Acyl carrier protein

Overview
NameAcyl carrier protein
Smed IDSMED30014141
Length (bp)657
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Acyl carrier protein (SMED30014141) t-SNE clustered cells

Violin plots show distribution of expression levels for Acyl carrier protein (SMED30014141) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Acyl carrier protein (SMED30014141) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Acyl carrier protein (SMED30014141) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Acyl carrier protein vs. Ensembl Human
Match: NDUFAB1 (NADH:ubiquinone oxidoreductase subunit AB1 [Source:HGNC Symbol;Acc:HGNC:7694])

HSP 1 Score: 87.8113 bits (216), Expect = 2.583e-21
Identity = 61/154 (39.61%), Postives = 95/154 (61.69%), Query Frame = 2
Query:   56 SRFLLSHSCKCFLKHNLIVRLPFQRISRMLNTSISSNVFYNRCH------IERQLKSNKLTTMRRYSS-EALSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            SR L ++  +       + R+    ++R L+T++ S     R        +  Q+        R+YS    L++E + DRV+ +L+LYDKIDP+K++++SH M D+G+DSLD VE+IMA+E+EF FEIPD +A KL  P+EI+ Y+ DK DVY+
Sbjct:    3 SRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE 156          
BLAST of Acyl carrier protein vs. Ensembl Human
Match: NDUFAB1 (NADH:ubiquinone oxidoreductase subunit AB1 [Source:HGNC Symbol;Acc:HGNC:7694])

HSP 1 Score: 87.8113 bits (216), Expect = 2.583e-21
Identity = 61/154 (39.61%), Postives = 95/154 (61.69%), Query Frame = 2
Query:   56 SRFLLSHSCKCFLKHNLIVRLPFQRISRMLNTSISSNVFYNRCH------IERQLKSNKLTTMRRYSS-EALSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            SR L ++  +       + R+    ++R L+T++ S     R        +  Q+        R+YS    L++E + DRV+ +L+LYDKIDP+K++++SH M D+G+DSLD VE+IMA+E+EF FEIPD +A KL  P+EI+ Y+ DK DVY+
Sbjct:    3 SRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE 156          
BLAST of Acyl carrier protein vs. Ensembl Human
Match: NDUFAB1 (NADH:ubiquinone oxidoreductase subunit AB1 [Source:HGNC Symbol;Acc:HGNC:7694])

HSP 1 Score: 62.3882 bits (150), Expect = 1.328e-12
Identity = 39/66 (59.09%), Postives = 56/66 (84.85%), Query Frame = 2
Query:  245 ALSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKL 442
             L++E + DRV+ +L+LYDKIDP+K++++SH M D+G+DSLD VE+IMA+E+EF FEIPD +A KL
Sbjct:    3 PLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKL 68          
BLAST of Acyl carrier protein vs. Ensembl Human
Match: NDUFAB1 (NADH:ubiquinone oxidoreductase subunit AB1 [Source:HGNC Symbol;Acc:HGNC:7694])

HSP 1 Score: 52.7582 bits (125), Expect = 1.099e-8
Identity = 34/60 (56.67%), Postives = 49/60 (81.67%), Query Frame = 2
Query:  317 KITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            +++++SH M D+G+DSLD VE+IMA+E+EF FEIPD +A KL  P+EI+ Y+ DK DVY+
Sbjct:   52 QLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE 111          
BLAST of Acyl carrier protein vs. Ensembl Celegans
Match: Y56A3A.19 (Acyl carrier protein [Source:UniProtKB/TrEMBL;Acc:Q9U241])

HSP 1 Score: 84.3445 bits (207), Expect = 1.120e-20
Identity = 50/92 (54.35%), Postives = 74/92 (80.43%), Query Frame = 2
Query:  224 MRRYSSEA-LSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            +R+YS++A L+ + + +R++L+L LYDKID +K+T+DS    D+G+DSLDHVEV+MA+EEEF FEIPD +A +  TPR+I QY+ DK DV++
Sbjct:   42 IRQYSAKAPLTKKTLEERIVLVLSLYDKIDAKKLTMDSDFSKDLGLDSLDHVEVVMAMEEEFGFEIPDGDADRFKTPRDIFQYIADKEDVFE 133          
BLAST of Acyl carrier protein vs. Ensembl Celegans
Match: F37C12.3 (Acyl carrier protein [Source:UniProtKB/TrEMBL;Acc:Q20122])

HSP 1 Score: 53.1434 bits (126), Expect = 7.475e-9
Identity = 39/104 (37.50%), Postives = 64/104 (61.54%), Query Frame = 2
Query:  197 QLKSNKLTTMRRY-SSEALSIEMVSDRVMLILRLYDKIDPQK---ITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            Q + +K+     +   + L+ + V DRV+  +R +D+    K   + LD+ L  D G DSLD VE++MA+E+EF FEIP Q++ K  T R+  +Y+C++ DVY+
Sbjct:   42 QTRGSKIEVFGPFDPPKQLTFKQVEDRVLKAVRSWDRFPADKESLLKLDADLSKDFGFDSLDQVEIVMALEDEFGFEIPLQDSDKFKTIRDAFKYICEREDVYE 145          
BLAST of Acyl carrier protein vs. Ensembl Celegans
Match: F37C12.3 (Acyl carrier protein [Source:UniProtKB/TrEMBL;Acc:Q20122])

HSP 1 Score: 53.1434 bits (126), Expect = 7.475e-9
Identity = 39/104 (37.50%), Postives = 64/104 (61.54%), Query Frame = 2
Query:  197 QLKSNKLTTMRRY-SSEALSIEMVSDRVMLILRLYDKIDPQK---ITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            Q + +K+     +   + L+ + V DRV+  +R +D+    K   + LD+ L  D G DSLD VE++MA+E+EF FEIP Q++ K  T R+  +Y+C++ DVY+
Sbjct:   42 QTRGSKIEVFGPFDPPKQLTFKQVEDRVLKAVRSWDRFPADKESLLKLDADLSKDFGFDSLDQVEIVMALEDEFGFEIPLQDSDKFKTIRDAFKYICEREDVYE 145          
BLAST of Acyl carrier protein vs. Ensembl Fly
Match: ND-ACP (gene:FBgn0011361 transcript:FBtr0072676)

HSP 1 Score: 93.2041 bits (230), Expect = 8.667e-24
Identity = 55/92 (59.78%), Postives = 79/92 (85.87%), Query Frame = 2
Query:  224 MRRYSSEA-LSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            +RRYS++  LS++++++RV+L+L+LYDKIDP K+ ++SH +ND+G+DSLDHVEVIMA+E+EF FEIPD +A KL  P +II+YV DK DVY+
Sbjct:   61 VRRYSAKPPLSLKLINERVLLVLKLYDKIDPSKLNVESHFINDLGLDSLDHVEVIMAMEDEFGFEIPDSDAEKLLKPADIIKYVADKEDVYE 152          
BLAST of Acyl carrier protein vs. Ensembl Fly
Match: ND-ACP (gene:FBgn0011361 transcript:FBtr0331864)

HSP 1 Score: 93.5893 bits (231), Expect = 1.262e-23
Identity = 55/92 (59.78%), Postives = 79/92 (85.87%), Query Frame = 2
Query:  224 MRRYSSEA-LSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            +RRYS++  LS++++++RV+L+L+LYDKIDP K+ ++SH +ND+G+DSLDHVEVIMA+E+EF FEIPD +A KL  P +II+YV DK DVY+
Sbjct:   90 VRRYSAKPPLSLKLINERVLLVLKLYDKIDPSKLNVESHFINDLGLDSLDHVEVIMAMEDEFGFEIPDSDAEKLLKPADIIKYVADKEDVYE 181          
BLAST of Acyl carrier protein vs. Ensembl Fly
Match: ND-ACP (gene:FBgn0011361 transcript:FBtr0072677)

HSP 1 Score: 75.0998 bits (183), Expect = 4.919e-17
Identity = 48/91 (52.75%), Postives = 71/91 (78.02%), Query Frame = 2
Query:  224 MRRYSSEALSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            +R YS+++ +IE +  RV+ ++  YDK+  +K+ ++SH +ND+G+DSLDHVEVIMA+E+EF FEIPD +A KL  P +II+YV DK DVY+
Sbjct:   54 VRSYSAKS-TIEDIKFRVLKVVSAYDKVTAEKLNVESHFINDLGLDSLDHVEVIMAMEDEFGFEIPDSDAEKLLKPADIIKYVADKEDVYE 143          
BLAST of Acyl carrier protein vs. Ensembl Zebrafish
Match: ndufab1a (NADH:ubiquinone oxidoreductase subunit AB1a [Source:ZFIN;Acc:ZDB-GENE-040801-1])

HSP 1 Score: 79.7221 bits (195), Expect = 1.791e-18
Identity = 44/86 (51.16%), Postives = 70/86 (81.40%), Query Frame = 2
Query:  239 SEALSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            S  L+++ V +RV+ +L+LYDKI+P+K+ + SH M D+G+DSLD VE+IMA+E+EF FEIPD++A KL TP +++QY+ +K +V++
Sbjct:   70 SPPLTLKTVHERVLYVLKLYDKINPEKLQVTSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDEDAEKLMTPEQVVQYIAEKKEVHE 155          
BLAST of Acyl carrier protein vs. Ensembl Zebrafish
Match: ndufab1a (NADH:ubiquinone oxidoreductase subunit AB1a [Source:ZFIN;Acc:ZDB-GENE-040801-1])

HSP 1 Score: 79.7221 bits (195), Expect = 1.791e-18
Identity = 44/86 (51.16%), Postives = 70/86 (81.40%), Query Frame = 2
Query:  239 SEALSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            S  L+++ V +RV+ +L+LYDKI+P+K+ + SH M D+G+DSLD VE+IMA+E+EF FEIPD++A KL TP +++QY+ +K +V++
Sbjct:   70 SPPLTLKTVHERVLYVLKLYDKINPEKLQVTSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDEDAEKLMTPEQVVQYIAEKKEVHE 155          
BLAST of Acyl carrier protein vs. Ensembl Zebrafish
Match: ndufab1b (NADH:ubiquinone oxidoreductase subunit AB1b [Source:ZFIN;Acc:ZDB-GENE-030131-4437])

HSP 1 Score: 73.9442 bits (180), Expect = 2.160e-16
Identity = 47/91 (51.65%), Postives = 67/91 (73.63%), Query Frame = 2
Query:  227 RRYS-SEALSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            R YS +  L+++ + +RV+ +L+LYDKI+P  +   SH M D+G+DSLD VE+IMA+E+EF FEIPD +  KL TP EI+ Y+ DK DVY+
Sbjct:   63 RHYSDAPPLTLDDIQERVLYVLKLYDKINPDVLKSTSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDGDGEKLMTPEEIVTYIADKKDVYE 153          
BLAST of Acyl carrier protein vs. Ensembl Zebrafish
Match: ndufab1b (NADH:ubiquinone oxidoreductase subunit AB1b [Source:ZFIN;Acc:ZDB-GENE-030131-4437])

HSP 1 Score: 73.9442 bits (180), Expect = 2.160e-16
Identity = 47/91 (51.65%), Postives = 67/91 (73.63%), Query Frame = 2
Query:  227 RRYS-SEALSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            R YS +  L+++ + +RV+ +L+LYDKI+P  +   SH M D+G+DSLD VE+IMA+E+EF FEIPD +  KL TP EI+ Y+ DK DVY+
Sbjct:   63 RHYSDAPPLTLDDIQERVLYVLKLYDKINPDVLKSTSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDGDGEKLMTPEEIVTYIADKKDVYE 153          
BLAST of Acyl carrier protein vs. Ensembl Xenopus
Match: ndufab1 (NADH:ubiquinone oxidoreductase subunit AB1 [Source:NCBI gene;Acc:448707])

HSP 1 Score: 85.1149 bits (209), Expect = 1.943e-20
Identity = 50/101 (49.50%), Postives = 75/101 (74.26%), Query Frame = 2
Query:  197 QLKSNKLTTMRRYSS-EALSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            Q+ ++     R+Y     L++E + +RV+ +L+LYDKIDP+K+++ SH M D+G+DSLD VE+IMA+E+EF FEIPD +  KL TP+EI+ Y+ DK DVY+
Sbjct:   49 QVSTSLFQLCRQYGDLPPLTLENIGERVLYVLKLYDKIDPEKLSVGSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDADGEKLMTPQEIVDYIADKKDVYE 149          
BLAST of Acyl carrier protein vs. Ensembl Mouse
Match: Ndufab1 (NADH:ubiquinone oxidoreductase subunit AB1 [Source:MGI Symbol;Acc:MGI:1917566])

HSP 1 Score: 87.4261 bits (215), Expect = 2.337e-21
Identity = 58/135 (42.96%), Postives = 89/135 (65.93%), Query Frame = 2
Query:  113 RLPFQRISRMLNTSISSNVFYNRCHIER------QLKSNKLTTMRRYS-SEALSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            RLP   ++R L+T++       R    +      Q+        R+YS +  L+++ + DRV+ +L+LYDKIDP+K++++SH M D+G+DSLD VE+IMA+E+EF FEIPD +A KL  P+EI+ Y+ DK DVY+
Sbjct:   22 RLPTLALARPLSTTLCPEGIRRRPGALQSALALAQVPGTVTHLCRQYSDAPPLTLDGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE 156          
BLAST of Acyl carrier protein vs. Ensembl Mouse
Match: Ndufab1 (NADH:ubiquinone oxidoreductase subunit AB1 [Source:MGI Symbol;Acc:MGI:1917566])

HSP 1 Score: 87.4261 bits (215), Expect = 2.337e-21
Identity = 58/135 (42.96%), Postives = 89/135 (65.93%), Query Frame = 2
Query:  113 RLPFQRISRMLNTSISSNVFYNRCHIER------QLKSNKLTTMRRYS-SEALSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            RLP   ++R L+T++       R    +      Q+        R+YS +  L+++ + DRV+ +L+LYDKIDP+K++++SH M D+G+DSLD VE+IMA+E+EF FEIPD +A KL  P+EI+ Y+ DK DVY+
Sbjct:   22 RLPTLALARPLSTTLCPEGIRRRPGALQSALALAQVPGTVTHLCRQYSDAPPLTLDGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE 156          
BLAST of Acyl carrier protein vs. Ensembl Mouse
Match: Ndufab1 (NADH:ubiquinone oxidoreductase subunit AB1 [Source:MGI Symbol;Acc:MGI:1917566])

HSP 1 Score: 83.5741 bits (205), Expect = 3.094e-20
Identity = 50/91 (54.95%), Postives = 74/91 (81.32%), Query Frame = 2
Query:  227 RRYS-SEALSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            R+YS +  L+++ + DRV+ +L+LYDKIDP+K++++SH M D+G+DSLD VE+IMA+E+EF FEIPD +A KL  P+EI+ Y+ DK DVY+
Sbjct:   37 RQYSDAPPLTLDGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE 127          
BLAST of Acyl carrier protein vs. Ensembl Mouse
Match: Ndufab1 (NADH:ubiquinone oxidoreductase subunit AB1 [Source:MGI Symbol;Acc:MGI:1917566])

HSP 1 Score: 83.5741 bits (205), Expect = 3.175e-20
Identity = 50/91 (54.95%), Postives = 74/91 (81.32%), Query Frame = 2
Query:  227 RRYS-SEALSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            R+YS +  L+++ + DRV+ +L+LYDKIDP+K++++SH M D+G+DSLD VE+IMA+E+EF FEIPD +A KL  P+EI+ Y+ DK DVY+
Sbjct:   38 RQYSDAPPLTLDGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE 128          
BLAST of Acyl carrier protein vs. UniProt/SwissProt
Match: sp|Q94519|ACPM_DROME (Acyl carrier protein, mitochondrial OS=Drosophila melanogaster OX=7227 GN=ND-ACP PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 2.688e-22
Identity = 54/92 (58.70%), Postives = 79/92 (85.87%), Query Frame = 2
Query:  224 MRRYSSEA-LSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            +R+YS++  LS++++++RV+L+L+LYDKIDP K+ ++SH +ND+G+DSLDHVEVIMA+E+EF FEIPD +A KL  P +II+YV DK DVY+
Sbjct:   61 VRKYSAKPPLSLKLINERVLLVLKLYDKIDPSKLNVESHFINDLGLDSLDHVEVIMAMEDEFGFEIPDSDAEKLLKPADIIKYVADKEDVYE 152          
BLAST of Acyl carrier protein vs. UniProt/SwissProt
Match: sp|P52505|ACPM_BOVIN (Acyl carrier protein, mitochondrial OS=Bos taurus OX=9913 GN=NDUFAB1 PE=1 SV=2)

HSP 1 Score: 88.5817 bits (218), Expect = 6.225e-21
Identity = 59/135 (43.70%), Postives = 89/135 (65.93%), Query Frame = 2
Query:  113 RLPFQRISRMLNTSISSNVFYNRCH------IERQLKSNKLTTMRRYS-SEALSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            RLP    +R L+T++ +     R        +  Q+        R+YS +  L++E + DRV+ +L+LYDKIDP+K++++SH M D+G+DSLD VE+IMA+E+EF FEIPD +A KL  P+EI+ Y+ DK DVY+
Sbjct:   22 RLPTLAAARPLSTTLFAAETRTRPGAPLPALVLAQVPGRVTQLCRQYSDAPPLTLEGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE 156          
BLAST of Acyl carrier protein vs. UniProt/SwissProt
Match: sp|Q0MQC3|ACPM_PANTR (Acyl carrier protein, mitochondrial OS=Pan troglodytes OX=9598 GN=NDUFAB1 PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 1.241e-20
Identity = 61/154 (39.61%), Postives = 95/154 (61.69%), Query Frame = 2
Query:   56 SRFLLSHSCKCFLKHNLIVRLPFQRISRMLNTSISSNVFYNRCH------IERQLKSNKLTTMRRYSS-EALSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            SR L ++  +       + R+    ++R L+T++ S     R        +  Q+        R+YS    L++E + DRV+ +L+LYDKIDP+K++++SH M D+G+DSLD VE+IMA+E+EF FEIPD +A KL  P+EI+ Y+ DK DVY+
Sbjct:    3 SRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE 156          
BLAST of Acyl carrier protein vs. UniProt/SwissProt
Match: sp|O14561|ACPM_HUMAN (Acyl carrier protein, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFAB1 PE=1 SV=3)

HSP 1 Score: 87.8113 bits (216), Expect = 1.241e-20
Identity = 61/154 (39.61%), Postives = 95/154 (61.69%), Query Frame = 2
Query:   56 SRFLLSHSCKCFLKHNLIVRLPFQRISRMLNTSISSNVFYNRCH------IERQLKSNKLTTMRRYSS-EALSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            SR L ++  +       + R+    ++R L+T++ S     R        +  Q+        R+YS    L++E + DRV+ +L+LYDKIDP+K++++SH M D+G+DSLD VE+IMA+E+EF FEIPD +A KL  P+EI+ Y+ DK DVY+
Sbjct:    3 SRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE 156          
BLAST of Acyl carrier protein vs. UniProt/SwissProt
Match: sp|Q0MQC2|ACPM_GORGO (Acyl carrier protein, mitochondrial OS=Gorilla gorilla gorilla OX=9595 GN=NDUFAB1 PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 1.241e-20
Identity = 61/154 (39.61%), Postives = 95/154 (61.69%), Query Frame = 2
Query:   56 SRFLLSHSCKCFLKHNLIVRLPFQRISRMLNTSISSNVFYNRCH------IERQLKSNKLTTMRRYSS-EALSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            SR L ++  +       + R+    ++R L+T++ S     R        +  Q+        R+YS    L++E + DRV+ +L+LYDKIDP+K++++SH M D+G+DSLD VE+IMA+E+EF FEIPD +A KL  P+EI+ Y+ DK DVY+
Sbjct:    3 SRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE 156          
BLAST of Acyl carrier protein vs. TrEMBL
Match: A0A1B0CNZ7 (Acyl carrier protein OS=Lutzomyia longipalpis OX=7200 PE=3 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 4.894e-24
Identity = 59/101 (58.42%), Postives = 84/101 (83.17%), Query Frame = 2
Query:  197 QLKSNKLTTMRRYSSEA-LSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            Q+   +   +R+YS++A L+I+ +++RV+L+L+LYDKIDP K+TLDSH +ND+G+DSLDHVEVIMA+E+EF FEIPD +A KLN P +I++YV DK DVY+
Sbjct:   55 QVHGWQYQILRQYSAKAPLTIQFITERVLLVLKLYDKIDPSKLTLDSHFINDLGLDSLDHVEVIMAMEDEFGFEIPDHDAEKLNRPADIVRYVADKEDVYE 155          
BLAST of Acyl carrier protein vs. TrEMBL
Match: A0A1L8E0Q9 (Acyl carrier protein OS=Nyssomyia neivai OX=330878 PE=3 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 2.363e-23
Identity = 57/101 (56.44%), Postives = 84/101 (83.17%), Query Frame = 2
Query:  197 QLKSNKLTTMRRYSSEA-LSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            Q+   +   +R+YS++A L+I+ +++RV+L+L+LYDK+DP K+T+DSH +ND+G+DSLDHVEVIMA+E+EF FEIPD +A KLN P +I++YV DK DVY+
Sbjct:   55 QVHGWQYQILRQYSAKAPLTIQFITERVLLVLKLYDKVDPSKLTIDSHFINDLGLDSLDHVEVIMAMEDEFGFEIPDHDAEKLNRPADIVRYVADKEDVYE 155          
BLAST of Acyl carrier protein vs. TrEMBL
Match: A0A3P8HF21 (Acyl carrier protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS7455 PE=3 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 2.404e-23
Identity = 66/118 (55.93%), Postives = 83/118 (70.34%), Query Frame = 2
Query:  167 VFYNRCHIE-RQLKSNKLTTM------RRYS-SEALSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            VF NRC I  R L  N + T+      R YS    ++  M+ DRVML+LRLYDK+DP K++L S L  D GIDSLDHVE++MAIEEEF FEIPD ++ K  TP +II+Y+CDKYD+YD
Sbjct:    2 VFSNRCSIMIRALGFNGVNTVTLKNIRRSYSHGPPVTKPMIEDRVMLVLRLYDKVDPNKLSLSSDLAKDFGIDSLDHVELVMAIEEEFNFEIPDMDSEKFRTPGDIIRYICDKYDLYD 119          
BLAST of Acyl carrier protein vs. TrEMBL
Match: A0A183AKG8 (Acyl carrier protein OS=Echinostoma caproni OX=27848 PE=3 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 2.482e-23
Identity = 66/118 (55.93%), Postives = 83/118 (70.34%), Query Frame = 2
Query:  167 VFYNRCHIE-RQLKSNKLTTM------RRYS-SEALSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            VF NRC I  R L  N + T+      R YS    ++  M+ DRVML+LRLYDK+DP K++L S L  D GIDSLDHVE++MAIEEEF FEIPD ++ K  TP +II+Y+CDKYD+YD
Sbjct:    2 VFSNRCSIMIRALGFNGVNTVTLKNIRRSYSHGPPVTKPMIEDRVMLVLRLYDKVDPNKLSLSSDLAKDFGIDSLDHVELVMAIEEEFNFEIPDMDSEKFRTPGDIIRYICDKYDLYD 119          
BLAST of Acyl carrier protein vs. TrEMBL
Match: A0A2M4AAE8 (Acyl carrier protein OS=Anopheles triannulatus OX=58253 PE=3 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 4.832e-23
Identity = 58/121 (47.93%), Postives = 90/121 (74.38%), Query Frame = 2
Query:  137 RMLNTSISSNVFYNRCHIERQLKSNKLTTMRRYSS-EALSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            + L  + +SN F        Q    +L  +R+YS+ E L+++++ +RV+L+L+LYDK++P+K+TL+SH +ND+G+DSLDHVEVIMA+E+EF FEIPD +A KL  P +I+QY+ DK D+Y+
Sbjct:   43 KGLTVAGASNSFAALLSPFEQTGRWQLAIVRQYSAKEPLTLQLIKERVLLVLKLYDKVNPEKLTLESHFINDLGLDSLDHVEVIMAMEDEFGFEIPDGDAEKLFRPADIVQYIADKEDIYE 163          
BLAST of Acyl carrier protein vs. Ensembl Cavefish
Match: ndufab1b (NADH:ubiquinone oxidoreductase subunit AB1 [Source:NCBI gene;Acc:103032816])

HSP 1 Score: 88.1965 bits (217), Expect = 8.852e-22
Identity = 52/101 (51.49%), Postives = 76/101 (75.25%), Query Frame = 2
Query:  197 QLKSNKLTTMRRYSS-EALSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            Q  S  ++ +R+Y     L+++ + DRV+ +L+LYDK++P+K+ + SH M D+G+DSLD VE+IMA+E+EF FEIPD EA KL TP EI+QY+ DK DVY+
Sbjct:   54 QYSSPLVSQLRQYGDLPPLTLDSIRDRVLYVLKLYDKVNPEKLQVTSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDAEAEKLMTPEEIVQYIADKKDVYE 154          
BLAST of Acyl carrier protein vs. Ensembl Sea Lamprey
Match: NDUFAB1 (NADH:ubiquinone oxidoreductase subunit AB1 [Source:HGNC Symbol;Acc:HGNC:7694])

HSP 1 Score: 81.6481 bits (200), Expect = 1.989e-20
Identity = 51/106 (48.11%), Postives = 76/106 (71.70%), Query Frame = 2
Query:  182 CHIERQLKSNKLTTMRRY-SSEALSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            C    Q++     ++R Y  +  L++  +++RVM +L LYDKIDPQK+ L+SH M D+G+DSLD VEVIMA+E+EF FEIPD +  +L TP+++I Y+ +K DVY+
Sbjct:    6 CLWPVQVRMPSAQSLRGYCDAPPLTLHFITERVMYVLNLYDKIDPQKLKLESHFMKDLGLDSLDQVEVIMAMEDEFGFEIPDVDGEQLLTPQDLINYIANKRDVYE 111          
BLAST of Acyl carrier protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008491.1 (pep scaffold:Pmarinus_7.0:GL491435:882:3150:-1 gene:ENSPMAG00000007689.1 transcript:ENSPMAT00000008491.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 43.8986 bits (102), Expect = 1.015e-6
Identity = 31/55 (56.36%), Postives = 43/55 (78.18%), Query Frame = 2
Query:  317 KITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDK 481
            ++TL+SH + D+G+DSLD VE+IM IE+EF FEIPD +A KL T +++I YV  K
Sbjct:   23 QLTLESHFLKDLGLDSLDQVELIMGIEDEFGFEIPDSDAEKLLTAKDVIAYVSKK 77          
BLAST of Acyl carrier protein vs. Ensembl Yeast
Match: ACP1 (Mitochondrial matrix acyl carrier protein; involved in biosynthesis of octanoate, which is a precursor to lipoic acid; activated by phosphopantetheinylation catalyzed by Ppt2p [Source:SGD;Acc:S000001675])

HSP 1 Score: 49.2914 bits (116), Expect = 2.433e-8
Identity = 41/108 (37.96%), Postives = 65/108 (60.19%), Query Frame = 2
Query:  179 RCHIERQLKSNKLTTMRRYSSEALSIEMVSDRVMLILRLYDKIDP----QKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDV 490
            R  + R + SN +   R YS+  LS + VS RV+ +++ +DK  P    ++I+ D+    D+G+DSLD VE+++AIEEEF  EIPD+ A +L +  E + Y+    D 
Sbjct:   18 RTIMGRSVMSNTILAQRFYSAN-LSKDQVSQRVIDVIKAFDKNSPNIANKQISSDTQFHKDLGLDSLDTVELLVAIEEEFDIEIPDKVADELRSVGETVDYIASNPDA 124          
BLAST of Acyl carrier protein vs. Ensembl Nematostella
Match: EDO48263 (Acyl carrier protein [Source:UniProtKB/TrEMBL;Acc:A7RJH5])

HSP 1 Score: 60.8474 bits (146), Expect = 5.394e-12
Identity = 37/92 (40.22%), Postives = 69/92 (75.00%), Query Frame = 2
Query:  215 LTTMRRYSSEALSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDV 490
            L  +R +++ A +I+ + ++V+ +++L+DK+D +++TL+SH +ND+G+DSLD VE++MA E+EFA EI D+EA K+ T  + ++++    DV
Sbjct:   57 LHNVRLFATAARTIDDLRNQVLNVVKLFDKVDAEQVTLESHFINDLGLDSLDVVEIVMAFEDEFAVEISDEEAEKIMTVNDAVEFLRKALDV 148          
BLAST of Acyl carrier protein vs. Ensembl Medaka
Match: ndufab1b (NADH:ubiquinone oxidoreductase subunit AB1 [Source:NCBI gene;Acc:101164403])

HSP 1 Score: 89.3521 bits (220), Expect = 2.758e-22
Identity = 56/120 (46.67%), Postives = 79/120 (65.83%), Query Frame = 2
Query:  143 LNTSISSNVFYNR-CHIERQLKSNKLTTMRRYSS-EALSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            +  + +  VF +R      +    +L    RY     L++E + +RVM +L+LYDKI+P+K+   SH M D+G+DSLD VE+IMA+E+EF FEIPD EA KL TP EI+QY+ DK DVY+
Sbjct:   27 VRATATPAVFIHRPLSFAAESPRTRLFGQSRYGDLPPLTLETIKERVMYVLKLYDKINPEKLQTSSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDAEAEKLMTPEEIVQYIADKKDVYE 146          
BLAST of Acyl carrier protein vs. Planmine SMEST
Match: SMESG000019639.1 (SMESG000019639.1)

HSP 1 Score: 291.582 bits (745), Expect = 9.522e-102
Identity = 159/159 (100.00%), Postives = 159/159 (100.00%), Query Frame = 2
Query:   20 MCLNIPILIFKMSRFLLSHSCKCFLKHNLIVRLPFQRISRMLNTSISSNVFYNRCHIERQLKSNKLTTMRRYSSEALSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREIIQYVCDKYDVYD 496
            MCLNIPILIFKMSRFLLSHSCKCFLKHNLIVRLPFQRISRMLNTSISSNVFYNRCHIERQLKSNKLTTMRRYSSEALSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHVEVIMAIEEEFAFEIPDQEAIKLNTPREIIQYVCDKYDVYD
Sbjct:    1 MCLNIPILIFKMSRFLLSHSCKCFLKHNLIVRLPFQRISRMLNTSISSNVFYNRCHIERQLKSNKLTTMRRYSSEALSIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHVEVIMAIEEEFAFEIPDQEAIKLNTPREIIQYVCDKYDVYD 159          
BLAST of Acyl carrier protein vs. Planmine SMEST
Match: SMESG000072854.1 (SMESG000072854.1)

HSP 1 Score: 51.6026 bits (122), Expect = 2.700e-8
Identity = 51/128 (39.84%), Postives = 77/128 (60.16%), Query Frame = 2
Query:  122 FQRISRMLNTSISSNVFYNR-----C-HIERQLKSN-KLTTMRRYSSEAL-------SIEMVSDRVMLILRLYDKIDPQKITLDSHLMNDMGIDSLDHXXXXXXXXXXXXXXIPDQEAIKLNTPREII 463
            F+   R+L TS+S N+  NR     C +I   L SN +L+    +S   L       + E V   VM   + ++KI  +K++L+S  + D+GIDSLDHVE+IMAIE+E  FE+P +E+ K+ TP++II
Sbjct:    2 FRHTLRVLTTSLSRNLRPNRFTNNNCKNISFYLHSNSRLSGHAIFSKRTLMKFKPLKTEEEVKAIVMRCCKEFEKIPAEKVSLESRFVEDLGIDSLDHVELIMAIEDEMEFEVPIEESEKMKTPQDII 129          
The following BLAST results are available for this feature:
BLAST of Acyl carrier protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
NDUFAB12.583e-2139.61NADH:ubiquinone oxidoreductase subunit AB1 [Source... [more]
NDUFAB12.583e-2139.61NADH:ubiquinone oxidoreductase subunit AB1 [Source... [more]
NDUFAB11.328e-1259.09NADH:ubiquinone oxidoreductase subunit AB1 [Source... [more]
NDUFAB11.099e-856.67NADH:ubiquinone oxidoreductase subunit AB1 [Source... [more]
back to top
BLAST of Acyl carrier protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Y56A3A.191.120e-2054.35Acyl carrier protein [Source:UniProtKB/TrEMBL;Acc... [more]
F37C12.37.475e-937.50Acyl carrier protein [Source:UniProtKB/TrEMBL;Acc... [more]
F37C12.37.475e-937.50Acyl carrier protein [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of Acyl carrier protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ND-ACP8.667e-2459.78gene:FBgn0011361 transcript:FBtr0072676[more]
ND-ACP1.262e-2359.78gene:FBgn0011361 transcript:FBtr0331864[more]
ND-ACP4.919e-1752.75gene:FBgn0011361 transcript:FBtr0072677[more]
back to top
BLAST of Acyl carrier protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ndufab1a1.791e-1851.16NADH:ubiquinone oxidoreductase subunit AB1a [Sourc... [more]
ndufab1a1.791e-1851.16NADH:ubiquinone oxidoreductase subunit AB1a [Sourc... [more]
ndufab1b2.160e-1651.65NADH:ubiquinone oxidoreductase subunit AB1b [Sourc... [more]
ndufab1b2.160e-1651.65NADH:ubiquinone oxidoreductase subunit AB1b [Sourc... [more]
back to top
BLAST of Acyl carrier protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ndufab11.943e-2049.50NADH:ubiquinone oxidoreductase subunit AB1 [Source... [more]
back to top
BLAST of Acyl carrier protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Ndufab12.337e-2142.96NADH:ubiquinone oxidoreductase subunit AB1 [Source... [more]
Ndufab12.337e-2142.96NADH:ubiquinone oxidoreductase subunit AB1 [Source... [more]
Ndufab13.094e-2054.95NADH:ubiquinone oxidoreductase subunit AB1 [Source... [more]
Ndufab13.175e-2054.95NADH:ubiquinone oxidoreductase subunit AB1 [Source... [more]
back to top
BLAST of Acyl carrier protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q94519|ACPM_DROME2.688e-2258.70Acyl carrier protein, mitochondrial OS=Drosophila ... [more]
sp|P52505|ACPM_BOVIN6.225e-2143.70Acyl carrier protein, mitochondrial OS=Bos taurus ... [more]
sp|Q0MQC3|ACPM_PANTR1.241e-2039.61Acyl carrier protein, mitochondrial OS=Pan troglod... [more]
sp|O14561|ACPM_HUMAN1.241e-2039.61Acyl carrier protein, mitochondrial OS=Homo sapien... [more]
sp|Q0MQC2|ACPM_GORGO1.241e-2039.61Acyl carrier protein, mitochondrial OS=Gorilla gor... [more]
back to top
BLAST of Acyl carrier protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1B0CNZ74.894e-2458.42Acyl carrier protein OS=Lutzomyia longipalpis OX=7... [more]
A0A1L8E0Q92.363e-2356.44Acyl carrier protein OS=Nyssomyia neivai OX=330878... [more]
A0A3P8HF212.404e-2355.93Acyl carrier protein OS=Echinostoma caproni OX=278... [more]
A0A183AKG82.482e-2355.93Acyl carrier protein OS=Echinostoma caproni OX=278... [more]
A0A2M4AAE84.832e-2347.93Acyl carrier protein OS=Anopheles triannulatus OX=... [more]
back to top
BLAST of Acyl carrier protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ndufab1b8.852e-2251.49NADH:ubiquinone oxidoreductase subunit AB1 [Source... [more]
back to top
BLAST of Acyl carrier protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
NDUFAB11.989e-2048.11NADH:ubiquinone oxidoreductase subunit AB1 [Source... [more]
ENSPMAT00000008491.11.015e-656.36pep scaffold:Pmarinus_7.0:GL491435:882:3150:-1 gen... [more]
back to top
BLAST of Acyl carrier protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ACP12.433e-837.96Mitochondrial matrix acyl carrier protein; involve... [more]
back to top
BLAST of Acyl carrier protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO482635.394e-1240.22Acyl carrier protein [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of Acyl carrier protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ndufab1b2.758e-2246.67NADH:ubiquinone oxidoreductase subunit AB1 [Source... [more]
back to top
BLAST of Acyl carrier protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000019639.19.522e-102100.00SMESG000019639.1[more]
SMESG000072854.12.700e-839.84SMESG000072854.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014141 ID=SMED30014141|Name=Acyl carrier protein|organism=Schmidtea mediterranea sexual|type=transcript|length=657bp
ATTTTAACTTATGAACTTCATGTGTTTAAATATTCCAATACTTATTTTTA
AAATGTCTAGATTTTTACTATCTCATTCATGTAAATGTTTTTTGAAACAT
AATTTGATTGTTCGTTTACCTTTTCAACGTATATCTCGAATGTTGAATAC
TAGTATTTCCTCGAATGTCTTTTACAATCGCTGTCACATAGAACGCCAAC
TGAAGTCAAATAAATTAACTACCATGCGAAGATACAGCAGTGAAGCACTT
TCCATAGAAATGGTTTCCGATCGAGTAATGCTAATATTAAGGCTGTATGA
CAAAATAGATCCACAAAAAATAACGCTGGACTCACATTTGATGAATGATA
TGGGCATTGACAGTTTAGATCATGTCGAAGTAATTATGGCTATCGAAGAA
GAATTCGCTTTCGAAATCCCAGACCAGGAAGCCATAAAATTGAACACACC
CAGAGAAATAATTCAATATGTGTGTGATAAATATGATGTTTATGATTAGA
CATATATACCGATATTAGTTGTAATACATTTGCATAAGTCTTGTTTTTCT
ACAGTAAAAATTAAACTGAATAGCTTTGGATTGGTTTTTGAAATTCCCCG
AATTATTAATGTTATCGATATTTGTAATAATAACCATTATTTTTATTCCT
ATTCTCA
back to top

protein sequence of SMED30014141-orf-1

>SMED30014141-orf-1 ID=SMED30014141-orf-1|Name=SMED30014141-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=163bp
MNFMCLNIPILIFKMSRFLLSHSCKCFLKHNLIVRLPFQRISRMLNTSIS
SNVFYNRCHIERQLKSNKLTTMRRYSSEALSIEMVSDRVMLILRLYDKID
PQKITLDSHLMNDMGIDSLDHVEVIMAIEEEFAFEIPDQEAIKLNTPREI
IQYVCDKYDVYD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR036736ACP-like_sf
IPR009081PP-bd_ACP
Vocabulary: biological process
TermDefinition
GO:0006633fatty acid biosynthetic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR009081Phosphopantetheine binding ACP domainPFAMPF00550PP-bindingcoord: 97..154
e-value: 5.2E-12
score: 45.9
IPR009081Phosphopantetheine binding ACP domainPROSITEPS50075CARRIERcoord: 83..158
score: 18.116
IPR036736ACP-like superfamilyGENE3DG3DSA:1.10.1200.10coord: 72..162
e-value: 4.8E-27
score: 96.1
IPR036736ACP-like superfamilySUPERFAMILYSSF47336ACP-likecoord: 82..157
NoneNo IPR availablePANTHERPTHR20863:SF5ACYL CARRIER PROTEIN, MITOCHONDRIALcoord: 36..160
NoneNo IPR availablePANTHERPTHR20863ACYL CARRIER PROTEIN/ZINC FINGER PROTEIN 593-RELATEDcoord: 36..160