Zgc:158640

Overview
NameZgc:158640
Smed IDSMED30014142
Length (bp)533
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zgc:158640 (SMED30014142) t-SNE clustered cells

Violin plots show distribution of expression levels for Zgc:158640 (SMED30014142) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zgc:158640 (SMED30014142) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zgc:158640 (SMED30014142) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014142

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30014142SMESG000055915.1 SmedASXL_002777SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30014142SMESG000055915.1 dd_Smed_v4_13161_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30014142SMESG000055915.1 dd_Smed_v6_13161_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zgc:158640 vs. Ensembl Human
Match: HSPB11 (heat shock protein family B (small) member 11 [Source:HGNC Symbol;Acc:HGNC:25019])

HSP 1 Score: 100.138 bits (248), Expect = 8.450e-27
Identity = 56/134 (41.79%), Postives = 88/134 (65.67%), Query Frame = 1
Query:   88 DLALANQGXXXXXXXXXXXXXXXXNMIDGNIKTYFVTTGMFPQEFVIGFSSTVKIDKINLVSYNIKGIQIEKSATGQCDDFILVAEYKLDHSAGNYTNSEFPVKNCNATHLKFIITGGYDHFICIQKIAVHGNV 489
            DL L+++GS +I ++S DE +PPEN+IDGN +T++ TTGMFPQEF+I F   V+I+++ + SY ++ ++IEKS + +  DF    E  L H+ G   N E    + +AT+L+FII   +DHF  +  ++  G V
Sbjct:    5 DLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTV 138          
BLAST of Zgc:158640 vs. Ensembl Human
Match: HSPB11 (heat shock protein family B (small) member 11 [Source:HGNC Symbol;Acc:HGNC:25019])

HSP 1 Score: 75.8702 bits (185), Expect = 1.146e-17
Identity = 46/103 (44.66%), Postives = 70/103 (67.96%), Query Frame = 1
Query:   88 DLALANQGXXXXXXXXXXXXXXXXNMIDGNIKTYFVTTGMFPQEFVIGFSSTVKIDKINLVSYNIKGIQIEKSATGQCDDFILVAEYKLDHSAGNYTNSEFPV 396
            DL L+++GS +I ++S DE +PPEN+IDGN +T++ TTGMFPQEF+I F   V+I+++ + SY ++ ++IEKS + +  DF    E  L H+ G   N E  V
Sbjct:    5 DLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVV 107          
BLAST of Zgc:158640 vs. Ensembl Human
Match: HSPB11 (heat shock protein family B (small) member 11 [Source:HGNC Symbol;Acc:HGNC:25019])

HSP 1 Score: 75.485 bits (184), Expect = 1.405e-16
Identity = 50/127 (39.37%), Postives = 79/127 (62.20%), Query Frame = 1
Query:   88 DLALANQGXXXXXXXXXXXXXXXXNMIDGNIKTYFVTTGMFPQEFVIGFSSTVKIDKINLVSYNIKGIQIEKSATGQCDDFILVAEYKLDHSAGNYTNSEFPVKNCNATHLKFI--ITGGYDHFICI 462
            DL L+++GS +I ++S DE +PPEN+IDGN +T++ TTGMFPQEF+I F   V+I+++ + SY ++ ++IEKS + +  DF    E  L H+ G   N E  V      +L  +   + G+  F C+
Sbjct:    5 DLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEI-VAGVGWRYLGSLQPPSPGFKRFSCL 130          
BLAST of Zgc:158640 vs. Ensembl Human
Match: HSPB11 (heat shock protein family B (small) member 11 [Source:HGNC Symbol;Acc:HGNC:25019])

HSP 1 Score: 56.6102 bits (135), Expect = 9.503e-11
Identity = 33/63 (52.38%), Postives = 50/63 (79.37%), Query Frame = 1
Query:   88 DLALANQGXXXXXXXXXXXXXXXXNMIDGNIKTYFVTTGMFPQEFVIGFSSTVKIDKINLVSY 276
            DL L+++GS +I ++S DE +PPEN+IDGN +T++ TTGMFPQEF+I F   V+I+++ + SY
Sbjct:    5 DLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSY 67          
BLAST of Zgc:158640 vs. Ensembl Zebrafish
Match: zgc:158640 (zgc:158640 [Source:ZFIN;Acc:ZDB-GENE-061215-15])

HSP 1 Score: 105.916 bits (263), Expect = 2.476e-29
Identity = 58/132 (43.94%), Postives = 92/132 (69.70%), Query Frame = 1
Query:   82 MPDLALANQGXXXXXXXXXXXXXXXXNMIDGNIKTYFVTTGMFPQEFVIGFSSTVKIDKINLVSYNIKGIQIEKSATGQCDDFILVAEYKLDHSAGNYTNSEFPVKNCNATHLKFIITGGYDHFICIQKIAV 477
            M D AL++ G+ ++ +SS DE++PPEN+IDG  +T+++TTG+FPQEF+I F   +KI  +++ SYNIK ++IEKS +   D F  VA+ + +H   +   ++  V   NATHL+F+I  GYDHF+ + K++V
Sbjct:    1 MLDAALSSYGAQVVLASSGDENHPPENIIDGKKETFWITTGLFPQEFIIRFPDNMKILTVSIHSYNIKRLRIEKSTSDDGDHFEEVADTEFEHIESSLQANDVSVNVSNATHLRFVILSGYDHFVSVHKVSV 132          
BLAST of Zgc:158640 vs. Ensembl Xenopus
Match: hspb11 (heat shock protein family B (small) member 11 [Source:NCBI gene;Acc:733760])

HSP 1 Score: 93.5893 bits (231), Expect = 2.778e-24
Identity = 46/133 (34.59%), Postives = 83/133 (62.41%), Query Frame = 1
Query:   88 DLALANQGXXXXXXXXXXXXXXXXNMIDGNIKTYFVTTGMFPQEFVIGFSSTVKIDKINLVSYNIKGIQIEKSATGQCDDFILVAEYKLDHSAGNYTNSEFPVKNCNATHLKFIITGGYDHFICIQKIAVHGN 486
            DL L+  G+ +  ++S D+ +P +N+IDGN  T++ TTGM+PQEF+I  +   KI+KI L S  ++ ++IE S + +  +F L  E  L+++ G+    EF +      H++F+I  G+DHF+ + +++  G+
Sbjct:    6 DLCLSCAGARVTLATSSDDRHPADNIIDGNPDTFWTTTGMYPQEFIISLNGIQKINKIILQSSLVRSVRIESSTSKEPVNFELRLERDLENTEGHLQYEEFTLPGVQVAHMRFVILSGFDHFVSVHRVSAEGD 138          
BLAST of Zgc:158640 vs. Ensembl Mouse
Match: Hspb11 (heat shock protein family B (small), member 11 [Source:MGI Symbol;Acc:MGI:1920188])

HSP 1 Score: 96.2857 bits (238), Expect = 2.141e-25
Identity = 55/132 (41.67%), Postives = 83/132 (62.88%), Query Frame = 1
Query:   88 DLALANQGXXXXXXXXXXXXXXXXNMIDGNIKTYFVTTGMFPQEFVIGFSSTVKIDKINLVSYNIKGIQIEKSATGQCDDFILVAEYKLDHSAGNYTNSEFPVKNCNATHLKFIITGGYDHFICIQKIAVHG 483
            DL    +G+ +I ++S DE +PPEN+IDGN +T++ TTGMFPQEF+I F   VKI+K+ + SY ++ ++IEK+ + +  DF    E  L H+ G   N E   ++  AT L+FII   +DHF  +  I+  G
Sbjct:    5 DLCSVTEGTEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVKIEKLVIQSYLVRTLRIEKTTSKEPLDFEQWVEKDLVHTEGQLQNEEIVARDGYATFLRFIIVSAFDHFASVHSISAEG 136          
BLAST of Zgc:158640 vs. Ensembl Mouse
Match: Hspb11 (heat shock protein family B (small), member 11 [Source:MGI Symbol;Acc:MGI:1920188])

HSP 1 Score: 96.2857 bits (238), Expect = 2.141e-25
Identity = 55/132 (41.67%), Postives = 83/132 (62.88%), Query Frame = 1
Query:   88 DLALANQGXXXXXXXXXXXXXXXXNMIDGNIKTYFVTTGMFPQEFVIGFSSTVKIDKINLVSYNIKGIQIEKSATGQCDDFILVAEYKLDHSAGNYTNSEFPVKNCNATHLKFIITGGYDHFICIQKIAVHG 483
            DL    +G+ +I ++S DE +PPEN+IDGN +T++ TTGMFPQEF+I F   VKI+K+ + SY ++ ++IEK+ + +  DF    E  L H+ G   N E   ++  AT L+FII   +DHF  +  I+  G
Sbjct:    5 DLCSVTEGTEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVKIEKLVIQSYLVRTLRIEKTTSKEPLDFEQWVEKDLVHTEGQLQNEEIVARDGYATFLRFIIVSAFDHFASVHSISAEG 136          
BLAST of Zgc:158640 vs. Ensembl Mouse
Match: Hspb11 (heat shock protein family B (small), member 11 [Source:MGI Symbol;Acc:MGI:1920188])

HSP 1 Score: 96.2857 bits (238), Expect = 2.141e-25
Identity = 55/132 (41.67%), Postives = 83/132 (62.88%), Query Frame = 1
Query:   88 DLALANQGXXXXXXXXXXXXXXXXNMIDGNIKTYFVTTGMFPQEFVIGFSSTVKIDKINLVSYNIKGIQIEKSATGQCDDFILVAEYKLDHSAGNYTNSEFPVKNCNATHLKFIITGGYDHFICIQKIAVHG 483
            DL    +G+ +I ++S DE +PPEN+IDGN +T++ TTGMFPQEF+I F   VKI+K+ + SY ++ ++IEK+ + +  DF    E  L H+ G   N E   ++  AT L+FII   +DHF  +  I+  G
Sbjct:    5 DLCSVTEGTEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVKIEKLVIQSYLVRTLRIEKTTSKEPLDFEQWVEKDLVHTEGQLQNEEIVARDGYATFLRFIIVSAFDHFASVHSISAEG 136          
BLAST of Zgc:158640 vs. UniProt/SwissProt
Match: sp|Q9Y547|IFT25_HUMAN (Intraflagellar transport protein 25 homolog OS=Homo sapiens OX=9606 GN=HSPB11 PE=1 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 4.058e-26
Identity = 56/134 (41.79%), Postives = 88/134 (65.67%), Query Frame = 1
Query:   88 DLALANQGXXXXXXXXXXXXXXXXNMIDGNIKTYFVTTGMFPQEFVIGFSSTVKIDKINLVSYNIKGIQIEKSATGQCDDFILVAEYKLDHSAGNYTNSEFPVKNCNATHLKFIITGGYDHFICIQKIAVHGNV 489
            DL L+++GS +I ++S DE +PPEN+IDGN +T++ TTGMFPQEF+I F   V+I+++ + SY ++ ++IEKS + +  DF    E  L H+ G   N E    + +AT+L+FII   +DHF  +  ++  G V
Sbjct:    5 DLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTV 138          
BLAST of Zgc:158640 vs. UniProt/SwissProt
Match: sp|Q9D6H2|IFT25_MOUSE (Intraflagellar transport protein 25 homolog OS=Mus musculus OX=10090 GN=Hspb11 PE=1 SV=2)

HSP 1 Score: 96.2857 bits (238), Expect = 1.497e-24
Identity = 55/132 (41.67%), Postives = 83/132 (62.88%), Query Frame = 1
Query:   88 DLALANQGXXXXXXXXXXXXXXXXNMIDGNIKTYFVTTGMFPQEFVIGFSSTVKIDKINLVSYNIKGIQIEKSATGQCDDFILVAEYKLDHSAGNYTNSEFPVKNCNATHLKFIITGGYDHFICIQKIAVHG 483
            DL    +G+ +I ++S DE +PPEN+IDGN +T++ TTGMFPQEF+I F   VKI+K+ + SY ++ ++IEK+ + +  DF    E  L H+ G   N E   ++  AT L+FII   +DHF  +  I+  G
Sbjct:    5 DLCSVTEGTEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVKIEKLVIQSYLVRTLRIEKTTSKEPLDFEQWVEKDLVHTEGQLQNEEIVARDGYATFLRFIIVSAFDHFASVHSISAEG 136          
BLAST of Zgc:158640 vs. UniProt/SwissProt
Match: sp|B8LIX8|IFT25_CHLRE (Intraflagellar transport protein 25 OS=Chlamydomonas reinhardtii OX=3055 GN=IFT25 PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 7.504e-18
Identity = 39/106 (36.79%), Postives = 63/106 (59.43%), Query Frame = 1
Query:  160 NMIDGNIKTYFVTTGMFPQEFVIGFSSTVKIDKINLVSYNIKGIQIEKSATGQCDDFILVAEYKLDHSAGNYTNSEFPVKNCNATHLKFIITGGYDHFICIQKIAV 477
            NM+DG   T++VTTGMFPQEFV+   S +++ KI  +S N++ + +EK    + D F  V E +L  + G+   +E    N  A +LKFI+  G+  F  + +++V
Sbjct:   27 NMLDGKDNTFWVTTGMFPQEFVLRLESCIRVSKITTLSLNVRKLAVEKCDQDKPDQFEKVFEVEL-ANRGDRLQTEVHQVNIRAKYLKFILLQGHGEFATVNRVSV 131          
BLAST of Zgc:158640 vs. TrEMBL
Match: A0A3P8YPH6 (Zgc:158640 OS=Esox lucius OX=8010 PE=4 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 2.125e-30
Identity = 57/132 (43.18%), Postives = 96/132 (72.73%), Query Frame = 1
Query:   82 MPDLALANQGXXXXXXXXXXXXXXXXNMIDGNIKTYFVTTGMFPQEFVIGFSSTVKIDKINLVSYNIKGIQIEKSATGQCDDFILVAEYKLDHSAGNYTNSEFPVKNCNATHLKFIITGGYDHFICIQKIAV 477
            M D AL++ G+ ++ ++S DE +PPEN+IDGNI+T++++TGMFPQEF+I F+ ++KI  + L SYN+K ++IEKS +    DF  ++E +L+H  G+   ++ P+     THL+FI+T G+DHF+ + +I++
Sbjct:    1 MIDHALSSLGAQVVLATSCDEKHPPENIIDGNIETFWISTGMFPQEFIIRFAESMKISLVTLHSYNVKTLKIEKSISDDATDFEPISEKQLEHIEGHLQTTDIPLNGLTVTHLRFIVTSGFDHFVSVHRISI 132          
BLAST of Zgc:158640 vs. TrEMBL
Match: B9EPG4 (Placental protein 25 OS=Salmo salar OX=8030 GN=PP25 PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 4.688e-29
Identity = 56/132 (42.42%), Postives = 95/132 (71.97%), Query Frame = 1
Query:   82 MPDLALANQGXXXXXXXXXXXXXXXXNMIDGNIKTYFVTTGMFPQEFVIGFSSTVKIDKINLVSYNIKGIQIEKSATGQCDDFILVAEYKLDHSAGNYTNSEFPVKNCNATHLKFIITGGYDHFICIQKIAV 477
            M D AL + G+ I+ ++S DE++PPEN+IDGN +T++++TGMFPQEF+I F+ ++KI  + +  YN+K ++IEKS +    DF  ++E + +H+ G+   ++ P+    ATHL+FI+T GYDHF+ + +++V
Sbjct:    1 MIDPALGSLGAQIVLAASSDENHPPENIIDGNTETFWMSTGMFPQEFIIRFAESMKIALVTMHCYNVKTLKIEKSISDDATDFEAISEKEFEHTEGHLQTNDIPLNGTTATHLRFIVTSGYDHFVSVHRVSV 132          
BLAST of Zgc:158640 vs. TrEMBL
Match: A0A060X6U3 (F5/8 type C domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00019228001 PE=4 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 8.701e-29
Identity = 56/132 (42.42%), Postives = 94/132 (71.21%), Query Frame = 1
Query:   82 MPDLALANQGXXXXXXXXXXXXXXXXNMIDGNIKTYFVTTGMFPQEFVIGFSSTVKIDKINLVSYNIKGIQIEKSATGQCDDFILVAEYKLDHSAGNYTNSEFPVKNCNATHLKFIITGGYDHFICIQKIAV 477
            M D AL + G+ I+ ++S DE++PPEN+IDGN  T++++TGMFPQEF+I F+ ++KI  + +  YN+K ++IEKS +    DF  ++E + +H+ G+   ++ P+    ATHL+FI+T GYDHF+ + +++V
Sbjct:    1 MIDPALVSLGAQIVLAASSDENHPPENIIDGNTATFWMSTGMFPQEFIIRFAESMKIALVTMHCYNVKTLKIEKSISDDATDFEAISEKEFEHTEGHLQTNDIPLNGTTATHLRFIVTSGYDHFVSVHRVSV 132          
BLAST of Zgc:158640 vs. TrEMBL
Match: W5MZY4 (Zgc:158640 OS=Lepisosteus oculatus OX=7918 PE=4 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.410e-28
Identity = 57/135 (42.22%), Postives = 95/135 (70.37%), Query Frame = 1
Query:   82 MPDLALANQGXXXXXXXXXXXXXXXXNMIDGNIKTYFVTTGMFPQEFVIGFSSTVKIDKINLVSYNIKGIQIEKSATGQCDDFILVAEYKLDHSAGNYTNSEFPVKNCNATHLKFIITGGYDHFICIQKIAVHGN 486
            M D AL++ G+ ++ ++S DE+YPPEN+IDG+ +T++++TGMFPQEF+I FS T KI  + + SYN+K ++I+KS      DF  + + + +H+ G   +++F +    ATHL+FIIT G+DHF+ + ++ V G+
Sbjct:    1 MIDAALSSSGAQVVLATSSDENYPPENIIDGSTETFWISTGMFPQEFIIRFSGTQKIRLVTIQSYNVKNLKIQKSTFSDATDFEGIIDKEFEHTEGQLQSNDFALNGTRATHLRFIITSGFDHFVSVHRVMVEGS 135          
BLAST of Zgc:158640 vs. TrEMBL
Match: A0A4W5P8F0 (Zgc:158640 OS=Hucho hucho OX=62062 PE=4 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 5.621e-28
Identity = 54/132 (40.91%), Postives = 95/132 (71.97%), Query Frame = 1
Query:   82 MPDLALANQGXXXXXXXXXXXXXXXXNMIDGNIKTYFVTTGMFPQEFVIGFSSTVKIDKINLVSYNIKGIQIEKSATGQCDDFILVAEYKLDHSAGNYTNSEFPVKNCNATHLKFIITGGYDHFICIQKIAV 477
            M D AL++ G+ I+ ++S DE++PPEN+IDG+ +T++++TGMFPQEF+I  + ++KI  + +  YN+K ++IEKS +    DF  ++E + +H+ G+   ++ P+    ATHL+FI+T GYDHF+ + +++V
Sbjct:    1 MVDPALSSLGAQIVLAASSDENHPPENIIDGSTETFWMSTGMFPQEFIIRLAESMKIALVTMHCYNVKTLKIEKSISDDATDFEAISEKEFEHTEGHLQTNDIPLNGTTATHLRFIVTSGYDHFVSVHRVSV 132          
BLAST of Zgc:158640 vs. Ensembl Cavefish
Match: zgc:158640 (heat shock protein family B (small) member 11 [Source:NCBI gene;Acc:103024080])

HSP 1 Score: 100.523 bits (249), Expect = 3.108e-27
Identity = 40/108 (37.04%), Postives = 73/108 (67.59%), Query Frame = 1
Query:  160 NMIDGNIKTYFVTTGMFPQEFVIGFSSTVKIDKINLVSYNIKGIQIEKSATGQCDDFILVAEYKLDHSAGNYTNSEFPVKNCNATHLKFIITGGYDHFICIQKIAVHG 483
            N++DG  +T++++TGMFPQEF+I F   +K+  I++ S+N+K ++IEK+   + D F ++AE + + +  +   ++  V   +ATHL+F+I  GYDHF+ + K++V  
Sbjct:   27 NILDGKTETFWLSTGMFPQEFIIRFPDNMKVSLISVHSFNVKHLRIEKNTLEEADKFQVMAEKEFEQTENSLQTNDISVDGSHATHLRFLIISGYDHFVSVHKVSVEA 134          
BLAST of Zgc:158640 vs. Ensembl Cavefish
Match: zgc:158640 (heat shock protein family B (small) member 11 [Source:NCBI gene;Acc:103024080])

HSP 1 Score: 81.6481 bits (200), Expect = 1.362e-19
Identity = 40/143 (27.97%), Postives = 73/143 (51.05%), Query Frame = 1
Query:  160 NMIDGNIKTYFVTTGMFPQEFVIGFSSTVKIDKINLVSYNIKGIQIEKSATGQCDDFILVAE-------------------------------------YKLDHSAGNYTNSEFPVKNCNATHLKFIITGGYDHFICIQKIAV 477
            N++DG  +T++++TGMFPQEF+I F   +K+  I++ S+N+K ++IEK+   + D F ++AE                                      + + +  +   ++  V   +ATHL+F+I  GYDHF+ + K++V
Sbjct:   27 NILDGKTETFWLSTGMFPQEFIIRFPDNMKVSLISVHSFNVKHLRIEKNTLEEADKFQVMAEKGKNPQSAQGLHSLNNLKLHKIRLSEIQLTRLHEFCVLEFEQTENSLQTNDISVDGSHATHLRFLIISGYDHFVSVHKVSV 169          
BLAST of Zgc:158640 vs. Ensembl Nematostella
Match: EDO48843 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIR2])

HSP 1 Score: 92.8189 bits (229), Expect = 1.145e-24
Identity = 55/134 (41.04%), Postives = 87/134 (64.93%), Query Frame = 1
Query:   82 MPDLALANQGXXXXXXXXXXXXXXXXNMIDGNIKTYFVTTGMFPQEFVIGFSSTVKIDKINLVSYNIKGIQIEKSATGQCDDFILVAEYKLDHSAGNYTNSEFPVKNCNATHLKFIITGGYDHFICIQKIAVHG 483
            M D+AL + G+ I   SSYDE+YPPEN+IDG + T++ TTG+FPQE ++ F+S + I  I ++  N+K +QI+KS      DF  +AE + +++ G     +  +   +A H++F+I  G+DHFI I KI++ G
Sbjct:    1 MFDVALNSAGAKIALVSSYDENYPPENVIDGTLDTFWPTTGLFPQELILSFNSLMSIRMIKIMCSNVKDLQIQKSTKTDPVDFETLAEKEFENTDGQMQMEDIKIPVTSACHIRFVIKSGFDHFISIHKISIEG 134          
BLAST of Zgc:158640 vs. Ensembl Medaka
Match: zgc:158640 (heat shock protein family B (small) member 11 [Source:NCBI gene;Acc:101165398])

HSP 1 Score: 99.3673 bits (246), Expect = 6.653e-27
Identity = 42/106 (39.62%), Postives = 69/106 (65.09%), Query Frame = 1
Query:  160 NMIDGNIKTYFVTTGMFPQEFVIGFSSTVKIDKINLVSYNIKGIQIEKSATGQCDDFILVAEYKLDHSAGNYTNSEFPVKNCNATHLKFIITGGYDHFICIQKIAV 477
            N++DGNI T++++TGMFPQEF+I F     I  + + SYN+K ++IEK+ +     F  V E + + + G+   +   +   +ATHL+FIIT GYDHF+ + K+++
Sbjct:   27 NIVDGNINTFWMSTGMFPQEFIIRFPEPTTISALTVDSYNVKKLKIEKNISQSASQFESVTEKEFESTEGHLQTNAISLNPGSATHLRFIITSGYDHFVSVHKVSI 132          
BLAST of Zgc:158640 vs. Planmine SMEST
Match: SMESG000055915.1 (SMESG000055915.1)

HSP 1 Score: 242.662 bits (618), Expect = 2.382e-83
Identity = 137/137 (100.00%), Postives = 137/137 (100.00%), Query Frame = 1
Query:   82 MPDLALANQGXXXXXXXXXXXXXXXXNMIDGNIKTYFVTTGMFPQEFVIGFSSTVKIDKINLVSYNIKGIQIEKSATGQCDDFILVAEYKLDHSAGNYTNSEFPVKNCNATHLKFIITGGYDHFICIQKIAVHGNVA 492
            MPDLALANQGSYIISSSSYDEDYPPENMIDGNIKTYFVTTGMFPQEFVIGFSSTVKIDKINLVSYNIKGIQIEKSATGQCDDFILVAEYKLDHSAGNYTNSEFPVKNCNATHLKFIITGGYDHFICIQKIAVHGNVA
Sbjct:    1 MPDLALANQGSYIISSSSYDEDYPPENMIDGNIKTYFVTTGMFPQEFVIGFSSTVKIDKINLVSYNIKGIQIEKSATGQCDDFILVAEYKLDHSAGNYTNSEFPVKNCNATHLKFIITGGYDHFICIQKIAVHGNVA 137          
The following BLAST results are available for this feature:
BLAST of Zgc:158640 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
HSPB118.450e-2741.79heat shock protein family B (small) member 11 [Sou... [more]
HSPB111.146e-1744.66heat shock protein family B (small) member 11 [Sou... [more]
HSPB111.405e-1639.37heat shock protein family B (small) member 11 [Sou... [more]
HSPB119.503e-1152.38heat shock protein family B (small) member 11 [Sou... [more]
back to top
BLAST of Zgc:158640 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zgc:158640 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zgc:158640 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zgc:1586402.476e-2943.94zgc:158640 [Source:ZFIN;Acc:ZDB-GENE-061215-15][more]
back to top
BLAST of Zgc:158640 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hspb112.778e-2434.59heat shock protein family B (small) member 11 [Sou... [more]
back to top
BLAST of Zgc:158640 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Hspb112.141e-2541.67heat shock protein family B (small), member 11 [So... [more]
Hspb112.141e-2541.67heat shock protein family B (small), member 11 [So... [more]
Hspb112.141e-2541.67heat shock protein family B (small), member 11 [So... [more]
back to top
BLAST of Zgc:158640 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q9Y547|IFT25_HUMAN4.058e-2641.79Intraflagellar transport protein 25 homolog OS=Hom... [more]
sp|Q9D6H2|IFT25_MOUSE1.497e-2441.67Intraflagellar transport protein 25 homolog OS=Mus... [more]
sp|B8LIX8|IFT25_CHLRE7.504e-1836.79Intraflagellar transport protein 25 OS=Chlamydomon... [more]
back to top
BLAST of Zgc:158640 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P8YPH62.125e-3043.18Zgc:158640 OS=Esox lucius OX=8010 PE=4 SV=1[more]
B9EPG44.688e-2942.42Placental protein 25 OS=Salmo salar OX=8030 GN=PP2... [more]
A0A060X6U38.701e-2942.42F5/8 type C domain-containing protein OS=Oncorhync... [more]
W5MZY41.410e-2842.22Zgc:158640 OS=Lepisosteus oculatus OX=7918 PE=4 SV... [more]
A0A4W5P8F05.621e-2840.91Zgc:158640 OS=Hucho hucho OX=62062 PE=4 SV=1[more]
back to top
BLAST of Zgc:158640 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
zgc:1586403.108e-2737.04heat shock protein family B (small) member 11 [Sou... [more]
zgc:1586401.362e-1927.97heat shock protein family B (small) member 11 [Sou... [more]
back to top
BLAST of Zgc:158640 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zgc:158640 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zgc:158640 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO488431.145e-2441.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Zgc:158640 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zgc:1586406.653e-2739.62heat shock protein family B (small) member 11 [Sou... [more]
back to top
BLAST of Zgc:158640 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000055915.12.382e-83100.00SMESG000055915.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014142 ID=SMED30014142|Name=Zgc:158640|organism=Schmidtea mediterranea sexual|type=transcript|length=533bp
TTTAATATTACCGTTGTCATTGTAAATTATATCATTTTCAAATTTATTTA
AAACAATATTGTTTTTGAATAAGACTACATAATGCCAGATTTAGCTTTAG
CTAACCAAGGATCTTACATTATATCTTCATCTTCATACGATGAAGATTAT
CCACCTGAAAACATGATTGATGGTAATATCAAAACATACTTTGTAACTAC
TGGTATGTTTCCTCAAGAATTCGTAATTGGGTTTAGTTCAACAGTTAAAA
TTGACAAAATCAACTTAGTTTCATATAACATTAAAGGAATTCAGATTGAA
AAATCAGCAACTGGTCAATGTGATGATTTCATTTTAGTTGCTGAATATAA
ACTGGATCATTCTGCTGGAAATTATACAAATTCAGAATTTCCAGTTAAGA
ATTGCAATGCGACGCATTTAAAATTTATCATTACAGGTGGATATGATCAT
TTTATCTGCATTCAGAAAATAGCAGTTCATGGAAATGTTGCATAAATTAT
TATAAAAAATAGACTTGTTCATTATTTGATTGA
back to top

protein sequence of SMED30014142-orf-1

>SMED30014142-orf-1 ID=SMED30014142-orf-1|Name=SMED30014142-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=138bp
MPDLALANQGSYIISSSSYDEDYPPENMIDGNIKTYFVTTGMFPQEFVIG
FSSTVKIDKINLVSYNIKGIQIEKSATGQCDDFILVAEYKLDHSAGNYTN
SEFPVKNCNATHLKFIITGGYDHFICIQKIAVHGNVA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR033558IFT25
IPR008979Galactose-bd-like_sf
IPR000421FA58C
Vocabulary: cellular component
TermDefinition
GO:0030992intraciliary transport particle B
GO:0031514motile cilium
Vocabulary: biological process
TermDefinition
GO:0042073intraciliary transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000421Coagulation factor 5/8 C-terminal domainPFAMPF00754F5_F8_type_Ccoord: 15..119
e-value: 1.0E-6
score: 28.8
IPR008979Galactose-binding-like domain superfamilyGENE3DG3DSA:2.60.120.260coord: 1..137
e-value: 4.1E-38
score: 132.6
IPR008979Galactose-binding-like domain superfamilySUPERFAMILYSSF49785Galactose-binding domain-likecoord: 12..134
IPR033558Intraflagellar transport protein 25PANTHERPTHR33906FAMILY NOT NAMEDcoord: 1..134