Phytanoyl-CoA dioxygenase domain-containing protein 1-like

Overview
NamePhytanoyl-CoA dioxygenase domain-containing protein 1-like
Smed IDSMED30014144
Length (bp)1274
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phytanoyl-CoA dioxygenase domain-containing protein 1-like (SMED30014144) t-SNE clustered cells

Violin plots show distribution of expression levels for Phytanoyl-CoA dioxygenase domain-containing protein 1-like (SMED30014144) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phytanoyl-CoA dioxygenase domain-containing protein 1-like (SMED30014144) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phytanoyl-CoA dioxygenase domain-containing protein 1-like (SMED30014144) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014144

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30014144SMESG000023010.1 dd_Smed_v4_1207_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30014144SMESG000023010.1 dd_Smed_v4_1207_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30014144SMESG000023010.1 dd_Smed_v4_1207_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
posterior region of the whole animalSMED30014144SMESG000023010.1 dd_Smed_v4_1207_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014144SMESG000023010.1 dd_Smed_v4_1207_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30014144SMESG000023010.1 dd_Smed_v4_1207_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014144SMESG000023010.1 dd_Smed_v4_1207_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. Ensembl Human
Match: PHYH (phytanoyl-CoA 2-hydroxylase [Source:HGNC Symbol;Acc:HGNC:8940])

HSP 1 Score: 51.6026 bits (122), Expect = 1.229e-6
Identity = 67/272 (24.63%), Postives = 117/272 (43.01%), Query Frame = 2
Query:   56 HPEVYQKYKRSNPRKPGQLTDEQLAEINENGYILVKDFFTPEEIQVAKDEVIRLLDELAKKLYKANKITSLHEDKNFYDRLIAIEK-EFPGANIILHKVGAF--DEPFQKLATNERLLNLLEDFLGPNITFNPVWNLRTKTPNNDATVV--PWHQDAGYFSQESFTMLIMTAWIPLIHATFENGTMQMVKRAHKDALVGVH-----ECCAGPTWYLMLDEKEIESRFNVSIEKDSEIIDVPEGSFILFNQFTPHRSLPNTSNIVRWALDFRW 841
            HP+ +Q    +N      LT EQ     ENG++++K+     +IQ  ++E     +++ +K  K   +T +        R + I K E+  +  ++ KV  F  D+   +  T   +L  +E F GPNI       L  K P++       P HQD  YF     + LI+ AW  + H +  NG + ++   HK +L   H     E      ++ + D +E ++R ++ +EK         G  + F+    H S  N +   R A+   +
Sbjct:   40 HPQQFQYTLDNNV-----LTLEQRKFYEENGFLVIKNLVPDADIQRFRNE----FEKICRKEVKPLGLTVM--------RDVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTM-LINKPPDSGKKTSRHPLHQDLHYFPFRP-SDLIVCAWTAMEHISRNNGCLVVLPGTHKGSL-KPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEK---------GDTVFFHPLLIHGSGQNKTQGFRKAISCHF 282          
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. Ensembl Human
Match: PHYH (phytanoyl-CoA 2-hydroxylase [Source:HGNC Symbol;Acc:HGNC:8940])

HSP 1 Score: 51.2174 bits (121), Expect = 1.754e-6
Identity = 66/273 (24.18%), Postives = 117/273 (42.86%), Query Frame = 2
Query:   56 HPEVYQKYKRSNPRKPGQLTDEQLAEINENGYILVKDFFTPEEIQVAKDEVIRLLDELAKKLYKANKITSLHEDKNFYDRLIAIEK-EFPGANIILHKVGAF--DEPFQKLATNERLLNLLEDFLGPNITFNPVWNLRTKTPNN----DATVVPWHQDAGYFSQESFTMLIMTAWIPLIHATFENGTMQMVKRAHKDALVGVH----ECCAGPTWYLMLDEKEIESRFNVSIEKDSEIIDVPEGSFILFNQFTPHRSLPNTSNIVRWALDFRW 841
            HP+ +Q    +N      LT EQ     ENG++++K+     +IQ  ++E     +++ +K  K   +T +        R + I K E+  +  ++ KV  F  D+   +  T   +L  +E F GPNI       L  K P++      +  P HQD  YF     + LI+ AW  + H +  NG + ++   HK +L        E      ++ + D +E ++R ++ +EK         G  + F+    H S  N +   R A+   +
Sbjct:   21 HPQQFQYTLDNN-----VLTLEQRKFYEENGFLVIKNLVPDADIQRFRNE----FEKICRKEVKPLGLTVM--------RDVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTM-LINKPPDSGNCKKTSRHPLHQDLHYFPFRP-SDLIVCAWTAMEHISRNNGCLVVLPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEK---------GDTVFFHPLLIHGSGQNKTQGFRKAISCHF 265          
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. Ensembl Xenopus
Match: tmem163 (transmembrane protein 163 [Source:Xenbase;Acc:XB-GENE-5808413])

HSP 1 Score: 53.1434 bits (126), Expect = 2.454e-7
Identity = 54/199 (27.14%), Postives = 87/199 (43.72%), Query Frame = 2
Query:  311 KEFPGANIILHKVGAFDEPFQKLATNERLLNLLEDFLGPNITFNPVWNL----RTKTPNNDATV--VPWHQDAGYFSQESFTMLIMTAWIPLIHATFENGTMQMVKRAHKDALVGVHECCAGPTWYLMLDEKEIESRFNVSIEKDSEIIDVP--EGSFILFNQFTPHRSLPNTSNIVRWALDFRWHQTGKPSCLFGLKD 883
            KE+   N  LH +    E    LA + +LL+ +   LGPN+       +     +  P+ D TV  V WHQD  Y+  E     + + W+       ENG +Q++  +HK  ++  H     P   L+   +EI  R  V +E   ++++ P   G   + +  T H S PN SN  R     R+     P+  + +KD
Sbjct:   45 KEYTQYN--LHNIHMQYEWVMNLAAHPKLLDAITAVLGPNVILLDSRFICKYPSSDVPHKDNTVPYVAWHQDIKYWGFEGGP--VASVWLAFDDVDAENGVLQVIPGSHKQGILE-HRVAEIPG-NLLTSNQEI-PRHLVQVE---DLVECPLKAGQMSVHDGLTVHASEPNMSNRRRCGFVIRY----VPTTAYPVKD 229          
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. Ensembl Xenopus
Match: tmem163 (transmembrane protein 163 [Source:Xenbase;Acc:XB-GENE-5808413])

HSP 1 Score: 52.7582 bits (125), Expect = 3.877e-7
Identity = 54/201 (26.87%), Postives = 87/201 (43.28%), Query Frame = 2
Query:  311 KEFPGANIILHKVGAFDEPFQKLATNERLLNLLEDFLGPNITF--------NPVWNLRTKTPNNDATVVPWHQDAGYFSQESFTMLIMTAWIPLIHATFENGTMQMVKRAHKDALVGVHECCAGPTWYLMLDEKEIESRFNVSIEKDSEIIDVP--EGSFILFNQFTPHRSLPNTSNIVRWALDFRWHQTGKPSCLFGLKD 883
            KE+   N  LH +    E    LA + +LL+ +   LGPN+           P  ++  K  +N A  V WHQD  Y+  E     + + W+       ENG +Q++  +HK  ++  H     P   L+   +EI  R  V +E   ++++ P   G   + +  T H S PN SN  R     R+     P+  + +KD
Sbjct:   45 KEYTQYN--LHNIHMQYEWVMNLAAHPKLLDAITAVLGPNVILLDSRFICKYPSSDVPHK--DNTAPYVAWHQDIKYWGFEGGP--VASVWLAFDDVDAENGVLQVIPGSHKQGILE-HRVAEIPG-NLLTSNQEI-PRHLVQVE---DLVECPLKAGQMSVHDGLTVHASEPNMSNRRRCGFVIRY----VPTTAYPVKD 229          
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. Ensembl Xenopus
Match: tmem163 (transmembrane protein 163 [Source:Xenbase;Acc:XB-GENE-5808413])

HSP 1 Score: 52.373 bits (124), Expect = 4.096e-7
Identity = 54/201 (26.87%), Postives = 87/201 (43.28%), Query Frame = 2
Query:  311 KEFPGANIILHKVGAFDEPFQKLATNERLLNLLEDFLGPNITF--------NPVWNLRTKTPNNDATVVPWHQDAGYFSQESFTMLIMTAWIPLIHATFENGTMQMVKRAHKDALVGVHECCAGPTWYLMLDEKEIESRFNVSIEKDSEIIDVP--EGSFILFNQFTPHRSLPNTSNIVRWALDFRWHQTGKPSCLFGLKD 883
            KE+   N  LH +    E    LA + +LL+ +   LGPN+           P  ++  K  +N A  V WHQD  Y+  E     + + W+       ENG +Q++  +HK  ++  H     P   L+   +EI  R  V +E   ++++ P   G   + +  T H S PN SN  R     R+     P+  + +KD
Sbjct:   45 KEYTQYN--LHNIHMQYEWVMNLAAHPKLLDAITAVLGPNVILLDSRFICKYPSSDVPHK--DNTAPYVAWHQDIKYWGFEGGP--VASVWLAFDDVDAENGVLQVIPGSHKQGILE-HRVAEIPG-NLLTSNQEI-PRHLVQVE---DLVECPLKAGQMSVHDGLTVHASEPNMSNRRRCGFVIRY----VPTTAYPVKD 229          
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. Ensembl Xenopus
Match: tmem163 (transmembrane protein 163 [Source:Xenbase;Acc:XB-GENE-5808413])

HSP 1 Score: 52.373 bits (124), Expect = 4.571e-7
Identity = 54/199 (27.14%), Postives = 87/199 (43.72%), Query Frame = 2
Query:  311 KEFPGANIILHKVGAFDEPFQKLATNERLLNLLEDFLGPNITFNPVWNL----RTKTPNNDATV--VPWHQDAGYFSQESFTMLIMTAWIPLIHATFENGTMQMVKRAHKDALVGVHECCAGPTWYLMLDEKEIESRFNVSIEKDSEIIDVP--EGSFILFNQFTPHRSLPNTSNIVRWALDFRWHQTGKPSCLFGLKD 883
            KE+   N  LH +    E    LA + +LL+ +   LGPN+       +     +  P+ D TV  V WHQD  Y+  E     + + W+       ENG +Q++  +HK  ++  H     P   L+   +EI  R  V +E   ++++ P   G   + +  T H S PN SN  R     R+     P+  + +KD
Sbjct:   45 KEYTQYN--LHNIHMQYEWVMNLAAHPKLLDAIIAVLGPNVILLDSRFICKYPSSDVPHKDNTVPYVAWHQDIKYWGFEGGP--VASVWLAFDDVDAENGVLQVIPGSHKQGILE-HRVAEIPG-NLLTSNQEI-PRHLVQVE---DLVECPLKAGQMSVHDGLTVHASEPNMSNRRRCGFVIRY----VPTTAYPVKD 229          
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. Ensembl Xenopus
Match: tmem163 (transmembrane protein 163 [Source:Xenbase;Acc:XB-GENE-5808413])

HSP 1 Score: 52.373 bits (124), Expect = 4.571e-7
Identity = 54/199 (27.14%), Postives = 87/199 (43.72%), Query Frame = 2
Query:  311 KEFPGANIILHKVGAFDEPFQKLATNERLLNLLEDFLGPNITFNPVWNL----RTKTPNNDATV--VPWHQDAGYFSQESFTMLIMTAWIPLIHATFENGTMQMVKRAHKDALVGVHECCAGPTWYLMLDEKEIESRFNVSIEKDSEIIDVP--EGSFILFNQFTPHRSLPNTSNIVRWALDFRWHQTGKPSCLFGLKD 883
            KE+   N  LH +    E    LA + +LL+ +   LGPN+       +     +  P+ D TV  V WHQD  Y+  E     + + W+       ENG +Q++  +HK  ++  H     P   L+   +EI  R  V +E   ++++ P   G   + +  T H S PN SN  R     R+     P+  + +KD
Sbjct:   45 KEYTQYN--LHNIHMQYEWVMNLAAHPKLLDAIIAVLGPNVILLDSRFICKYPSSDVPHKDNTVPYVAWHQDIKYWGFEGGP--VASVWLAFDDVDAENGVLQVIPGSHKQGILE-HRVAEIPG-NLLTSNQEI-PRHLVQVE---DLVECPLKAGQMSVHDGLTVHASEPNMSNRRRCGFVIRY----VPTTAYPVKD 229          
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. UniProt/SwissProt
Match: sp|Q54XH6|PHYD1_DICDI (Phytanoyl-CoA dioxygenase domain-containing protein 1 homolog OS=Dictyostelium discoideum OX=44689 GN=phyhd1 PE=3 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 4.012e-6
Identity = 52/269 (19.33%), Postives = 115/269 (42.75%), Query Frame = 2
Query:  107 QLTDEQLAEINENGYILVKDFFTPEEIQVAKDEVIRLLDELAKK-------------------LYKANKITSLHEDKNFYDRLIAIEKEFPGANIILHKVGAFDEPFQKLATNERLLNLLEDFLGPNITFNPV-WNLRTKTPNNDATVVPWHQDAGYFSQESFTMLIMTAWIPLIHATFENGTMQMVKRAHKDAL----VGVHECCAGPTWYLMLDEKEIESRFNVSIEKDSEIIDVPEGSFILFNQFTPHRSLPNTSNIVRWALDFRW 841
            +LT+EQ+A+  ++G++++++F T EEI + + E+ +L+DEL                      L   +KI    E  +  D  + + K+    N + H +   +  F++ + ++++ +L+      N   + + +  + +    +  +   HQD+ +      T      W     +T ENG ++ +  +H + +    +      +G ++  + ++K+      V++E         +G  IL +    H S PNTS   R A    +
Sbjct:    2 KLTEEQVAQYKKDGFLIIRNFNTTEEIDIVRGEMKKLIDELDTPSTISIFTTSEQERKVDDYFLGSGDKIRYFFEKGSIEDGKLIVPKDM-AFNKVGHALHDLNPKFEEFSYSQKIHDLIYSLGIYNKALSGIMYIFKNQKIGGEVDI---HQDSTFLHTTPLTT--HAIWFAFEDSTIENGCLRGLPGSHTEGITRRFITDPNSESGCSFIKLAEDKQYNKSDFVALE-------CKKGDIILLDGSVVHYSEPNTSPNSRHAYTLHF 257          
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. UniProt/SwissProt
Match: sp|O14832|PAHX_HUMAN (Phytanoyl-CoA dioxygenase, peroxisomal OS=Homo sapiens OX=9606 GN=PHYH PE=1 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 5.903e-6
Identity = 67/272 (24.63%), Postives = 117/272 (43.01%), Query Frame = 2
Query:   56 HPEVYQKYKRSNPRKPGQLTDEQLAEINENGYILVKDFFTPEEIQVAKDEVIRLLDELAKKLYKANKITSLHEDKNFYDRLIAIEK-EFPGANIILHKVGAF--DEPFQKLATNERLLNLLEDFLGPNITFNPVWNLRTKTPNNDATVV--PWHQDAGYFSQESFTMLIMTAWIPLIHATFENGTMQMVKRAHKDALVGVH-----ECCAGPTWYLMLDEKEIESRFNVSIEKDSEIIDVPEGSFILFNQFTPHRSLPNTSNIVRWALDFRW 841
            HP+ +Q    +N      LT EQ     ENG++++K+     +IQ  ++E     +++ +K  K   +T +        R + I K E+  +  ++ KV  F  D+   +  T   +L  +E F GPNI       L  K P++       P HQD  YF     + LI+ AW  + H +  NG + ++   HK +L   H     E      ++ + D +E ++R ++ +EK         G  + F+    H S  N +   R A+   +
Sbjct:   40 HPQQFQYTLDNNV-----LTLEQRKFYEENGFLVIKNLVPDADIQRFRNE----FEKICRKEVKPLGLTVM--------RDVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTM-LINKPPDSGKKTSRHPLHQDLHYFPFRP-SDLIVCAWTAMEHISRNNGCLVVLPGTHKGSL-KPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEK---------GDTVFFHPLLIHGSGQNKTQGFRKAISCHF 282          
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. UniProt/SwissProt
Match: sp|Q10E49|PAHX1_ORYSJ (Phytanoyl-CoA dioxygenase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0708100 PE=2 SV=1)

HSP 1 Score: 50.8322 bits (120), Expect = 9.322e-6
Identity = 74/297 (24.92%), Postives = 116/297 (39.06%), Query Frame = 2
Query:  104 GQLTDEQLAEINENGYILVKDFFTPEEIQVAKDEVIRLLDEL--AKKLY---------------KANKITSLHEDKNFYDRLIAIEKEFPGANIILHKVGAFDEPFQKLATNERLLNLLED--FLGPNITFNPVWNLRT-KTPNNDATVVPWHQDAGYFSQE--SFTMLIMTAWIPLIHATFENGTMQMVKRAHKDAL--------VGVHECCAGPTWYLMLDEKEIESRFNVSIEKDSEIIDVPEGSFILFNQFTPHRSLPNTSNIVRWALDFRWHQTGKPSCLFGLKDGCEVRKE 904
            G LTDEQL   + NGY+++  F + EE++  +D +  L+D    A  ++                A  I+   E+K F D     + +    N + H +   D  F+K +    + +L     +  P +    + ++   K P     VVP HQD  +   +  S T L    W+ L  AT  NG +  +  +HK+ L        +  H     PT+    D KE      V +E  S  + V  G  I       H+S  N S + R AL      T          +GCE  K+
Sbjct:    5 GSLTDEQLRFFDANGYLVLGSFSSAEEVRAMRDRMAELVDGFDGAGDVFSTKDHRQVKNDFFFKSAENISFFFEEKAFGDDGCLKQAKELSINKVGHALHELDPVFKKFSFGANVSSLFSSLRYKRPAV----IQSMYIFKQPGIGGEVVP-HQDNTFLYTDPPSCTGL----WLALEDATKTNGCLWAIPGSHKNGLKRRMIRDEIDTHFDHPSPTY----DLKEF-----VPLEVKSGDLVVIHGDLI-------HQSFENLSPVSRHALSLHVIDT----------EGCEWSKQ 266          
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. TrEMBL
Match: A0A1I8HS86 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 426.017 bits (1094), Expect = 1.006e-144
Identity = 197/362 (54.42%), Postives = 254/362 (70.17%), Query Frame = 2
Query:   38 GFTGEKHPEVYQKYKRSNPRKPGQLTDEQLAEINENGYILVKDFFTPEEIQVAKDEVIRLLDELAKKLYKANKITSLHEDKNFYDRLIAIEKEFPGANIILHKVGAFDEPFQKLATNERLLNLLEDFLGPNITFNPVWNLRTKTPNNDATVVPWHQDAGYFSQESFTMLIMTAWIPLIHATFENGTMQMVKRAHKDALVGVHECCAGPTWYLMLDEKEIESRFNVSIEKDSEIIDVPEGSFILFNQFTPHRSLPNTSNIVRWALDFRWHQTGKPSCLFGLKDGCEVRKEAEPDFKPPWDVFNAVDRNSAQIESSGFKN---DEFNTTIMGPWMGQWTMVHSNRHTAAYIDDPSKWDSRTVHG 1114
            G+TGE+HPE++ K + +   KPGQL+  QL E    G+ LV+DFFT EE+   K ++   + ELA KLY A KI   HE   FY RL AIE++FPGANI+LHK+      F+ +A +ER+LNLLED +GPNI+FNPVWNLRTKTPNN A+ VPWHQD+GYF  ES+  LI+TAW+PL+    +NGT+QMV   H+D  +  H CCAGPTWY+ LDE  IE  F V + KD   +DVP GSF+LFN FTPHRSL N S++VRW++DFRW +TG P+ LFGLK  CEVR++ EPDF+P WD F++VDRN AQ+ES        DEF+  I GPWM +W +V+ N+HT A+  +P  W    +HG
Sbjct:    9 GYTGERHPELF-KERPAKGNKPGQLSRAQLDEFYTRGFTLVRDFFTKEELDAVKADITVKVSELADKLYNAGKIKDKHEGLGFYHRLCAIERDFPGANIVLHKLSTLPPSFRAIAAHERMLNLLEDIVGPNISFNPVWNLRTKTPNNAASTVPWHQDSGYFDVESYNTLIVTAWVPLLDTNEQNGTLQMVPGCHRDGYIAKHTCCAGPTWYIDLDEDIIEKEFGVDMAKDPVTLDVPYGSFLLFNNFTPHRSLNNRSDVVRWSIDFRWQRTGTPAGLFGLKPTCEVRRDGEPDFRPDWDSFDSVDRNRAQLESMARDESAADEFSAVISGPWMKKWEIVNHNKHTDAFEKNPEGWQPGMLHG 369          
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. TrEMBL
Match: A0A267GH71 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033362g2 PE=4 SV=1)

HSP 1 Score: 424.476 bits (1090), Expect = 4.414e-144
Identity = 196/362 (54.14%), Postives = 253/362 (69.89%), Query Frame = 2
Query:   38 GFTGEKHPEVYQKYKRSNPRKPGQLTDEQLAEINENGYILVKDFFTPEEIQVAKDEVIRLLDELAKKLYKANKITSLHEDKNFYDRLIAIEKEFPGANIILHKVGAFDEPFQKLATNERLLNLLEDFLGPNITFNPVWNLRTKTPNNDATVVPWHQDAGYFSQESFTMLIMTAWIPLIHATFENGTMQMVKRAHKDALVGVHECCAGPTWYLMLDEKEIESRFNVSIEKDSEIIDVPEGSFILFNQFTPHRSLPNTSNIVRWALDFRWHQTGKPSCLFGLKDGCEVRKEAEPDFKPPWDVFNAVDRNSAQIESSGFKN---DEFNTTIMGPWMGQWTMVHSNRHTAAYIDDPSKWDSRTVHG 1114
            G+TGE+HPE++ K + +   KPGQL+  QL E    G+ LV+DFFT EE+   K ++   + ELA  LY A KI   HE   FY RL AIE++FPGANI+LHK+      F+ +A +ER+LNLLED +GPNI+FNPVWNLRTKTPNN A+ VPWHQD+GYF  ES+  LI+TAW+PL+    +NGT+QMV   H+D  +  H CCAGPTWY+ LDE  IE  F V + KD   +DVP GSF+LFN FTPHRSL N S++VRW++DFRW +TG P+ LFGLK  CEVR++ EPDF+P WD F++VDRN AQ+ES        DEF+  I GPWM +W +V+ N+HT A+  +P  W    +HG
Sbjct:   12 GYTGERHPELF-KERPAKGNKPGQLSRAQLDEFYTRGFTLVRDFFTKEELDAVKADITVKVSELADNLYNAGKIKDKHEGLGFYHRLCAIERDFPGANIVLHKLSTLPPSFRAIAAHERMLNLLEDIVGPNISFNPVWNLRTKTPNNAASTVPWHQDSGYFDVESYNTLIVTAWVPLLDTNEQNGTLQMVPGCHRDGYIAKHTCCAGPTWYIDLDEDTIEKEFGVDMAKDPVTLDVPYGSFLLFNNFTPHRSLNNRSDVVRWSIDFRWQRTGTPAGLFGLKPTCEVRRDGEPDFRPDWDSFDSVDRNRAQLESMARDESAADEFSAVISGPWMKKWEIVNHNKHTDAFEKNPEGWQPGMLHG 372          
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. TrEMBL
Match: A0A267EHM9 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033362g1 PE=4 SV=1)

HSP 1 Score: 423.32 bits (1087), Expect = 8.954e-144
Identity = 196/361 (54.29%), Postives = 253/361 (70.08%), Query Frame = 2
Query:   41 FTGEKHPEVYQKYKRSNPRKPGQLTDEQLAEINENGYILVKDFFTPEEIQVAKDEVIRLLDELAKKLYKANKITSLHEDKNFYDRLIAIEKEFPGANIILHKVGAFDEPFQKLATNERLLNLLEDFLGPNITFNPVWNLRTKTPNNDATVVPWHQDAGYFSQESFTMLIMTAWIPLIHATFENGTMQMVKRAHKDALVGVHECCAGPTWYLMLDEKEIESRFNVSIEKDSEIIDVPEGSFILFNQFTPHRSLPNTSNIVRWALDFRWHQTGKPSCLFGLKDGCEVRKEAEPDFKPPWDVFNAVDRNSAQIESSGFKN---DEFNTTIMGPWMGQWTMVHSNRHTAAYIDDPSKWDSRTVHG 1114
            +TGE+HPE++ K + +   KPGQL+  QL E    G+ LV+DFFT EE+   K ++   + ELA KLY A KI   HE   FY RL AIE++FPGANI+LHK+      F+ +A +ER+LNLLED +GPNI+FNPVWNLRTKTPNN A+ VPWHQD+GYF  ES+  LI+TAW+PL+    +NGT+QMV   H+D  +  H CCAGPTWY+ LDE  IE  F V + KD   +DVP GSF+LFN FTPHRSL N S++VRW++DFRW +TG P+ LFGLK  CEVR++ EPDF+P WD F++VDRN AQ+ES        DEF+  I GPWM +W +V+ N+HT A+  +P  W    +HG
Sbjct:    1 YTGERHPELF-KERPAKGNKPGQLSRAQLDEFYTRGFTLVRDFFTKEELDAVKADITVKVSELADKLYNAGKIKDKHEGLGFYHRLCAIERDFPGANIVLHKLSTLPPSFRAIAAHERMLNLLEDIVGPNISFNPVWNLRTKTPNNAASTVPWHQDSGYFDVESYNTLIVTAWVPLLDTNEQNGTLQMVPGCHRDGYIAKHTCCAGPTWYIDLDEDIIEKEFGVDMAKDPVTLDVPYGSFLLFNNFTPHRSLNNRSDVVRWSIDFRWQRTGTPAGLFGLKPTCEVRRDGEPDFRPDWDSFDSVDRNRAQLESMARDESAADEFSAVISGPWMKKWEIVNHNKHTDAFDKNPEGWQPGMLHG 360          
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. TrEMBL
Match: A0A267G1N4 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033362g3 PE=4 SV=1)

HSP 1 Score: 417.542 bits (1072), Expect = 2.346e-141
Identity = 192/348 (55.17%), Postives = 247/348 (70.98%), Query Frame = 2
Query:   38 GFTGEKHPEVYQKYKRSNPRKPGQLTDEQLAEINENGYILVKDFFTPEEIQVAKDEVIRLLDELAKKLYKANKITSLHEDKNFYDRLIAIEKEFPGANIILHKVGAFDEPFQKLATNERLLNLLEDFLGPNITFNPVWNLRTKTPNNDATVVPWHQDAGYFSQESFTMLIMTAWIPLIHATFENGTMQMVKRAHKDALVGVHECCAGPTWYLMLDEKEIESRFNVSIEKDSEIIDVPEGSFILFNQFTPHRSLPNTSNIVRWALDFRWHQTGKPSCLFGLKDGCEVRKEAEPDFKPPWDVFNAVDRNSAQIESSGFKN---DEFNTTIMGPWMGQWTMVHSNRHTAAY 1072
            G+TGE+HPE++ K + +   KPGQL+  QL E    G+ LV+DFF  EE+   K ++   + ELA KLY A KI   HE   FY RL AIE++FPGANI+LHK+      F+ +A +ER+LNLLED +GPNI+FNPVWNLRTKTPNN A+ VPWHQD+GYF  ES+  LI+TAW+PL+    +NGT+QMV   H+D  +  H CCAGPTWY+ LDE  IE  F V + KD   +DVP GSF+LFN FTPHRSL N S++VRW++DFRW +TG P+ LFGLK  CEVR++ EPDF+P WD F++VDRN AQ+ES        DEF+  I GPWM +W +V+ N+HT A+
Sbjct:    7 GYTGERHPELF-KERPAKGNKPGQLSRAQLDEFYTRGFTLVRDFFAKEELDAVKADITVKVSELADKLYNAGKIKDKHEGLGFYHRLCAIERDFPGANIVLHKLSTLPPSFRAIAAHERMLNLLEDIVGPNISFNPVWNLRTKTPNNAASTVPWHQDSGYFDVESYNTLIVTAWVPLLDTNEQNGTLQMVPGCHRDGYIAKHTCCAGPTWYIDLDEDIIEKEFGVDMAKDPVTLDVPYGSFLLFNNFTPHRSLNNRSDVVRWSIDFRWQRTGTPAGLFGLKPTCEVRRDGEPDFRPDWDSFDSVDRNRAQLESMARDESAADEFSAVISGPWMKKWEIVNHNKHTDAF 353          
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. TrEMBL
Match: A0A1I8G628 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 388.267 bits (996), Expect = 4.647e-130
Identity = 184/362 (50.83%), Postives = 240/362 (66.30%), Query Frame = 2
Query:   38 GFTGEKHPEVYQKYKRSNPRKPGQLTDEQLAEINENGYILVKDFFTPEEIQVAKDEVIRLLDELAKKLYKANKITSLHEDKNFYDRLIAIEKEFPGANIILHKVGAFDEPFQKLATNERLLNLLEDFLGPNITFNPVWNLRTKTPNNDATVVPWHQDAGYFSQESFTMLIMTAWIPLIHATFENGTMQMVKRAHKDALVGVHECCAGPTWYLMLDEKEIESRFNVSIEKDSEIIDVPEGSFILFNQFTPHRSLPNTSNIVRWALDFRWHQTGKPSCLFGLKDGCEVRKEAEPDFKPPWDVFNAVDRNSAQIESSGFKN---DEFNTTIMGPWMGQWTMVHSNRHTAAYIDDPSKWDSRTVHG 1114
            G+TGE+HPE++ K + +   KPGQL+  QL E    G+ LV+DFFT EE+   K ++   + ELA  LY A KI   HE   FY RL AIE++FPGANI+LHK+      F+ +A +ER+LNLLED +GPNI+FNPVWNLRTKTPNN A+ VPWHQD+GYF  ES+  LI+TAW+PL+    +NGT+QMV   H+D  +  H CCAGPTWY+ LDE  IE  F V + KD   +DVP               L N S++VRW++DFRW +TG P+ LFGLK  CEVR++ EPDF+P WD F++VDRN AQ+ES        DEF+  I GPWM +W +V+ N+HT A+  +P  W    +HG
Sbjct:    9 GYTGERHPELF-KERPAKGNKPGQLSRAQLDEFYTRGFTLVRDFFTKEELDAVKADITVKVSELADNLYNAGKIKDKHEGLGFYHRLCAIERDFPGANIVLHKLSTLPPSFRAIAAHERMLNLLEDIVGPNISFNPVWNLRTKTPNNAASTVPWHQDSGYFDVESYNTLIVTAWVPLLDTNEQNGTLQMVPGCHRDGYIAKHTCCAGPTWYIDLDEDIIEKEFGVDMAKDPVTLDVP---------------LNNRSDVVRWSIDFRWQRTGTPAGLFGLKPTCEVRRDGEPDFRPDWDSFDSVDRNRAQLESMARDESAADEFSAVISGPWMKKWEIVNHNKHTDAFEKNPEGWQPGMLHG 354          
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. Ensembl Sea Lamprey
Match: phyh (phytanoyl-CoA 2-hydroxylase [Source:ZFIN;Acc:ZDB-GENE-050417-361])

HSP 1 Score: 51.2174 bits (121), Expect = 1.702e-7
Identity = 67/255 (26.27%), Postives = 107/255 (41.96%), Query Frame = 2
Query:  104 GQLTDEQLAEINENGYILVKDFFTPEEIQVAKDEVIRLLDELAKKLYKANKITSLHEDKNFYDRLIAIEK-EFPGANIILHKVGAFDEP---FQKLATNERLLNLLEDFLGPNI-TFNPVWNLRTKTPNNDATVVPWHQDAGYFSQESFTMLIMTAWIPLIHATFENGTMQMVKRAHKDALVGVHECCAGPTW-------YLML-DEKEIESRFNVSIEKDSEIIDVPEGSFILFNQFTPHRSLPNTSNIVRWAL 829
            G LT EQ A   +NG+I++K   T E+++   +      + + ++      IT +        R IAI K +    +  + KV  F E    FQ     E +L  +E F GP+I   + +   +   P   ++  P HQD  +F        I+ +W  + H   ENGT+ ++   HK  L    +  A P W       YL L D      RF++S+EK         G  + F+    H S  N +N  R ++
Sbjct:   27 GILTPEQRAFYEDNGFIVIKGLVTDEDLERYSER--DRFERICRREVTVPAITIM--------RDIAIAKSKVAQDHSSVTKVQDFQEDPILFQYCQLPE-ILKYVESFTGPDIMAVHSMLINKPPDPGQKSSRHPLHQDLHFFPFRP-AERIVCSWTAMQHIDRENGTLVVLPGTHKGDL----KPHAYPKWEGGVNKLYLGLRDFDSTAPRFHLSMEK---------GDTVFFHPLLIHGSGMNRTNGFRKSI 256          
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. Ensembl Nematostella
Match: EDO48545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJA0])

HSP 1 Score: 70.4774 bits (171), Expect = 2.022e-13
Identity = 68/257 (26.46%), Postives = 110/257 (42.80%), Query Frame = 2
Query:   86 SNPRKPGQLTDEQLAEINENGYILVKDFFTPEEIQVAKDEVIRLLDELAKKLYKANKITSLHEDKNFYDRLIAIEKEFPGANII--LHKVGAFDEPFQKLATNERLLNLLEDFLGPNITFNPVWNLRTKTPNNDATVVPWHQDAGYFSQESFTMLIMTAWIPLIHATFENGTMQMVKRAHKDALVGVHECCAGPTWYLMLDEKEIESRFNVSIEKDSEIIDVPEGSFILFNQFTPHRSLPNTSNIVRWALDFRWHQT 850
            S+P     LTDEQ  +  E GY+++ D    E IQ  KD     LDE  ++     K T         + L       PG +++  +H        F++   NE++L+++ D +GPNI +     +  K P      + WHQD   F+  +   L+M   I +     ENG +Q+V ++HK  L+  +    G     + D      RF+ S  K    ++VP G   L +  + H S  N S   R    +++  T
Sbjct:   46 SSPAANLALTDEQKQQFEEEGYLIINDVLDKEHIQRMKDA----LDECEERAKHLEKST---------NHLTLDPMSIPGNSLLQRVHIPSLLFPVFEETIKNEKILDIVSDLIGPNIRYIRQDKVNVKHPKGTGFPIKWHQDWA-FNPHTNQDLVMIC-ISIDDTNIENGCLQVVPKSHKGPLLSHYR--DGEFASAINDH-----RFDPSKAKH---LEVPSGGISLHHVSSIHGSAINRSKNKRRLYVYQYCST 277          
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. Ensembl Nematostella
Match: EDO44135 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWJ6])

HSP 1 Score: 53.5286 bits (127), Expect = 5.056e-8
Identity = 61/255 (23.92%), Postives = 100/255 (39.22%), Query Frame = 2
Query:  113 TDEQLAEINENGYILVKDFFTPEEIQVAKDEVIRLLDELAKKLYKANKITSLHEDKNFYDRLIAIEKEFPGANIILHKVGAFDEPFQKLATNERLLNLLEDFLGPNI-TFNPVWNLRTKTPNNDATVVPWHQDAGYFSQESFTMLIMTAWIPLIHATFENGTMQMVKRAHK-----------DALVGVHECCAGPTWYLMLDEKEIESRFNVSIEKDSEIIDVPEGSFILFNQFTPHRSLPNTSNIVRWALDFRW 841
            T+E   +++E GY  ++     +++  A++ V   L  +  K+ +A        DK   D ++ ++ E                 F+++ +  ++      F G +  TF   W LR   P     V   H D  Y S+   T  ++T W P    T E G++ M + +HK            +L    E   G  W+   D  EI  RF        +I D   G  ++F Q T H S  N +  VR + D RW
Sbjct:   13 TEELRKQMDEQGYFFIRQLHNRDDVLSAREAV---LQHIQSKVPEA-----FDPDKPLQDGVLKLDTEDK------------KNKFKEVTSRIQVKQFFRKFFGQDSKTFTYKW-LRAVEPCGFTGV---HVDNVYMSRG--TDKLLTVWTPFSDVTMEMGSLAMCEGSHKLPSFDHFQDTYGSLDLDKEGVVGSGWF-SEDANEITQRFGGKW----KIADFKAGDVLIFTQRTVHMSSVNATQRVRISCDTRW 236          
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. Ensembl Nematostella
Match: EDO42949 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S038])

HSP 1 Score: 51.9878 bits (123), Expect = 1.672e-7
Identity = 57/252 (22.62%), Postives = 104/252 (41.27%), Query Frame = 2
Query:  143 NGYILVKDFFTPEEIQVAKDEVIRLLDELAKK-------------------LYKANKITSLHEDKNFYDRLIAIEKEFPGANIILHKVGAFDEPFQKLATNERLLNLLEDFLGPNITFNPVWNLRTKTPNNDATVVPWHQDAGYFSQESFTMLIMTAWIPLIHATFENGTMQMVKRAHK-DALVGVHECCAGPTWYLMLDEKEIESRFNVSIEKDSEIIDVPEGSFILFNQFTPHRSLPNTSNIVRWALDFR 838
            +GY+++++F + +E+Q  ++ +  ++D+L                      L   +KI    E+  F  +   ++ +    N I H + AF+  F+K   ++++  + +   G      P      K P     V P H+D+ Y   E  + +    WIPL   T ENG +  +  +HK D +        G   +++L     E  +N   E  S      +GS ++ +    HRS PN S+  R A  F 
Sbjct:   15 DGYVVIENFLSLDEVQELREAMRNIVDDLDLSQNPLSVFKTGDDQVGDDYFLTSGDKIRPFMEEGAFDKQGNLVKDKHVAINKIGHALHAFNPVFKKATFSKKIQEIAKSVAGMKNPVVPQSMYIFKQPGIGGEVNP-HRDSTYLYTEPISAIGF--WIPLEDCTTENGCLWFIPGSHKVDKIERRLIRTPGSKEHVVLHIGPQE-EYN---EAQSVPALTKKGSLVVIHGSVLHRSFPNKSSKSRHAYTFH 259          
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. Ensembl Nematostella
Match: EDO28287 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6W8])

HSP 1 Score: 51.2174 bits (121), Expect = 1.826e-7
Identity = 53/207 (25.60%), Postives = 84/207 (40.58%), Query Frame = 2
Query:  239 LYKANKITSLHEDKNFYDRLIAIEKEFPGANIILHKVGAFDEPFQKLATNERLLNLLEDFLGPNITFNPVWNLRTKTPNNDATVVPWHQDAGYFSQESFTMLIMTAWIPLIHATFENGTMQMVKRAHKDALVGVHECCAGPTWYLMLDEKEIESRFNVSIEKDSEIID---VP----EGSFILFNQFTPHRSLPNTSNIVRWALDFR 838
            +  A+KI    E   F D+   ++++    N I H + A +  F+K   ++++  + +   G      P      K P     V P H+D+ Y   E  T  ++  WIPL   T ENG +  +  +HK   +             M+   E E R    I  D E  D   VP    +G+ ++ +    HRS PN S+  R A  F 
Sbjct:    1 MTSADKIRPFMEQNAFDDQGNLVKEKHLAINKIGHALHALNPVFKKATFSKKVQEIAKYVAGLKNPIVPQSMYIFKQPGIGDEVAP-HRDSTYLYTEPPT--VVGFWIPLEDCTTENGCLWFIPGSHKVEKIERR----------MVRSLESEGRLVSHIGPDEEYDDSKSVPLCTNKGALVIIHGSVLHRSFPNKSSKSRHAYTFH 194          
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. Planmine SMEST
Match: SMESG000023010.1 (SMESG000023010.1)

HSP 1 Score: 763.451 bits (1970), Expect = 0.000e+0
Identity = 365/367 (99.46%), Postives = 366/367 (99.73%), Query Frame = 2
Query:   14 N*MEKKSKGFTGEKHPEVYQKYKRSNPRKPGQLTDEQLAEINENGYILVKDFFTPEEIQVAKDEVIRLLDELAKKLYKANKITSLHEDKNFYDRLIAIEKEFPGANIILHKVGAFDEPFQKLATNERLLNLLEDFLGPNITFNPVWNLRTKTPNNDATVVPWHQDAGYFSQESFTMLIMTAWIPLIHATFENGTMQMVKRAHKDALVGVHECCAGPTWYLMLDEKEIESRFNVSIEKDSEIIDVPEGSFILFNQFTPHRSLPNTSNIVRWALDFRWHQTGKPSCLFGLKDGCEVRKEAEPDFKPPWDVFNAVDRNSAQIESSGFKNDEFNTTIMGPWMGQWTMVHSNRHTAAYIDDPSKWDSRTVHG 1114
            N +EKKSKGFTGEKHPEVYQKYKRSNPRKPGQLTDEQLAEINENGYILVKDFFTPEEIQVAKDEVIRLLDELAKKLYKANKITSLHEDKNFYDRLIAIEKEFPGANIILHKVGAFDEPFQKLATNERLLNLLEDFLGPNITFNPVWNLRTKTPNNDATVVPWHQDAGYFSQESFTMLIMTAWIPLIHATFENGTMQMVKRAHKDALVGVHECCAGPTWYLMLDEKEIESRFNVSIEKDSEIIDVPEGSFILFNQFTPHRSLPNTSNIVRWALDFRWHQTGKPSCLFGLKDGCEVRKEAEPDFKPPWDVFNAVDRNSAQIESSGFKNDEFNTTIMGPWMGQWTMVHSNRHTAAYIDDPSKWDSRTVHG
Sbjct:    5 NIVEKKSKGFTGEKHPEVYQKYKRSNPRKPGQLTDEQLAEINENGYILVKDFFTPEEIQVAKDEVIRLLDELAKKLYKANKITSLHEDKNFYDRLIAIEKEFPGANIILHKVGAFDEPFQKLATNERLLNLLEDFLGPNITFNPVWNLRTKTPNNDATVVPWHQDAGYFSQESFTMLIMTAWIPLIHATFENGTMQMVKRAHKDALVGVHECCAGPTWYLMLDEKEIESRFNVSIEKDSEIIDVPEGSFILFNQFTPHRSLPNTSNIVRWALDFRWHQTGKPSCLFGLKDGCEVRKEAEPDFKPPWDVFNAVDRNSAQIESSGFKNDEFNTTIMGPWMGQWTMVHSNRHTAAYIDDPSKWDSRTVHG 371          
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. Planmine SMEST
Match: SMESG000023010.1 (SMESG000023010.1)

HSP 1 Score: 761.911 bits (1966), Expect = 0.000e+0
Identity = 364/364 (100.00%), Postives = 364/364 (100.00%), Query Frame = 2
Query:   23 EKKSKGFTGEKHPEVYQKYKRSNPRKPGQLTDEQLAEINENGYILVKDFFTPEEIQVAKDEVIRLLDELAKKLYKANKITSLHEDKNFYDRLIAIEKEFPGANIILHKVGAFDEPFQKLATNERLLNLLEDFLGPNITFNPVWNLRTKTPNNDATVVPWHQDAGYFSQESFTMLIMTAWIPLIHATFENGTMQMVKRAHKDALVGVHECCAGPTWYLMLDEKEIESRFNVSIEKDSEIIDVPEGSFILFNQFTPHRSLPNTSNIVRWALDFRWHQTGKPSCLFGLKDGCEVRKEAEPDFKPPWDVFNAVDRNSAQIESSGFKNDEFNTTIMGPWMGQWTMVHSNRHTAAYIDDPSKWDSRTVHG 1114
            EKKSKGFTGEKHPEVYQKYKRSNPRKPGQLTDEQLAEINENGYILVKDFFTPEEIQVAKDEVIRLLDELAKKLYKANKITSLHEDKNFYDRLIAIEKEFPGANIILHKVGAFDEPFQKLATNERLLNLLEDFLGPNITFNPVWNLRTKTPNNDATVVPWHQDAGYFSQESFTMLIMTAWIPLIHATFENGTMQMVKRAHKDALVGVHECCAGPTWYLMLDEKEIESRFNVSIEKDSEIIDVPEGSFILFNQFTPHRSLPNTSNIVRWALDFRWHQTGKPSCLFGLKDGCEVRKEAEPDFKPPWDVFNAVDRNSAQIESSGFKNDEFNTTIMGPWMGQWTMVHSNRHTAAYIDDPSKWDSRTVHG
Sbjct:   20 EKKSKGFTGEKHPEVYQKYKRSNPRKPGQLTDEQLAEINENGYILVKDFFTPEEIQVAKDEVIRLLDELAKKLYKANKITSLHEDKNFYDRLIAIEKEFPGANIILHKVGAFDEPFQKLATNERLLNLLEDFLGPNITFNPVWNLRTKTPNNDATVVPWHQDAGYFSQESFTMLIMTAWIPLIHATFENGTMQMVKRAHKDALVGVHECCAGPTWYLMLDEKEIESRFNVSIEKDSEIIDVPEGSFILFNQFTPHRSLPNTSNIVRWALDFRWHQTGKPSCLFGLKDGCEVRKEAEPDFKPPWDVFNAVDRNSAQIESSGFKNDEFNTTIMGPWMGQWTMVHSNRHTAAYIDDPSKWDSRTVHG 383          
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. Planmine SMEST
Match: SMESG000004909.1 (SMESG000004909.1)

HSP 1 Score: 61.2326 bits (147), Expect = 4.463e-10
Identity = 67/283 (23.67%), Postives = 118/283 (41.70%), Query Frame = 2
Query:   86 SNPRKPGQLTDEQLAEINENGYILVKDFFTPEEIQVAKDEVIRLLDE-----------------LAKKLYKA------NKITSLHEDKNFYDRLIAIEKEFPGANIILHKVGAFDEPFQKLATNERLLNLLED--FLGPNITFNPVWNLRTKTPNNDATVVPWHQDAGYFSQESFTMLIMTAWIPLIHATFENGTMQMVKRAHKDALVGVHECCAGPTW-----YLMLDEKEIESRFNVSIEKDSEIIDVPEGSFILFNQFTPHRSLPNTSNIVRWALDFRWH 844
            SN      L+ + + + NENG+ +V+++ +  +    ++E+ R++++                   K+L+        +KI    E     +    I  E    N I H +    +PF++++ +  +  + +   F  P I  +       KTP   + V P HQDA +   E     I+  WI L  A  ENG +  V+ +HK+ L+        P+       L  +  EI+    V +E       V +GS +L + +  H+SLPN SN  R    + WH
Sbjct:   50 SNKASQNYLSTDDIKKFNENGFFVVENYLSISKCDGLRNEISRIINQHDFTNFHQVFACTEKGVTDKELHDEYFFDSWDKIRFFLEGDTIKNAKEPITNENKKINKIGHNLHNLSQPFKEVSFDSSVKTICQQLGFKKPAICQSM---FIFKTPKIGSRVTP-HQDASFLWTEP-ECRILGFWIALEDAKIENGCLWAVQGSHKNGLLNNVRFIRDPSMGKYVTRLCSEYPEIKDEEYVPVE-------VSKGSLVLIHGYVMHKSLPNISNKTRDI--YTWH 318          
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. Planmine SMEST
Match: SMESG000004910.1 (SMESG000004910.1)

HSP 1 Score: 58.5362 bits (140), Expect = 2.319e-9
Identity = 66/277 (23.83%), Postives = 114/277 (41.16%), Query Frame = 2
Query:  107 QLTDEQLAEINENGYILVKDFFTPEEIQVAKDEVIRLLDELAKKLY--------KANKITSLHEDKNFYDRLIAIEKEFPGANI----------------ILHKVGAFDEPFQKLATNERLLNLLED--FLGPNITFNPVWNLRTKTPNNDATVVPWHQDAGYFSQESFTMLIMTAWIPLIHATFENGTMQMVKRAHKDALVGVHECCAGPTW-----YLMLDEKEIESRFNVSIEKDSEIIDVPEGSFILFNQFTPHRSLPNTSNIVRWALDFRWH 844
             LT  ++ + + +G+++V+++   E+    + E+  ++D      +        K    T LH D+ F+D    I     G  I                I H +    +PF++++ +  +  + +   F  P I  +       KTP   + V P HQDA +   E     I+  WI L  A  ENG +  V+ +HK+ L+        P+       L  +  EI+    V +E       V +GS +L + +  H+SLPN SN  R    + WH
Sbjct:    5 SLTASEVRKFDNDGFLVVENYLPSEKCDELRKEISSIIDNFDFTNFNHAFTCTEKGVSATELH-DEYFFDSWDKIRFFLEGDTIKNAKEPITNENKKINKIGHNLHNLSQPFKEVSFDSSVKTICQQLGFKKPAICQSM---FIFKTPKIGSRVTP-HQDASFLWTEP-ECRILGFWIALEDAKIENGCLWAVQGSHKNGLLNNVRFIRDPSMGKYVTRLCSEYPEIKDEEYVPVE-------VSKGSLVLIHGYVMHKSLPNISNKTRDI--YTWH 266          
The following BLAST results are available for this feature:
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
PHYH1.229e-624.63phytanoyl-CoA 2-hydroxylase [Source:HGNC Symbol;Ac... [more]
PHYH1.754e-624.18phytanoyl-CoA 2-hydroxylase [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmem1632.454e-727.14transmembrane protein 163 [Source:Xenbase;Acc:XB-G... [more]
tmem1633.877e-726.87transmembrane protein 163 [Source:Xenbase;Acc:XB-G... [more]
tmem1634.096e-726.87transmembrane protein 163 [Source:Xenbase;Acc:XB-G... [more]
tmem1634.571e-727.14transmembrane protein 163 [Source:Xenbase;Acc:XB-G... [more]
tmem1634.571e-727.14transmembrane protein 163 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q54XH6|PHYD1_DICDI4.012e-619.33Phytanoyl-CoA dioxygenase domain-containing protei... [more]
sp|O14832|PAHX_HUMAN5.903e-624.63Phytanoyl-CoA dioxygenase, peroxisomal OS=Homo sap... [more]
sp|Q10E49|PAHX1_ORYSJ9.322e-624.92Phytanoyl-CoA dioxygenase 1 OS=Oryza sativa subsp.... [more]
back to top
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HS861.006e-14454.42Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GH714.414e-14454.14Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267EHM98.954e-14454.29Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267G1N42.346e-14155.17Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8G6284.647e-13050.83Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
phyh1.702e-726.27phytanoyl-CoA 2-hydroxylase [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO485452.022e-1326.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO441355.056e-823.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429491.672e-722.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO282871.826e-725.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phytanoyl-CoA dioxygenase domain-containing protein 1-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000023010.10.000e+099.46SMESG000023010.1[more]
SMESG000023010.10.000e+0100.00SMESG000023010.1[more]
SMESG000004909.14.463e-1023.67SMESG000004909.1[more]
SMESG000004910.12.319e-923.83SMESG000004910.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014144 ID=SMED30014144|Name=Phytanoyl-CoA dioxygenase domain-containing protein 1-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1274bp
ACGTTTTATATAAAATTGAATGGAGAAAAAATCTAAAGGATTTACCGGTG
AAAAACATCCGGAAGTTTATCAAAAGTACAAGCGATCTAATCCAAGAAAA
CCAGGACAATTAACTGATGAGCAATTAGCTGAAATAAATGAAAATGGATA
TATTTTAGTAAAGGATTTTTTTACTCCTGAAGAAATACAAGTGGCAAAAG
ATGAAGTAATTAGATTGCTCGATGAATTAGCTAAAAAGTTATACAAGGCT
AATAAAATAACAAGCTTACATGAGGATAAAAATTTTTACGATCGTTTGAT
CGCAATAGAGAAGGAATTCCCAGGAGCAAATATCATCCTCCATAAAGTCG
GAGCATTTGATGAGCCATTTCAAAAACTTGCCACCAATGAAAGACTATTG
AATTTATTGGAAGATTTTCTTGGACCAAATATAACATTTAATCCAGTTTG
GAATCTCAGAACAAAAACTCCAAATAATGATGCAACTGTTGTACCGTGGC
ATCAAGACGCTGGATACTTTTCCCAGGAATCATTTACTATGTTGATAATG
ACAGCTTGGATTCCTCTTATTCATGCAACGTTTGAAAATGGAACTATGCA
GATGGTGAAAAGAGCTCATAAAGATGCACTGGTTGGAGTTCATGAATGTT
GTGCTGGACCAACTTGGTATTTAATGTTAGATGAGAAAGAAATTGAATCT
CGTTTTAATGTATCTATTGAGAAAGATTCGGAAATCATCGATGTGCCAGA
AGGGAGTTTTATTTTATTCAACCAGTTTACTCCTCATCGAAGTTTACCAA
ACACTTCTAACATAGTTCGATGGGCTCTTGATTTCCGTTGGCATCAAACT
GGCAAACCTTCCTGTCTTTTTGGATTAAAAGACGGCTGCGAAGTTAGAAA
AGAGGCCGAACCGGATTTCAAACCTCCTTGGGATGTATTCAATGCGGTCG
ATCGAAATTCCGCTCAAATCGAGTCATCAGGATTTAAAAATGACGAGTTC
AACACGACAATTATGGGACCTTGGATGGGTCAGTGGACCATGGTTCACAG
TAATCGGCACACGGCAGCTTACATTGATGATCCATCAAAATGGGATTCCA
GAACGGTCCATGGATGATTTATTCGCATAGTTTTGCATTGGTCGGTGAGA
ATCGCCGTCACTTCATACTGAACTGTGTTTTTAGGAACTAAATTTGATAA
TCTTAAAATGATTTTATTTATTATAAATCCATAATTTTTATTGATATTTT
AATAAACATAAATTTTTATTGTTT
back to top

protein sequence of SMED30014144-orf-1

>SMED30014144-orf-1 ID=SMED30014144-orf-1|Name=SMED30014144-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=366bp
MEKKSKGFTGEKHPEVYQKYKRSNPRKPGQLTDEQLAEINENGYILVKDF
FTPEEIQVAKDEVIRLLDELAKKLYKANKITSLHEDKNFYDRLIAIEKEF
PGANIILHKVGAFDEPFQKLATNERLLNLLEDFLGPNITFNPVWNLRTKT
PNNDATVVPWHQDAGYFSQESFTMLIMTAWIPLIHATFENGTMQMVKRAH
KDALVGVHECCAGPTWYLMLDEKEIESRFNVSIEKDSEIIDVPEGSFILF
NQFTPHRSLPNTSNIVRWALDFRWHQTGKPSCLFGLKDGCEVRKEAEPDF
KPPWDVFNAVDRNSAQIESSGFKNDEFNTTIMGPWMGQWTMVHSNRHTAA
YIDDPSKWDSRTVHG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR008775Phytyl_CoA_dOase
Vocabulary: molecular function
TermDefinition
GO:0051213dioxygenase activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008775Phytanoyl-CoA dioxygenasePFAMPF05721PhyHcoord: 39..266
e-value: 6.8E-19
score: 69.0
NoneNo IPR availableGENE3DG3DSA:2.60.120.620coord: 15..287
e-value: 2.2E-39
score: 137.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..27
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..28
NoneNo IPR availablePANTHERPTHR20883PHYTANOYL-COA DIOXYGENASE DOMAIN CONTAINING 1coord: 18..323
NoneNo IPR availablePANTHERPTHR20883:SF14coord: 18..323
NoneNo IPR availableSUPERFAMILYSSF51197Clavaminate synthase-likecoord: 27..277