = 173/206 (83.98%), Postives = 188/206 (91.26%), Query Frame = 2
Query:  116 DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPNDCQC 733
            DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKT+ R+DK+VKLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESFNAVQDW TQIKTYSWDNAQVVLVGNK DL+ ERV+S +RG+QLA QLGLEFFETSAKEN++VK+VFERLVDIIC+KMSESLDTDP++VN+  KGTRL  E        CQC
Sbjct:   15 DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRQDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVQDWCTQIKTYSWDNAQVVLVGNKCDLEEERVVSTERGKQLADQLGLEFFETSAKENINVKAVFERLVDIICEKMSESLDTDPTLVNSQTKGTRLLTENPNPQNGSCQC 220          
BLAST of Ras-related protein Rab-3 vs. TrEMBL
Match: A0A1S3H6L2 (ras-related protein Rab-3 isoform X6 OS=Lingula unguis OX=7574 GN=LOC106152563 PE=4 SV=1)

HSP 1 Score: 363.614 bits (932), Expect = 5.852e-124
Identity = 174/206 (84.47%), Postives = 191/206 (92.72%), Query Frame = 2
Query:  116 DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPNDCQC 733
            DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKT+ R+DK+VKLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESFNAVQDWVTQIKTYSWDNAQVVLVGNK DL+ ERV+S +RG+QLA QLGLEFFETSAKEN++VK+VFERLVDIIC+KMSESLD+DP+IV+N   GTRL +  N+   N CQC
Sbjct:   15 DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRQDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKCDLEDERVVSTERGKQLADQLGLEFFETSAKENINVKAVFERLVDIICEKMSESLDSDPTIVSNQRGGTRLTETPNQQASN-CQC 219          
BLAST of Ras-related protein Rab-3 vs. TrEMBL
Match: A0A1S3H822 (ras-related protein Rab-3 isoform X4 OS=Lingula unguis OX=7574 GN=LOC106152563 PE=4 SV=1)

HSP 1 Score: 363.999 bits (933), Expect = 6.518e-124
Identity = 174/206 (84.47%), Postives = 191/206 (92.72%), Query Frame = 2
Query:  116 DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPNDCQC 733
            DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKT+ R+DK+VKLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESFNAVQDWVTQIKTYSWDNAQVVLVGNK DL+ ERV+S +RG+QLA QLGLEFFETSAKEN++VK+VFERLVDIIC+KMSESLD+DP+IV+N   GTRL +  N+   N CQC
Sbjct:   23 DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRQDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKCDLEDERVVSTERGKQLADQLGLEFFETSAKENINVKAVFERLVDIICEKMSESLDSDPTIVSNQRGGTRLTETPNQQASN-CQC 227          
BLAST of Ras-related protein Rab-3 vs. TrEMBL
Match: A0A1S3H6M6 (ras-related protein Rab-3 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106152563 PE=4 SV=1)

HSP 1 Score: 363.999 bits (933), Expect = 1.230e-123
Identity = 174/206 (84.47%), Postives = 191/206 (92.72%), Query Frame = 2
Query:  116 DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPNDCQC 733
            DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKT+ R+DK+VKLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESFNAVQDWVTQIKTYSWDNAQVVLVGNK DL+ ERV+S +RG+QLA QLGLEFFETSAKEN++VK+VFERLVDIIC+KMSESLD+DP+IV+N   GTRL +  N+   N CQC
Sbjct:   41 DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRQDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKCDLEDERVVSTERGKQLADQLGLEFFETSAKENINVKAVFERLVDIICEKMSESLDSDPTIVSNQRGGTRLTETPNQQASN-CQC 245          
BLAST of Ras-related protein Rab-3 vs. Ensembl Cavefish
Match: RAB3C (RAB3C, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:30269])

HSP 1 Score: 341.658 bits (875), Expect = 1.015e-118
Identity = 160/215 (74.42%), Postives = 181/215 (84.19%), Query Frame = 2
Query:   89 VMSANSKDTDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPNDCQC 733
            + +A  + +DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKT+ + DK++KLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESF AVQDW TQIKTYSWDNAQV+L GNK D++ ERV+S+D GR LA QLG EFFETSAK+N++VK  FERLVDIICDKMSESL+TDP++        RL D    +   +C C
Sbjct:    1 MAAAQKESSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVYKNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFGAVQDWSTQIKTYSWDNAQVILAGNKCDMEEERVVSVDSGRLLAEQLGFEFFETSAKDNVNVKQTFERLVDIICDKMSESLETDPTVTTGTQGNARLTDNPPPSQQPNCAC 215          
BLAST of Ras-related protein Rab-3 vs. Ensembl Cavefish
Match: rab3b (ras-related protein Rab-3B [Source:NCBI gene;Acc:103027359])

HSP 1 Score: 332.028 bits (850), Expect = 7.078e-115
Identity = 159/205 (77.56%), Postives = 181/205 (88.29%), Query Frame = 2
Query:  113 TDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPNDC 727
            +DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSF+++FVSTVGIDFKVKT+ R DK+VKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDW TQIKTYSWDNAQV+LVGNK D+D ERVI +++G+ LA QLG E++E SAKEN++V+ VFERLVDIIC KMSE +D DPS+V    K TRL D+  + LP +C
Sbjct:   14 SDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFSNSFVSTVGIDFKVKTVYRNDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNAQVILVGNKCDMDDERVIPMEKGKHLADQLGFEYYEASAKENINVRQVFERLVDIICVKMSERVDADPSMVTGA-KTTRLTDKPAQ-LPQNC 216          
BLAST of Ras-related protein Rab-3 vs. Ensembl Cavefish
Match: rab3ab (RAB3A, member RAS oncogene family [Source:NCBI gene;Acc:103043849])

HSP 1 Score: 327.791 bits (839), Expect = 3.766e-113
Identity = 157/210 (74.76%), Postives = 178/210 (84.76%), Query Frame = 2
Query:  107 KDTDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPN-DCQC 733
            + +DQNFDYMFK+LIIGNSSVGKTSFLFRYADDSFT AFVSTVGIDFKVKTI R DK++KLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESF AVQDW TQIKTYSWDNAQV+LVGNK D++ ERV++ +RGRQL+  LG EFFE SAK+N++VK  FERLVDIIC+KMSESLD     V    +G +L ++   A P+ DC C
Sbjct:   13 ESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFAAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVAAERGRQLSEHLGFEFFEASAKDNINVKQTFERLVDIICEKMSESLDAADPAVTGAKQGPQLTEQ--PAAPHQDCAC 220          
BLAST of Ras-related protein Rab-3 vs. Ensembl Cavefish
Match: rab3ab (RAB3A, member RAS oncogene family [Source:NCBI gene;Acc:103043849])

HSP 1 Score: 327.791 bits (839), Expect = 3.766e-113
Identity = 157/210 (74.76%), Postives = 178/210 (84.76%), Query Frame = 2
Query:  107 KDTDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPN-DCQC 733
            + +DQNFDYMFK+LIIGNSSVGKTSFLFRYADDSFT AFVSTVGIDFKVKTI R DK++KLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESF AVQDW TQIKTYSWDNAQV+LVGNK D++ ERV++ +RGRQL+  LG EFFE SAK+N++VK  FERLVDIIC+KMSESLD     V    +G +L ++   A P+ DC C
Sbjct:   13 ESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFAAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVAAERGRQLSEHLGFEFFEASAKDNINVKQTFERLVDIICEKMSESLDAADPAVTGAKQGPQLTEQ--PAAPHQDCAC 220          
BLAST of Ras-related protein Rab-3 vs. Ensembl Cavefish
Match: rab3aa (ras-related protein Rab-3A-like [Source:NCBI gene;Acc:103026901])

HSP 1 Score: 326.25 bits (835), Expect = 1.213e-112
Identity = 157/210 (74.76%), Postives = 181/210 (86.19%), Query Frame = 2
Query:  107 KDT-DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPNDCQC 733
            KDT DQNFDYMFK+LIIGNSSVGKTSFLFRYADDSFT AFVSTVGIDFKVKTI R DK++KLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNE+SFNAVQDW TQIKTYSWDNAQV+LVGNK D++ ER+++  RGRQLA QLG EFFE SAK+N++VK  FERLVD+IC++MSESL++  S V    +G +L ++  ++   DC C
Sbjct:   12 KDTSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEDSFNAVQDWSTQIKTYSWDNAQVLLVGNKCDIEDERLVASQRGRQLADQLGFEFFEASAKDNINVKQTFERLVDVICERMSESLESGDSSVTGGKQGPQLTEQPQRS-HQDCAC 220          
BLAST of Ras-related protein Rab-3 vs. Ensembl Sea Lamprey
Match: rab3c (RAB3C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-040718-263])

HSP 1 Score: 314.694 bits (805), Expect = 1.252e-108
Identity = 155/213 (72.77%), Postives = 176/213 (82.63%), Query Frame = 2
Query:  116 DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESL----DTDPSIVNNPNKGTRLADETNKALPND---CQC 733
            DQNFDYMFKLLIIGNSSVGKTSFLFRYAD+SFTSAFVSTVGIDFKVKT+ R +K++KLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNE+SFNAV DW TQIKTYSWDNAQVVLVGNK D++ +R++  ++GRQLA QLG EFFETSAK+N++VK  FERLVD+IC+KMSESL        +      +GTRL D    +LP     C C
Sbjct:   23 DQNFDYMFKLLIIGNSSVGKTSFLFRYADESFTSAFVSTVGIDFKVKTVYRNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEDSFNAVSDWSTQIKTYSWDNAQVVLVGNKCDMEDDRMVPTEQGRQLAEQLGFEFFETSAKDNINVKQTFERLVDVICEKMSESLDGDGAAAGAGAAGSKQGTRLTD----SLPQSSQACGC 231          
BLAST of Ras-related protein Rab-3 vs. Ensembl Sea Lamprey
Match: rab8a (RAB8A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070424-36])

HSP 1 Score: 199.134 bits (505), Expect = 1.428e-63
Identity = 93/196 (47.45%), Postives = 142/196 (72.45%), Query Frame = 2
Query:  119 QNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESL------DTDPSIVNNPNKGTR 688
            + +DY+FKLL+IG+S VGKT  LFR+++D+F S F+ST+GIDFK++TI    KK+KLQIWDTAGQER+RTITTAYYRGAMG +L+YDITNE+SF  +++W+  I+ ++  + + +++GNK D++  R ++ +RG +LA + G++F ETSAK +++V+  F  L   I  KM   L      D++   +  P++G +
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIDLDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFENIKNWIRNIEEHASADVEKMILGNKCDMNERRQVTRERGEKLAIEYGIKFMETSAKASINVEEAFFTLARDIKAKMDRKLEGNNTPDSNAVRITAPSQGKK 198          
BLAST of Ras-related protein Rab-3 vs. Ensembl Sea Lamprey
Match: rab1aa (RAB1A, member RAS oncogene family a [Source:ZFIN;Acc:ZDB-GENE-090312-110])

HSP 1 Score: 182.956 bits (463), Expect = 3.158e-57
Identity = 82/173 (47.40%), Postives = 123/173 (71.10%), Query Frame = 2
Query:  116 DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMS 634
            +  +DY+FKLL+IG+S VGK+  L R+ADD++T +++ST+G+DFK++TI    K +KLQIWDTAGQER+RTIT++YYRGA G I++YD+T++ESFN V+ W+ +I  Y+ +N   +LVGNK DL  ++V+     ++ A  L + F ETSAK   +V+  F  +   I  +M 
Sbjct:    5 NPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLEIPFLETSAKNATNVEQAFMTMAAEIKKRMG 177          
BLAST of Ras-related protein Rab-3 vs. Ensembl Sea Lamprey
Match: rab8a (RAB8A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070424-36])

HSP 1 Score: 177.178 bits (448), Expect = 5.116e-55
Identity = 88/187 (47.06%), Postives = 133/187 (71.12%), Query Frame = 2
Query:  119 QNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKV-KTIVRRD-KKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNP 673
            +++D +FKLL+IG+S VGKT  LFR+++D+F S F+ST+G    V +  +R D KK+KLQIWDTAGQER+RTITTAYYRGAMG +L+YDITNE+SF  +++W+  I+ ++  + Q  +VGNK D++  R ++ DRG +LA    ++F ETSAK +++V+  F  L   I  KM + ++ + +  N+ 
Sbjct:    3 KSYDCLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGGSRPVCQVCIRIDLKKIKLQIWDTAGQERFRTITTAYYRGAMGSMLVYDITNEKSFENIKNWIRNIEEHASADVQ-KMVGNKCDMNDRRQVTKDRGEKLAEDYNIQFMETSAKASINVEEAFFTLAREIKAKMDKKMEGNTAAENSS 188          
BLAST of Ras-related protein Rab-3 vs. Ensembl Sea Lamprey
Match: rab27a (RAB27A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-050913-46])

HSP 1 Score: 154.836 bits (390), Expect = 3.122e-46
Identity = 77/211 (36.49%), Postives = 134/211 (63.51%), Query Frame = 2
Query:  113 TDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTI----------VRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSW-DNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTD--PSIVNNPNKGTRLADETN 706
            +D  +DY+ KLL++G+S VGK+S L +Y +  F   +++TVGIDF+ K +           ++ K+V LQ+WDTAGQER+R++TTA++R AMGF++++D+T+E++F  V++W+ Q++ +++ ++  +VL GNK DL  E  I+  + ++ A + G+ +FETSA+   +V    E L+ +I  +M   +D    P  V N     +  DE +
Sbjct:    2 SDLEYDYLIKLLVLGDSGVGKSSLLCQYTEGRFHDKYITTVGIDFREKRVTYTNEGADGTAKQTKRVHLQLWDTAGQERFRSLTTAFFRDAMGFLVIFDLTSEQTFLNVRNWLNQLQMHAYCESPDIVLCGNKSDLS-EHNITQKQAKEFAEKHGMPYFETSARTGNNVVPAVETLLGLIMKRMERCIDKSWIPQGVLNKKDKLQEVDEAD 211          
BLAST of Ras-related protein Rab-3 vs. Ensembl Yeast
Match: SEC4 (Rab family GTPase; essential for vesicle-mediated exocytic secretion and autophagy; associates with the exocyst component Sec15p and may regulate polarized delivery of transport vesicles to the exocyst at the plasma membrane [Source:SGD;Acc:S000001889])

HSP 1 Score: 184.882 bits (468), Expect = 3.898e-58
Identity = 85/176 (48.30%), Postives = 128/176 (72.73%), Query Frame = 2
Query:  104 SKDTDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKM 631
            S    +++D + K+L+IG+S VGK+  L R+ +D F  +F++T+GIDFK+KT+    KKVKLQ+WDTAGQER+RTITTAYYRGAMG IL+YD+T+E +F  ++ W   +  ++ D AQ++LVGNK D++  RV++ D+G  LA +LG+ F E+SAK + +V  +F  L  +I +K+
Sbjct:   10 SSGNGKSYDSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDME-TRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKI 184          
BLAST of Ras-related protein Rab-3 vs. Ensembl Yeast
Match: YPT1 (Rab family GTPase; involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by type II protein geranylgeranyltransferase (Bet2p-Bet4p); binds to unspliced HAC1 mRNA; regulates the unfolded protein response (UPR) by promoting the decay of HAC1 RNA; localizes to the early Golgi, the transitional Golgi and ER membranes, pre-autophagosomal structures, and cytoplasmic vesicles [Source:SGD;Acc:S000001856])

HSP 1 Score: 178.333 bits (451), Expect = 1.057e-55
Identity = 82/171 (47.95%), Postives = 123/171 (71.93%), Query Frame = 2
Query:  125 FDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSE 637
            +DY+FKLL+IGNS VGK+  L R++DD++T+ ++ST+G+DFK+KT+    K VKLQIWDTAGQER+RTIT++YYRG+ G I++YD+T++ESFN V+ W+ +I  Y+      +LVGNK DL  +RV+  D  ++ A    + F ETSA ++ +V+  F  +   I + MS+
Sbjct:    5 YDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQ 175          
BLAST of Ras-related protein Rab-3 vs. Ensembl Yeast
Match: YPT32 (Rab family GTPase involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; protein abundance increases in response to DNA replication stress; YPT32 has a paralog, YPT31, that arose from the whole genome duplication [Source:SGD;Acc:S000003178])

HSP 1 Score: 152.91 bits (385), Expect = 1.205e-45
Identity = 77/190 (40.53%), Postives = 119/190 (62.63%), Query Frame = 2
Query:  104 SKDTDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSE-SLDTDPSIVNN 670
            ++D   ++DY+FK+++IG+S VGK++ L R+  D F     ST+G++F  +TI   +KK+K QIWDTAGQERYR IT+AYYRGA+G +++YDI+   S+     W+T+++  + DN  V L+GNK DL + R +  D  +  A +  + F ETSA  + +V   F  L+  I   +S+  +D   S  NN
Sbjct:    3 NEDYGYDYDYLFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENADDNVAVGLIGNKSDLAHLRAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFRELIVAIFQMVSKHQVDLSGSGTNN 192          
BLAST of Ras-related protein Rab-3 vs. Ensembl Yeast
Match: YPT31 (Rab family GTPase; involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; YPT31 has a paralog, YPT32, that arose from the whole genome duplication; localizes to the transitional and late Golgi [Source:SGD;Acc:S000000833])

HSP 1 Score: 152.91 bits (385), Expect = 1.520e-45
Identity = 81/220 (36.82%), Postives = 128/220 (58.18%), Query Frame = 2
Query:  104 SKDTDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSES-LDTDPSIVNNPNKG-----------TRLADETNKALPNDC 727
            S+D   ++D +FK+++IG+S VGK++ L R+  + F     ST+G++F  +T+    K++K QIWDTAGQERYR IT+AYYRGA+G +++YDI+   S+     W+++++  + DN  V L+GNK DL + R +  +  +  A +  L F ETSA  + +V   FE L++ I  K+S+  +D   S  N    G           T   +E  KA  N+C
Sbjct:    3 SEDYGYDYDLLFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENADDNVAVGLIGNKSDLAHLRAVPTEESKTFAQENQLLFTETSALNSENVDKAFEELINTIYQKVSKHQMDLGDSSANGNANGASAPNGPTISLTPTPNENKKANGNNC 222          
BLAST of Ras-related protein Rab-3 vs. Ensembl Yeast
Match: YPT6 (Rab family GTPase; required for endosome-to-Golgii, intra-Golgi retrograde, and retrograde Golgi-to-ER transport; temporarily at the Golgi, dissociating into the cytosol on arrival of the late Golgi GTPase Ypt32p; Golgi-localized form is GTP bound, while cytosolic form is GDP-bound; required for delivery of Atg9p to the phagophore assembly site during autophagy under heat stress, with Ypt6p for starvation induced autophagy and for the CVT pathway; homolog of mammalian Rab6 [Source:SGD;Acc:S000004252])

HSP 1 Score: 132.494 bits (332), Expect = 9.070e-38
Identity = 75/205 (36.59%), Postives = 119/205 (58.05%), Query Frame = 2
Query:  137 FKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWD-NAQVVLVGNKVDLDYERVISIDRGRQLASQLGLE-FFETSAKENLHVKSVFERLVDIICD-KMSESLDTDPSIVNNPNKGTRLADETNKALPND---CQC 733
            +K++ +G   VGKTS + R+  D+F   + +T+GIDF  KT+   DK ++LQ+WDTAGQER+R++  +Y R +   I++YDIT  +SF  +  W+  +K    D N  + +VGNK DL  ER IS + G + A  LG + F ETS K   +VK++F+++   + + + SES   D    N+ N+      + + A   +   CQC
Sbjct:   11 YKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDVKNERGDENVILCIVGNKSDLSDERQISTEEGEKKAKLLGAKIFMETSTKAGYNVKALFKKIAKSLPEFQNSESTPLDSENANSANQNKPGVIDISTAEEQEQSACQC 215          
BLAST of Ras-related protein Rab-3 vs. Ensembl Nematostella
Match: EDO34944 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMW8])

HSP 1 Score: 342.813 bits (878), Expect = 1.637e-119
Identity = 165/207 (79.71%), Postives = 183/207 (88.41%), Query Frame = 2
Query:  116 DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKG-TRLADETNKALPNDCQC 733
            DQNFDYMFKLLIIGNS+VGKTSFLFRYADDSFTSAFVSTVGIDFKVKT+ R DK+VKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESF AVQDW TQ+KTYSW NAQV+LVGNK D++ ERV+S DRG+QLA QLGLEF+ETSAK+N +VK VFERLVDIICDKMS+SLDTDP+IV+    G T+L  E  K   ++C C
Sbjct:   15 DQNFDYMFKLLIIGNSAVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRNDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFQAVQDWSTQVKTYSWANAQVILVGNKCDMEEERVVSYDRGKQLADQLGLEFYETSAKDNTNVKKVFERLVDIICDKMSQSLDTDPTIVSGQKPGTTKLTAERPKQNQDNCAC 221          
BLAST of Ras-related protein Rab-3 vs. Ensembl Nematostella
Match: EDO47471 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMA6])

HSP 1 Score: 201.83 bits (512), Expect = 1.878e-64
Identity = 89/180 (49.44%), Postives = 135/180 (75.00%), Query Frame = 2
Query:  119 QNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPS 658
            +++DY+FKLL+IG+S VGKT  LFR++DD+F + F+ST+GIDFK+KTI  + KK+KLQIWDTAGQER+ TITT+YYRGAMG +L+YDIT E++F+ +  W+  I+ ++ ++ + +++GNK D+D  R++S +RG Q+A + G+ F ETSAK N++++  F+ L   I  K       +PS
Sbjct:    4 KSYDYLFKLLLIGDSGVGKTCILFRFSDDAFNTTFISTIGIDFKIKTIEMQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITQEKTFDNISKWLRNIEEHANEDVEKMILGNKCDMDDRRIVSRERGEQIAREHGIRFLETSAKTNINIEQAFQYLAQDILKKELNKDSEEPS 183          
BLAST of Ras-related protein Rab-3 vs. Ensembl Nematostella
Match: EDO41018 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5I6])

HSP 1 Score: 197.978 bits (502), Expect = 6.388e-63
Identity = 91/181 (50.28%), Postives = 139/181 (76.80%), Query Frame = 2
Query:  119 QNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLD-TDPS 658
            + +D++FKLL+IG+S VGKT  LFR+++D+F S F+ST+GIDFK++TI    KK+KLQIWDTAGQER+RTITTAYYRGAMG +L+YDITN++SF  +++W+  I+ ++  + + +++GNK D++  R +S +RG QLA + G++F ETSAK +++V+  F  L   I  KM + L+ ++P+
Sbjct:    3 KTYDFLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNDKSFENIKNWIRNIEEHASQDVEKMVLGNKCDMEDRRQVSKERGEQLAVEYGIKFMETSAKASINVEEAFFTLARDIKLKMDKKLENSNPA 183          
BLAST of Ras-related protein Rab-3 vs. Ensembl Nematostella
Match: EDO40845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5Z2])

HSP 1 Score: 190.66 bits (483), Expect = 3.066e-60
Identity = 90/174 (51.72%), Postives = 128/174 (73.56%), Query Frame = 2
Query:  128 DYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVF----ERLVDIICDKMSE 637
            D  FKLL+IG+S VGKT  +FR+AD++F  +F+ST+GIDFK+KT+    KK+KLQIWDTAGQER+ TITTAYYRGAMG +L+YD+TNE+SF+ +  W+ +I  ++ ++ + +LVGNK D+  +RVIS  +G QLAS  G+ F ETSA  N++V+  F    E +++ +C    E
Sbjct:    7 DLFFKLLLIGDSGVGKTCIIFRFADNTFNPSFISTIGIDFKIKTLELGGKKIKLQIWDTAGQERFHTITTAYYRGAMGIMLVYDVTNEKSFSNISKWLKKIDDHANEDVKRMLVGNKCDMYDKRVISQTKGEQLASSYGISFIETSALSNINVEKSFVVLTEDILNAVCPPTVE 180          
BLAST of Ras-related protein Rab-3 vs. Ensembl Nematostella
Match: EDO40167 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S806])

HSP 1 Score: 189.889 bits (481), Expect = 1.045e-59
Identity = 84/175 (48.00%), Postives = 126/175 (72.00%), Query Frame = 2
Query:  116 DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSES 640
            +  +DY+FKLL+IG+S VGK+  L R+ADD++T +++ST+G+DFK++TI    K +KLQIWDTAGQER+RTIT++YYRGA G I++YD+T++ESFN V+ W+ +I  Y+ +N   +LVGNK DL  ++V+     ++ A  LG+ F ETSAK   +V+  F  +   I ++M  S
Sbjct:    5 NPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYACENVNKLLVGNKCDLTTKKVVDFTTAKEYAESLGVPFLETSAKNATNVEQAFMTMAAEIKNRMGPS 179          
BLAST of Ras-related protein Rab-3 vs. Ensembl Medaka
Match: rab3c (RAB3C, member RAS oncogene family [Source:NCBI gene;Acc:101166306])

HSP 1 Score: 332.028 bits (850), Expect = 7.998e-115
Identity = 160/209 (76.56%), Postives = 177/209 (84.69%), Query Frame = 2
Query:  116 DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALP---NDCQC 733
            DQNFDYMFKLLIIGNSSVGKTSFLFRYADD+FTSAFVSTVGIDFKVKT+ + DK++KLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESF AVQDW TQIKTYSWDNAQVVL GNK D++ ERV+S++ GR LA QLG EFFETSAK+N++VK  FERLVD+ICDKMSESLDTDP++      G   A  T+ A P     C C
Sbjct:   22 DQNFDYMFKLLIIGNSSVGKTSFLFRYADDAFTSAFVSTVGIDFKVKTVYKNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFGAVQDWSTQIKTYSWDNAQVVLAGNKCDMEEERVVSVESGRLLAEQLGFEFFETSAKDNINVKQTFERLVDLICDKMSESLDTDPAVTT----GAPTAKLTDSAPPLQQQGCNC 226          
BLAST of Ras-related protein Rab-3 vs. Ensembl Medaka
Match: rab3c (RAB3C, member RAS oncogene family [Source:NCBI gene;Acc:101166306])

HSP 1 Score: 331.257 bits (848), Expect = 1.155e-114
Identity = 160/209 (76.56%), Postives = 177/209 (84.69%), Query Frame = 2
Query:  116 DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALP---NDCQC 733
            DQNFDYMFKLLIIGNSSVGKTSFLFRYADD+FTSAFVSTVGIDFKVKT+ + DK++KLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESF AVQDW TQIKTYSWDNAQVVL GNK D++ ERV+S++ GR LA QLG EFFETSAK+N++VK  FERLVD+ICDKMSESLDTDP++      G   A  T+ A P     C C
Sbjct:   15 DQNFDYMFKLLIIGNSSVGKTSFLFRYADDAFTSAFVSTVGIDFKVKTVYKNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFGAVQDWSTQIKTYSWDNAQVVLAGNKCDMEEERVVSVESGRLLAEQLGFEFFETSAKDNINVKQTFERLVDLICDKMSESLDTDPAVTT----GAPTAKLTDSAPPLQQQGCNC 219          
BLAST of Ras-related protein Rab-3 vs. Ensembl Medaka
Match: rab3c (RAB3C, member RAS oncogene family [Source:NCBI gene;Acc:101166306])

HSP 1 Score: 331.257 bits (848), Expect = 1.504e-114
Identity = 160/209 (76.56%), Postives = 177/209 (84.69%), Query Frame = 2
Query:  116 DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALP---NDCQC 733
            DQNFDYMFKLLIIGNSSVGKTSFLFRYADD+FTSAFVSTVGIDFKVKT+ + DK++KLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESF AVQDW TQIKTYSWDNAQVVL GNK D++ ERV+S++ GR LA QLG EFFETSAK+N++VK  FERLVD+ICDKMSESLDTDP++      G   A  T+ A P     C C
Sbjct:   21 DQNFDYMFKLLIIGNSSVGKTSFLFRYADDAFTSAFVSTVGIDFKVKTVYKNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFGAVQDWSTQIKTYSWDNAQVVLAGNKCDMEEERVVSVESGRLLAEQLGFEFFETSAKDNINVKQTFERLVDLICDKMSESLDTDPAVTT----GAPTAKLTDSAPPLQQQGCNC 225          
BLAST of Ras-related protein Rab-3 vs. Ensembl Medaka
Match: rab3ab (RAB3A, member RAS oncogene family [Source:NCBI gene;Acc:101167944])

HSP 1 Score: 330.487 bits (846), Expect = 2.300e-114
Identity = 159/210 (75.71%), Postives = 179/210 (85.24%), Query Frame = 2
Query:  107 KDTDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPN-DCQC 733
            + +DQNFDYMFK+LIIGNSSVGKTSFLFRYADDSFT AFVSTVGIDFKVKTI R DK++KLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNE+SFNAVQDW TQIKTYSWDNAQV+LVGNK D++ ERV+S DRGRQL+  LG EFFE SAK+N++VK  FERLVDIIC+KMSESLD     V    +G +L ++   A P+ DC C
Sbjct:   12 ESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEDSFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSADRGRQLSEHLGFEFFEASAKDNINVKQTFERLVDIICEKMSESLDAGDPAVTGAKQGPQLTEQ--PAPPHQDCAC 219          
BLAST of Ras-related protein Rab-3 vs. Ensembl Medaka
Match: rab3ab (RAB3A, member RAS oncogene family [Source:NCBI gene;Acc:101167944])

HSP 1 Score: 330.487 bits (846), Expect = 2.300e-114
Identity = 159/210 (75.71%), Postives = 179/210 (85.24%), Query Frame = 2
Query:  107 KDTDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPN-DCQC 733
            + +DQNFDYMFK+LIIGNSSVGKTSFLFRYADDSFT AFVSTVGIDFKVKTI R DK++KLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNE+SFNAVQDW TQIKTYSWDNAQV+LVGNK D++ ERV+S DRGRQL+  LG EFFE SAK+N++VK  FERLVDIIC+KMSESLD     V    +G +L ++   A P+ DC C
Sbjct:   12 ESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEDSFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSADRGRQLSEHLGFEFFEASAKDNINVKQTFERLVDIICEKMSESLDAGDPAVTGAKQGPQLTEQ--PAPPHQDCAC 219          
BLAST of Ras-related protein Rab-3 vs. Planmine SMEST
Match: SMESG000034019.1 (SMESG000034019.1)

HSP 1 Score: 442.965 bits (1138), Expect = 5.863e-159
Identity = 214/214 (100.00%), Postives = 214/214 (100.00%), Query Frame = 2
Query:   92 MSANSKDTDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPNDCQC 733
            MSANSKDTDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPNDCQC
Sbjct:    1 MSANSKDTDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPNDCQC 214          
BLAST of Ras-related protein Rab-3 vs. Planmine SMEST
Match: SMESG000037789.1 (SMESG000037789.1)

HSP 1 Score: 332.028 bits (850), Expect = 3.903e-115
Identity = 160/213 (75.12%), Postives = 185/213 (86.85%), Query Frame = 2
Query:  101 NSKDTDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRL--ADETNKALPNDCQC 733
            N + +DQNFDYMFKLL+IGNSSVGKTSFLFRYAD+SF+SAFV+TVGIDFKVKT+ R DK+VKLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESFNAV DW+ QIKTYSWDNAQVVLVGNK DL+ ++VISI RG+QLA QLG+EFFE+SAKEN++VK VFERLVDIIC+KM ES++ +P + N   KG +L  A ET+      CQC
Sbjct:    2 NKELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETD---GQGCQC 211          
BLAST of Ras-related protein Rab-3 vs. Planmine SMEST
Match: SMESG000055715.1 (SMESG000055715.1)

HSP 1 Score: 309.301 bits (791), Expect = 2.318e-106
Identity = 143/193 (74.09%), Postives = 172/193 (89.12%), Query Frame = 2
Query:  134 MFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKA 712
            MFKLL+IGNSSVGKTSFLFRYAD+SFTSAFV+TVGIDFKVKT+ R+DK+VKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNE++FN VQDWVTQIKTYSWDNAQ++LVGNK DL+  R +S +R +QLA  L L+FFETSAKEN++VK+VFERLVD+ICDKM+E +D+ P++VN     +   D+T+++
Sbjct:    1 MFKLLLIGNSSVGKTSFLFRYADNSFTSAFVATVGIDFKVKTVFRQDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEDTFNCVQDWVTQIKTYSWDNAQIILVGNKCDLEENRAVSTERAKQLADYLNLDFFETSAKENINVKAVFERLVDVICDKMAECIDSSPALVNGHLLKSMHEDDTSES 193          
BLAST of Ras-related protein Rab-3 vs. Planmine SMEST
Match: SMESG000026178.1 (SMESG000026178.1)

HSP 1 Score: 195.282 bits (495), Expect = 1.859e-61
Identity = 89/174 (51.15%), Postives = 130/174 (74.71%), Query Frame = 2
Query:  125 FDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLD 646
            +D++FKLL+IG+S VGKTS LFR+++D+F + F++T+GIDFK++TI    KK+KLQIWDTAGQER+RTITTAYYRGAMG +L+YD+T+E+SFN +  W+  I  ++  + + +L+GNK D++ +R +  D GR+LA   G++F ETSAK   +V   F +L   I +KM +  D
Sbjct:    5 YDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSD 178          
BLAST of Ras-related protein Rab-3 vs. Planmine SMEST
Match: SMESG000035214.1 (SMESG000035214.1)

HSP 1 Score: 192.586 bits (488), Expect = 2.296e-60
Identity = 85/180 (47.22%), Postives = 133/180 (73.89%), Query Frame = 2
Query:  119 QNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPS 658
            +++D +FKLL+IG+S VGKT  LFRYADD+F++ F+ST+GIDFK+KTI    K++KLQIWDTAGQER+ TIT +YYRGAMG +L+YD+TN++SF+ +  W+T I++++ ++ + ++V NK+D++ +RV++ D G  +A    + F E SAK  ++V   FE+L   I  K+  + ++  S
Sbjct:    4 KSYDLLFKLLLIGDSGVGKTCLLFRYADDTFSTTFISTIGIDFKIKTIEMNGKRIKLQIWDTAGQERFHTITMSYYRGAMGIMLVYDVTNKKSFDNISKWLTNIQSHASESVEKLIVANKIDMEEKRVVTKDIGENIAVANKVSFLEVSAKTGVNVPQAFEKLTMAILAKVPNTKESAES 183          
The following BLAST results are available for this feature:
BLAST of Ras-related protein Rab-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAB3C8.137e-11778.26RAB3C, member RAS oncogene family [Source:HGNC Sym... [more]
RAB3B4.005e-11576.81RAB3B, member RAS oncogene family [Source:HGNC Sym... [more]
RAB3A7.009e-11576.92RAB3A, member RAS oncogene family [Source:HGNC Sym... [more]
RAB3D1.491e-10672.46RAB3D, member RAS oncogene family [Source:HGNC Sym... [more]
RAB3D1.491e-10672.46RAB3D, member RAS oncogene family [Source:HGNC Sym... [more]
back to top
BLAST of Ras-related protein Rab-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab-32.755e-12078.97Ras-related protein Rab-3 [Source:UniProtKB/Swiss... [more]
rab-34.043e-12078.97Ras-related protein Rab-3 [Source:UniProtKB/Swiss... [more]
rab-81.315e-6551.87RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
rab-81.315e-6551.87RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
rab-101.809e-6349.47Ras-related protein Rab-10 [Source:UniProtKB/Swis... [more]
back to top
BLAST of Ras-related protein Rab-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab33.453e-12380.68gene:FBgn0005586 transcript:FBtr0473383[more]
Rab33.453e-12380.68gene:FBgn0005586 transcript:FBtr0088257[more]
Rab104.868e-6450.00gene:FBgn0015789 transcript:FBtr0077337[more]
Rab82.660e-6350.00gene:FBgn0262518 transcript:FBtr0308833[more]
Rab82.660e-6350.00gene:FBgn0262518 transcript:FBtr0074921[more]
back to top
BLAST of Ras-related protein Rab-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab3c4.538e-11573.68RAB3C, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab3c4.538e-11573.68RAB3C, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab3c6.593e-11573.68RAB3C, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab3ab2.554e-11274.29RAB3A, member RAS oncogene family, b [Source:ZFIN;... [more]
rab3da6.091e-11275.73RAB3D, member RAS oncogene family, a [Source:ZFIN;... [more]
back to top
BLAST of Ras-related protein Rab-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab3a7.704e-11677.14RAB3A, member RAS oncogene family [Source:NCBI gen... [more]
rab3b1.460e-11276.44RAB3B, member RAS oncogene family [Source:NCBI gen... [more]
RAB3C2.173e-11077.14RAB3C, member RAS oncogene family [Source:NCBI gen... [more]
RAB3C2.605e-11077.14RAB3C, member RAS oncogene family [Source:NCBI gen... [more]
tekt15.356e-10873.91tektin 1 [Source:Xenbase;Acc:XB-GENE-5929242][more]
back to top
BLAST of Ras-related protein Rab-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab3c4.175e-11677.29RAB3C, member RAS oncogene family [Source:MGI Symb... [more]
Rab3c9.133e-11677.29RAB3C, member RAS oncogene family [Source:MGI Symb... [more]
Rab3a1.282e-11577.40Ras-related protein Rab-3A [Source:UniProtKB/Swis... [more]
Rab3a1.282e-11577.40Ras-related protein Rab-3A [Source:UniProtKB/Swis... [more]
Rab3a1.282e-11577.40RAB3A, member RAS oncogene family [Source:MGI Symb... [more]
back to top
BLAST of Ras-related protein Rab-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P25228|RAB3_DROME3.462e-12280.68Ras-related protein Rab-3 OS=Drosophila melanogast... [more]
sp|Q94986|RAB3_CAEEL5.143e-11978.97Ras-related protein Rab-3 OS=Caenorhabditis elegan... [more]
sp|Q96E17|RAB3C_HUMAN3.907e-11678.26Ras-related protein Rab-3C OS=Homo sapiens OX=9606... [more]
sp|P10949|RAB3C_BOVIN6.461e-11678.26Ras-related protein Rab-3C OS=Bos taurus OX=9913 G... [more]
sp|P62824|RAB3C_RAT2.920e-11577.29Ras-related protein Rab-3C OS=Rattus norvegicus OX... [more]
back to top
BLAST of Ras-related protein Rab-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3H6N11.909e-12479.73ras-related protein Rab-3 isoform X5 OS=Lingula un... [more]
Q253894.979e-12483.98Rab3 OS=Doryteuthis pealeii OX=1051067 PE=4 SV=2[more]
A0A1S3H6L25.852e-12484.47ras-related protein Rab-3 isoform X6 OS=Lingula un... [more]
A0A1S3H8226.518e-12484.47ras-related protein Rab-3 isoform X4 OS=Lingula un... [more]
A0A1S3H6M61.230e-12384.47ras-related protein Rab-3 isoform X1 OS=Lingula un... [more]
back to top
BLAST of Ras-related protein Rab-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAB3C1.015e-11874.42RAB3C, member RAS oncogene family [Source:HGNC Sym... [more]
rab3b7.078e-11577.56ras-related protein Rab-3B [Source:NCBI gene;Acc:1... [more]
rab3ab3.766e-11374.76RAB3A, member RAS oncogene family [Source:NCBI gen... [more]
rab3ab3.766e-11374.76RAB3A, member RAS oncogene family [Source:NCBI gen... [more]
rab3aa1.213e-11274.76ras-related protein Rab-3A-like [Source:NCBI gene;... [more]
back to top
BLAST of Ras-related protein Rab-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab3c1.252e-10872.77RAB3C, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab8a1.428e-6347.45RAB8A, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab1aa3.158e-5747.40RAB1A, member RAS oncogene family a [Source:ZFIN;A... [more]
rab8a5.116e-5547.06RAB8A, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab27a3.122e-4636.49RAB27A, member RAS oncogene family [Source:ZFIN;Ac... [more]
back to top
BLAST of Ras-related protein Rab-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SEC43.898e-5848.30Rab family GTPase; essential for vesicle-mediated ... [more]
YPT11.057e-5547.95Rab family GTPase; involved in the ER-to-Golgi ste... [more]
YPT321.205e-4540.53Rab family GTPase involved in the exocytic pathway... [more]
YPT311.520e-4536.82Rab family GTPase; involved in the exocytic pathwa... [more]
YPT69.070e-3836.59Rab family GTPase; required for endosome-to-Golgii... [more]
back to top
BLAST of Ras-related protein Rab-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO349441.637e-11979.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474711.878e-6449.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410186.388e-6350.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408453.066e-6051.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401671.045e-5948.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ras-related protein Rab-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab3c7.998e-11576.56RAB3C, member RAS oncogene family [Source:NCBI gen... [more]
rab3c1.155e-11476.56RAB3C, member RAS oncogene family [Source:NCBI gen... [more]
rab3c1.504e-11476.56RAB3C, member RAS oncogene family [Source:NCBI gen... [more]
rab3ab2.300e-11475.71RAB3A, member RAS oncogene family [Source:NCBI gen... [more]
rab3ab2.300e-11475.71RAB3A, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of Ras-related protein Rab-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000034019.15.863e-159100.00SMESG000034019.1[more]
SMESG000037789.13.903e-11575.12SMESG000037789.1[more]
SMESG000055715.12.318e-10674.09SMESG000055715.1[more]
SMESG000026178.11.859e-6151.15SMESG000026178.1[more]
SMESG000035214.12.296e-6047.22SMESG000035214.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014149 ID=SMED30014149|Name=Ras-related protein Rab-3|organism=Schmidtea mediterranea sexual|type=transcript|length=976bp
TTTTCTCTTATTAGATTTCGTGAATTAAGTCATTTTTTGTTTTAAACAAT
AGTTATACTTCAATTTTTTCTCCTCGATAAACCAATTTGTCATGAGTGCC
AATTCAAAGGATACAGATCAAAACTTTGATTACATGTTCAAGTTGTTGAT
TATTGGGAATTCATCAGTTGGTAAAACTTCTTTTCTTTTTCGATATGCTG
ATGACAGTTTTACGTCGGCTTTCGTTTCAACTGTTGGCATAGATTTTAAA
GTGAAAACTATTGTTAGGAGAGACAAGAAAGTAAAATTACAGATTTGGGA
CACTGCCGGACAGGAGAGATATAGGACGATTACGACAGCTTATTATCGAG
GTGCGATGGGATTCATTTTAATGTATGACATAACCAATGAAGAATCATTC
AATGCCGTTCAAGATTGGGTCACTCAGATCAAAACTTATTCGTGGGACAA
TGCTCAAGTTGTCTTAGTTGGAAATAAAGTGGACTTAGATTATGAAAGAG
TCATTTCAATTGACCGTGGCCGCCAGTTAGCAAGTCAATTGGGACTGGAA
TTTTTCGAGACTTCAGCAAAAGAAAATCTGCATGTCAAATCGGTTTTTGA
GAGATTAGTAGACATTATATGTGATAAGATGAGTGAGAGTCTTGATACAG
ATCCATCTATTGTCAATAATCCGAATAAAGGTACAAGGCTAGCAGATGAA
ACTAATAAAGCTCTCCCAAATGATTGTCAGTGTTGATTTATTGTGAAAAG
CATGATTTTTAAACCTGTTTCCTTTTATTATCCGGACACGAAATTAGCTG
TGCAGGATATTATATAGATGGATTGATTGAAATTATTGTGTTATTTGCCA
ATCATTTATAATAATTGGATGTGAATAAAGTATTTAATTAGGAGCTAATA
TAAATATTATTTAAACAACAGGTACAATTAGATATTAGAAGTATTTTTGA
TGAAGTATGTTTGTAATTTCCACAGT
back to top

protein sequence of SMED30014149-orf-1

>SMED30014149-orf-1 ID=SMED30014149-orf-1|Name=SMED30014149-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=215bp
MSANSKDTDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGI
DFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNE
ESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQL
GLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRL
ADETNKALPNDCQC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR027417P-loop_NTPase
IPR001806Small_GTPase
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0000166nucleotide binding
GO:0003924GTPase activity
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
GO:0048790maintenance of presynaptic active zone structure
GO:0006810transport
GO:0006887exocytosis
GO:0007269neurotransmitter secretion
GO:0015031protein transport
GO:0016192vesicle-mediated transport
GO:0031630regulation of synaptic vesicle fusion to presynaptic active zone membrane
GO:0032482Rab protein signal transduction
GO:0048172regulation of short-term neuronal synaptic plasticity
GO:0048789cytoskeletal matrix organization at active zone
Vocabulary: cellular component
TermDefinition
GO:0008021synaptic vesicle
GO:0030054cell junction
GO:0031410cytoplasmic vesicle
GO:0031982vesicle
GO:0045202synapse
GO:0048786presynaptic active zone
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 16..37
score: 43.78
coord: 119..132
score: 52.58
coord: 154..176
score: 39.25
coord: 57..79
score: 52.61
coord: 39..55
score: 30.65
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 16..179
e-value: 1.8E-28
score: 110.6
NoneNo IPR availableSMARTSM00176ran_sub_2coord: 21..214
e-value: 3.4E-5
score: 24.7
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 16..179
e-value: 2.5E-91
score: 319.4
NoneNo IPR availableSMARTSM00174rho_sub_3coord: 18..179
e-value: 2.9E-12
score: 37.2
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1..182
e-value: 2.9E-64
score: 217.8
NoneNo IPR availablePANTHERPTHR24073FAMILY NOT NAMEDcoord: 6..208
NoneNo IPR availablePANTHERPTHR24073:SF853RAS-RELATED PROTEIN RAB-3coord: 6..208
NoneNo IPR availablePROSITEPS51419RABcoord: 11..214
score: 34.363
IPR001806Small GTPasePFAMPF00071Rascoord: 17..176
e-value: 8.1E-60
score: 201.1
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 14..169
e-value: 1.8E-25
score: 87.6
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 11..187