TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30014140
Length (bp)8420
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30014140) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30014140) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30014140) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30014140) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014140

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30014140SMESG000053419.1 SmedASXL_080525SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30014140 SmedASXL_009739SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30014140SMESG000053419.1 dd_Smed_v4_14567_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014140SMESG000053419.1 dd_Smed_v4_14567_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014140SMESG000005279.1 Contig44859uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014140SMESG000005279.1 Contig44859newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014140SMESG000053822.1 Contig34973uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014140SMESG000053822.1 Contig34973newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014140 Contig36163uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014140 Contig36163newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 150.984 bits (380), Expect = 7.319e-37
Identity = 135/535 (25.23%), Postives = 224/535 (41.87%), Query Frame = 3
Query: 2889 KIRMVNDTEERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQC--QVKECEWKGRMKEAENH-TNECEYNEILCEK--C-QXXXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKD--KVKLKEHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMM---------------------KTIGMIAWEVKSLQTEMDAQKALMR--------------------------------------------EILESR----KSFEKSQGTIPRKMTEMEEKIQ---QIISNVQDLETTSPVAR--KLPTTPF----IWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTG-----NEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEVEKPD 4220
            K + V   E++ KC KC  +L   +QT+CG R C  C   ++ + + KC  C E + KD+     D    +EI  L I C  + + C  +  +     H  N+C + E+ C +  C + +  K       K C  RE  C  C S    I ++K     +E+  C      C + C+ +   + +L  H +EC+  P  C  + + C  Q    +++ H   ++++H  ++                      K+I  +  ++ S + E++ QK ++R                                            E L++R    +S +KS G + R    +E ++    Q++S V D+       R   L T  +    IWKI  +  + Q+A  G    L S P Y+   GYK+  R+Y NGDG   GTH+S+F    I +GEYD LL WPFKQ + L +  +   R  +        N     +PT + N A G P F  Q  L    ++++D ++IK+ V+  D
Sbjct:   40 KEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDK--VFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQK-----HEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLS-VHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLF--FVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSD 564          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 150.984 bits (380), Expect = 7.319e-37
Identity = 135/535 (25.23%), Postives = 224/535 (41.87%), Query Frame = 3
Query: 2889 KIRMVNDTEERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQC--QVKECEWKGRMKEAENH-TNECEYNEILCEK--C-QXXXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKD--KVKLKEHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMM---------------------KTIGMIAWEVKSLQTEMDAQKALMR--------------------------------------------EILESR----KSFEKSQGTIPRKMTEMEEKIQ---QIISNVQDLETTSPVAR--KLPTTPF----IWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTG-----NEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEVEKPD 4220
            K + V   E++ KC KC  +L   +QT+CG R C  C   ++ + + KC  C E + KD+     D    +EI  L I C  + + C  +  +     H  N+C + E+ C +  C + +  K       K C  RE  C  C S    I ++K     +E+  C      C + C+ +   + +L  H +EC+  P  C  + + C  Q    +++ H   ++++H  ++                      K+I  +  ++ S + E++ QK ++R                                            E L++R    +S +KS G + R    +E ++    Q++S V D+       R   L T  +    IWKI  +  + Q+A  G    L S P Y+   GYK+  R+Y NGDG   GTH+S+F    I +GEYD LL WPFKQ + L +  +   R  +        N     +PT + N A G P F  Q  L    ++++D ++IK+ V+  D
Sbjct:   40 KEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDK--VFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQK-----HEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLS-VHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLF--FVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSD 564          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 139.043 bits (349), Expect = 3.943e-33
Identity = 140/512 (27.34%), Postives = 221/512 (43.16%), Query Frame = 3
Query: 2889 KIRMVNDTEERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQC--QVKECEWKGRMKEAENHT-NECEYNEILCEK--C-QXXXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRK---------------------DKVKLKEHWNECIGKPV-----------KCPLELFN--CQAQLPIMEMQKHMIENSIEHTEIMMKTIGMIAWEVKSLQTEM----------DAQKALMREILESR----KSFEKSQGTIPRKMTEMEEKIQ---QIISNVQDLETTSPVAR--KLPTTPF----IWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTGNEP-----QMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEVEKPD 4220
            K + V   E++ KC KC  +L   +QT+CG R C  C   ++ + + KC  C E + KD+     D    +EI  L I C  + + C  +  +     H  N+C + E+ C +  C + +  K       K C  RE  C  C S    I ++K     +E+  C      C + C+ +                       V L + W+  + K V           K    L N  C  ++ I E QK M+ N+      + + I   A ++K L  E+          D+ K+ + E L++R    +S +KS G + R    +E ++    Q++S V D+       R   L T  +    IWKI  +  + Q+A  G    L S P Y+   GYK+  R+Y NGDG   GTH+S+F    I +GEYD LL WPFKQ + L +  +   R  +    +P        +PT + N A G P F  Q  L    ++++D ++IK+ V+  D
Sbjct:   40 KEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDK--VFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQK-----HEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEI-ERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSV-ESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLS-VHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLF--FVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSD 539          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 139.043 bits (349), Expect = 3.943e-33
Identity = 140/512 (27.34%), Postives = 221/512 (43.16%), Query Frame = 3
Query: 2889 KIRMVNDTEERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQC--QVKECEWKGRMKEAENHT-NECEYNEILCEK--C-QXXXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRK---------------------DKVKLKEHWNECIGKPV-----------KCPLELFN--CQAQLPIMEMQKHMIENSIEHTEIMMKTIGMIAWEVKSLQTEM----------DAQKALMREILESR----KSFEKSQGTIPRKMTEMEEKIQ---QIISNVQDLETTSPVAR--KLPTTPF----IWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTGNEP-----QMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEVEKPD 4220
            K + V   E++ KC KC  +L   +QT+CG R C  C   ++ + + KC  C E + KD+     D    +EI  L I C  + + C  +  +     H  N+C + E+ C +  C + +  K       K C  RE  C  C S    I ++K     +E+  C      C + C+ +                       V L + W+  + K V           K    L N  C  ++ I E QK M+ N+      + + I   A ++K L  E+          D+ K+ + E L++R    +S +KS G + R    +E ++    Q++S V D+       R   L T  +    IWKI  +  + Q+A  G    L S P Y+   GYK+  R+Y NGDG   GTH+S+F    I +GEYD LL WPFKQ + L +  +   R  +    +P        +PT + N A G P F  Q  L    ++++D ++IK+ V+  D
Sbjct:   40 KEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDK--VFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQK-----HEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEI-ERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSV-ESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLS-VHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLF--FVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSD 539          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF2 (TNF receptor associated factor 2 [Source:HGNC Symbol;Acc:HGNC:12032])

HSP 1 Score: 137.502 bits (345), Expect = 7.192e-33
Identity = 126/487 (25.87%), Postives = 200/487 (41.07%), Query Frame = 3
Query: 2913 EERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNE---------ILEKDEDPTTMDKATNKEINNLLIQCQVKECEWKGRMKEAEN-HTNECEYNEILCEKCQXXXXX-XXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKD--KVKLKEHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMMKTIGMIAWEVKSLQTEMDAQKALMREILESRKSFEKSQGT---------------------IPRKMTEMEEKIQQIISNVQDLETT--------SPVARKLPTTP-------FIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQN---MILTMKGREEYRNPIRTG-NEPQMGRPTTDWNTAIGTPRFYPQQRLRGE-GFLREDNLYIKLEVE 4211
            E +  C  C+ +L    Q +CG R C+ C   ++ +    C  C           ILE        D A  +E+ +L   C    C WKG +KE E+ H   C      C  C+ +    +  +     C +R   C  C +      V+  H      ++C  +   C + C +K   + K ++H   C    V C      C   +   + Q+H ++   EH  +++ ++     E K L   +  Q     E+L+  +S EK   T                       R+    ++KI+ + S VQ LE +        + + +K+           FIWKI+ FA K Q+A  G    + SP  Y+ + GYK+ +R+Y NGDG   GTH+S+F    + KG  D LL WPF Q    M+L    RE   +  R         RP  D N A G P F P  ++  +  ++R+D ++IK  V+
Sbjct:   29 EAKYLCSACRNVLRRPFQAQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSS--AFPDNAARREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHH------EVCPKFPLTC-DGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSSV----LEAKPL---LGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLF--FVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 497          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 97.0561 bits (240), Expect = 3.406e-20
Identity = 102/428 (23.83%), Postives = 174/428 (40.65%), Query Frame = 3
Query: 2979 CRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQCQVKE--CEWKGRMKEAENHTNECEYNEIL-CEKCQXXXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKDKVKLK--EHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMMKTIGMIAWEVKSLQTEMDAQKALMREILESRKSFEKSQGTIPRKMTEMEEKIQQIISNVQDLETTSPVARKLPTTPFIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNM---ILTMKGREEYRNPIR--------TGNEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEVEK 4214
            CR C E      E +T  C  C  I++ +      D+A  K+I  L + C  +   C W G++    +H +EC +   L CEKC     K  ++ H   C      C FC   ++ I+     R+P   + C      C   C   D+ +L+   H   C      CP   + C        +Q+H+ +  + H  +M                       L  EI + + ++E     + R M    ++  +I+S  +          ++     IWKI    ++  +AK G    + S P  S + GYK+       GDG++ G  IS++V   + KGE+D  L WPF + +   +L    R E R  I           NE  + RP  + N A G+  F     L  + ++++D +Y++++V++
Sbjct:   38 CRQCFE-----NENRTPGCAACQTIIQPEL--CQHDRAKQKQILALPVVCTFESSGCPWDGQLGTLHDHLSECTFKSSLKCEKCGRQFAKNDLEKHRAKCELNRAVCSFC---NKTIRDSDRERHP---KTCPQVIISCPFQCGLTDRPRLEIEAHCPSCPNVDNVCPFVPYGCTFAGGKESIQQHLSDEPVRH--LMY----------------------LCDEITDLKGTYE----LMERDMGSFNDRQTRILSAAE-------TCTEMFGPQLIWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLYVL--LLKGEFDPTLEWPFHRAIKISLLDQNPRPEDRVNITYVIDPRKLKANEKFLARPRGERNAAFGSQSFCSLAIL--QNYVKDDKIYVQIDVDR 413          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 56.6102 bits (135), Expect = 1.370e-7
Identity = 40/136 (29.41%), Postives = 67/136 (49.26%), Query Frame = 3
Query: 3822 LQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNM---ILTMKGREEYRNPIRTGNEPQ----MGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEV 4208
            ++  K+ + R + S P YS   GYK+     P GDG A   + SVFV   + KGE+D++L WPF+ ++   IL+   +E     I     P+    + RP    N   G   F P  ++    F  + +++I+++V
Sbjct:  172 VKATKNKSHRSIYSQPFYSHGYGYKMMAVAAPYGDGLAFREYFSVFV--CLMKGEWDDILEWPFRCDVTFSILSDDKKELLTKTIYVNEMPEIQEFLERPEGLRNGTFGFQNFLPLAKVT--EFAADGDIFIQIKV 303          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 99.7525 bits (247), Expect = 5.886e-21
Identity = 103/420 (24.52%), Postives = 176/420 (41.90%), Query Frame = 3
Query: 3099 KEINNLLIQC--QVKECEWKGRMKEAENHTNECEYNEILC-EKCQXXXXX-XXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQI-CDFY*G--------------ICAN------NCNRKDKVK-LKEHWNECIGKPVKCPLELFNCQA-QLPIMEMQKHM------IENSIEHTEIMMKTIGMIAWEVKSLQTEMDAQKALMREILESRKSFEKSQGTIPRKMTEMEEKIQQIISNVQDLETTSPVARKLPTTPFIWKITGFAEKLQKA--KDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTM--KGREEYRNPIRTGNEP-----QMGRPTTDWN-TAIGTPRFYPQQRLRGEGFLREDNLYIKLEVEKPDKTL 4229
            K I   L+ C    + C+W   +++ + H N C+++   C  KC     +          C  R  +CEFC S      +E+ + +  +E + C+   G               CA       +C R+     L  H  +C   P+ CP     C A  +P  E++ H+      +  S    E   +  G        L++   A  +LM   L SR+                 ++IQ + S V  L           T   +WKIT ++ K+ +A  KDG +  L SPP Y+ + GYKL   ++ NG+G    TH+SV+++  +  GEYD LL WPF  ++  T+  +G +  +  +     P        RP+ + +    G PRF   + L    F++ D ++++++V+ P K +
Sbjct:   88 KHIMGSLVFCIHHKQGCKWSDELRKLKGHLNACKHDATQCPNKCGAQIPRIMMTDHLQYTCTMRRTRCEFCQSEFSGAGLEEHNGSCGQEPVYCEAKCGQRILRGRMTLHKSKDCAKRLRRCAHCQREFSADTLPLHAAQCPRAPLACPQR---CDAGPIPRGELEAHLRDECQSLAVSCSFKEAGCRFKGPRQMLEAHLESNAAAHLSLM-VALSSRQG----------------QQIQMLKSAVSKLSINY-------TGTLLWKITDWSAKMAEARGKDGLE--LVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIK--VLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLHSRPFIKGDTVFLRVKVD-PSKIV 475          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 99.7525 bits (247), Expect = 6.403e-21
Identity = 100/418 (23.92%), Postives = 173/418 (41.39%), Query Frame = 3
Query: 3099 KEINNLLIQC--QVKECEWKGRMKEAENHTNECEYNEILC-EKCQXXXXX-XXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQI-CDFY*G--------------ICAN------NCNRKDKVK-LKEHWNECIGKPVKCPLELFNCQA-QLPIMEMQKHM------IENSIEHTEIMMKTIGMIAWEVKSLQTEMDAQKALMREILESRKSFEKSQGTIPRKMTEMEEKIQQIISNVQDLETTSPVARKLPTTPFIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTM--KGREEYRNPIRTGNEP-----QMGRPTTDWN-TAIGTPRFYPQQRLRGEGFLREDNLYIKLEVEKPDKTL 4229
            K I   L+ C    + C+W   +++ + H N C+++   C  KC     +          C  R  +CEFC S      +E+ + +  +E + C+   G               CA       +C R+     L  H  +C   P+ CP     C A  +P  E++ H+      +  S    E   +  G        L++   A  +LM   L SR+                 ++IQ + S V  L           T   +WKIT ++ K+ +A+      L SPP Y+ + GYKL   ++ NG+G    TH+SV+++  +  GEYD LL WPF  ++  T+  +G +  +  +     P        RP+ + +    G PRF   + L    F++ D ++++++V+ P K +
Sbjct:   97 KHIMGSLVFCIHHKQGCKWSDELRKLKGHLNACKHDATQCPNKCGAQIPRIMMTDHLQYTCTMRRTRCEFCQSEFSGAGLEEHNGSCGQEPVYCEAKCGQRILRGRMTLHKSKDCAKRLRRCAHCQREFSADTLPLHAAQCPRAPLACPQR---CDAGPIPRGELEAHLRDECQSLAVSCSFKEAGCRFKGPRQMLEAHLESNAAAHLSLM-VALSSRQG----------------QQIQMLKSAVSKLSINY-------TGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIK--VLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLHSRPFIKGDTVFLRVKVD-PSKIV 484          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0074275)

HSP 1 Score: 60.8474 bits (146), Expect = 1.432e-8
Identity = 44/189 (23.28%), Postives = 88/189 (46.56%), Query Frame = 3
Query: 3690 KMTEMEEKIQQIISNVQDLETTSPVARKLPTTP-----FIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFK-------QNMILTMKGREEYRNPIRTGNEPQMGRPTTDWNTAIGTPRFY--PQQRLRGEGFLREDNLYIKLEVEK 4214
            +  +++  + Q + N+ DLET   + +++ +        IW+I  +++KL+++K     IL S    +   GY L + +Y NG G   G ++     + +  GEYD LL WP +       ++    +   E+Y   I         R  +D    I + +++  P + +    +LR D+++I++ V K
Sbjct:  298 RCDKLDRALHQTMQNISDLETQMAMQQRIASVQNIRGHLIWRIKDYSKKLEESK-QYDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNM--IACLNVLSGEYDPLLAWPCRLQAEIIIRDQCTNVADAEDYVKTI-------FVRKKSD--DFIQSNQYFHIPHKVITSRNYLRNDSMFIEVRVLK 474          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0074273)

HSP 1 Score: 60.4622 bits (145), Expect = 1.742e-8
Identity = 44/189 (23.28%), Postives = 88/189 (46.56%), Query Frame = 3
Query: 3690 KMTEMEEKIQQIISNVQDLETTSPVARKLPTTP-----FIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFK-------QNMILTMKGREEYRNPIRTGNEPQMGRPTTDWNTAIGTPRFY--PQQRLRGEGFLREDNLYIKLEVEK 4214
            +  +++  + Q + N+ DLET   + +++ +        IW+I  +++KL+++K     IL S    +   GY L + +Y NG G   G   ++   + +  GEYD LL WP +       ++    +   E+Y   I         R  +D    I + +++  P + +    +LR D+++I++ V K
Sbjct:  276 RCDKLDRALHQTMQNISDLETQMAMQQRIASVQNIRGHLIWRIKDYSKKLEESK-QYDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGR--NMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCTNVADAEDYVKTI-------FVRKKSD--DFIQSNQYFHIPHKVITSRNYLRNDSMFIEVRVLK 452          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0308606)

HSP 1 Score: 60.077 bits (144), Expect = 1.847e-8
Identity = 44/189 (23.28%), Postives = 88/189 (46.56%), Query Frame = 3
Query: 3690 KMTEMEEKIQQIISNVQDLETTSPVARKLPTTP-----FIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFK-------QNMILTMKGREEYRNPIRTGNEPQMGRPTTDWNTAIGTPRFY--PQQRLRGEGFLREDNLYIKLEVEK 4214
            +  +++  + Q + N+ DLET   + +++ +        IW+I  +++KL+++K     IL S    +   GY L + +Y NG G   G ++     + +  GEYD LL WP +       ++    +   E+Y   I         R  +D    I + +++  P + +    +LR D+++I++ V K
Sbjct:  219 RCDKLDRALHQTMQNISDLETQMAMQQRIASVQNIRGHLIWRIKDYSKKLEESK-QYDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNM--IACLNVLSGEYDPLLAWPCRLQAEIIIRDQCTNVADAEDYVKTI-------FVRKKSD--DFIQSNQYFHIPHKVITSRNYLRNDSMFIEVRVLK 395          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 158.688 bits (400), Expect = 7.826e-40
Identity = 135/502 (26.89%), Postives = 216/502 (43.03%), Query Frame = 3
Query: 2913 EERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNE--ILEKDEDPTTM-----DKATNKEINNLLIQCQVKECEWKGRMKEAEN-HTNECEYNEILCEKCQXX-XXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKD--KVKLKEHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMMKTI--------GMIAWE------------------------------VKSLQTEMDAQKALMREILESRKSFEKSQGTIPRKMTEMEEKIQQIISNVQDLETT-----------SPVARKLPTTP----FIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQN---MILTMKGREEYRNPIRTG-NEPQMGRPTTDWNTAIGTPRFYPQQRLRGE-GFLREDNLYIKLEVE 4211
            E + +C +CK +L    Q +CG R C  C  ++  +  I C  C    I E++     +     D A  +EI++L  +C  + C W G +K+ EN H   C +  + CE CQ +    +  + + + C  R   C++C     + ++ K H     ++IC  +   C  +C +K   + K +EH   C      C      C+A +   + Q+H   + +EH  +M+  +        G   W+                               K + T  +    L +E+  S  + E     I R+    +EKI+ + + V+ LE T               R+L        FIWKI  F+ + Q A  G    + SP  YS K GYK+ +RLY NGDG   G+H+S+F    + KG+YD LL WPF Q    M+L    RE   +  R   +     RP ++ N A G P F P  +L G+  +LR+D ++IK  V+
Sbjct:   53 EPKYQCQQCKDILRKPFQAQCGHRFCVFCFKQLTSSGPIPCEACRAEGIFEEETSVLNIAVAFPDNAARREIDSLPAKCPNEGCSWSGTLKDFENQHEGRCAFERVKCEACQVLILLSEKDRHNERECEARTLNCKYCKVTFNFKEI-KAH-----DEICQKFPMQC-KDCGKKKIPREKFQEHTKSCAKSKSACQFREIGCRAVVDNCKQQEHEQTSIMEHLRLMLALLSSMRLRAEGAGEWQEDVGLGLYRGPEDAPPAGAHNVGRGGGPGVQKKVTTLENIVCVLNKEVERSALTME----AISRQHRLDQEKIENLSNKVRQLERTLTTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLF--FVVMKGKYDALLKWPFSQKVTLMLLDQNNREHIIDAFRPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVD 541          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 158.303 bits (399), Expect = 9.204e-40
Identity = 135/502 (26.89%), Postives = 216/502 (43.03%), Query Frame = 3
Query: 2913 EERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNE--ILEKDEDPTTM-----DKATNKEINNLLIQCQVKECEWKGRMKEAEN-HTNECEYNEILCEKCQXX-XXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKD--KVKLKEHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMMKTI--------GMIAWE------------------------------VKSLQTEMDAQKALMREILESRKSFEKSQGTIPRKMTEMEEKIQQIISNVQDLETT-----------SPVARKLPTTP----FIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQN---MILTMKGREEYRNPIRTG-NEPQMGRPTTDWNTAIGTPRFYPQQRLRGE-GFLREDNLYIKLEVE 4211
            E + +C +CK +L    Q +CG R C  C  ++  +  I C  C    I E++     +     D A  +EI++L  +C  + C W G +K+ EN H   C +  + CE CQ +    +  + + + C  R   C++C     + ++ K H     ++IC  +   C  +C +K   + K +EH   C      C      C+A +   + Q+H   + +EH  +M+  +        G   W+                               K + T  +    L +E+  S  + E     I R+    +EKI+ + + V+ LE T               R+L        FIWKI  F+ + Q A  G    + SP  YS K GYK+ +RLY NGDG   G+H+S+F    + KG+YD LL WPF Q    M+L    RE   +  R   +     RP ++ N A G P F P  +L G+  +LR+D ++IK  V+
Sbjct:   40 EPKYQCQQCKDILRKPFQAQCGHRFCVFCFKQLTSSGPIPCEACRAEGIFEEETSVLNIAVAFPDNAARREIDSLPAKCPNEGCSWSGTLKDFENQHEGRCAFERVKCEACQVLILLSEKDRHNERECEARTLNCKYCKVTFNFKEI-KAH-----DEICQKFPMQC-KDCGKKKIPREKFQEHTKSCAKSKSACQFREIGCRAVVDNCKQQEHEQTSIMEHLRLMLALLSSMRLRAEGAGEWQEDVGLGLYRGPEDAPPAGAHNVGRGGGPGVQKKVTTLENIVCVLNKEVERSALTME----AISRQHRLDQEKIENLSNKVRQLERTLTTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLF--FVVMKGKYDALLKWPFSQKVTLMLLDQNNREHIIDAFRPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVD 528          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 158.303 bits (399), Expect = 9.204e-40
Identity = 135/502 (26.89%), Postives = 216/502 (43.03%), Query Frame = 3
Query: 2913 EERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNE--ILEKDEDPTTM-----DKATNKEINNLLIQCQVKECEWKGRMKEAEN-HTNECEYNEILCEKCQXX-XXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKD--KVKLKEHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMMKTI--------GMIAWE------------------------------VKSLQTEMDAQKALMREILESRKSFEKSQGTIPRKMTEMEEKIQQIISNVQDLETT-----------SPVARKLPTTP----FIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQN---MILTMKGREEYRNPIRTG-NEPQMGRPTTDWNTAIGTPRFYPQQRLRGE-GFLREDNLYIKLEVE 4211
            E + +C +CK +L    Q +CG R C  C  ++  +  I C  C    I E++     +     D A  +EI++L  +C  + C W G +K+ EN H   C +  + CE CQ +    +  + + + C  R   C++C     + ++ K H     ++IC  +   C  +C +K   + K +EH   C      C      C+A +   + Q+H   + +EH  +M+  +        G   W+                               K + T  +    L +E+  S  + E     I R+    +EKI+ + + V+ LE T               R+L        FIWKI  F+ + Q A  G    + SP  YS K GYK+ +RLY NGDG   G+H+S+F    + KG+YD LL WPF Q    M+L    RE   +  R   +     RP ++ N A G P F P  +L G+  +LR+D ++IK  V+
Sbjct:   40 EPKYQCQQCKDILRKPFQAQCGHRFCVFCFKQLTSSGPIPCEACRAEGIFEEETSVLNIAVAFPDNAARREIDSLPAKCPNEGCSWSGTLKDFENQHEGRCAFERVKCEACQVLILLSEKDRHNERECEARTLNCKYCKVTFNFKEI-KAH-----DEICQKFPMQC-KDCGKKKIPREKFQEHTKSCAKSKSACQFREIGCRAVVDNCKQQEHEQTSIMEHLRLMLALLSSMRLRAEGAGEWQEDVGLGLYRGPEDAPPAGAHNVGRGGGPGVQKKVTTLENIVCVLNKEVERSALTME----AISRQHRLDQEKIENLSNKVRQLERTLTTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLF--FVVMKGKYDALLKWPFSQKVTLMLLDQNNREHIIDAFRPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVD 528          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 127.872 bits (320), Expect = 1.344e-29
Identity = 118/471 (25.05%), Postives = 201/471 (42.68%), Query Frame = 3
Query: 2913 EERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQCQVKECEWKGRMKEAENHTNECEYNEILCEKCQXXX-XXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKDKVKLKEHWN-ECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMM-----KTIGMIAWEVKSLQTEMDAQKALMR---------EILESRKSFEKSQGTIPRK-----------------MTEMEEKIQQIISNVQDLETTSPVARKLPTTPFIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLY-PNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTG-NEPQM---GRPTTDWNT-AIGTPRFYPQQRLRGEGFLREDNLYIKLEV 4208
            E + +C  C   L  A QT CG R C  C  + I     KCP  NE+L   E+    D    +EI +L ++C    C  K  +++ E H ++C +    C +CQ         +   + C++R   C  C     ++   K+    N EQ C F   +C        + +L  H + +C+  PV C    F C+ ++   E+ +HM E +  H   M      +T+        +     D + A  R         E+L  R++  + +G + R+                 +TE+  K+  +  + ++LE     A++     ++W++  F+  L+  + G   +L SPP Y+ + GYKL +RL+            IS+FV     +GE+D  L+WP +  + L +  + E ++ I     +P +    RPT   N    G   F   Q LR  GF++ED L ++ EV
Sbjct:   66 ESKYECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCPVDNEVLL--EEQLFPDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCPQCQESVPISHLDEHKSQHCLQRIMTCPDCAG--SFVYAVKQ----NHEQFCPFANTVCEYCEMELIRDQLALHCDTDCLKAPVACTFSTFGCREKMTRNELAQHMQEFTQMHMRYMAEFLRSQTLNNCTMPSAAAHLSSDDRGASARSPDSCQCKQELLNLRETVLELEGRLVRQDQQIRELCIHNDTQKNQVTELRRKLVSLEESTRELE-----AQQYQGI-YVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVH--TMQGEFDSQLSWPLQGTIRLAVLDQVEGQHHIEVMETKPDLQAFQRPTVMRNPKGFGYVTFLHLQALRQRGFVKEDVLLVRCEV 520          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 127.872 bits (320), Expect = 1.344e-29
Identity = 118/471 (25.05%), Postives = 201/471 (42.68%), Query Frame = 3
Query: 2913 EERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQCQVKECEWKGRMKEAENHTNECEYNEILCEKCQXXX-XXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKDKVKLKEHWN-ECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMM-----KTIGMIAWEVKSLQTEMDAQKALMR---------EILESRKSFEKSQGTIPRK-----------------MTEMEEKIQQIISNVQDLETTSPVARKLPTTPFIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLY-PNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTG-NEPQM---GRPTTDWNT-AIGTPRFYPQQRLRGEGFLREDNLYIKLEV 4208
            E + +C  C   L  A QT CG R C  C  + I     KCP  NE+L   E+    D    +EI +L ++C    C  K  +++ E H ++C +    C +CQ         +   + C++R   C  C     ++   K+    N EQ C F   +C        + +L  H + +C+  PV C    F C+ ++   E+ +HM E +  H   M      +T+        +     D + A  R         E+L  R++  + +G + R+                 +TE+  K+  +  + ++LE     A++     ++W++  F+  L+  + G   +L SPP Y+ + GYKL +RL+            IS+FV     +GE+D  L+WP +  + L +  + E ++ I     +P +    RPT   N    G   F   Q LR  GF++ED L ++ EV
Sbjct:   66 ESKYECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCPVDNEVLL--EEQLFPDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCPQCQESVPISHLDEHKSQHCLQRIMTCPDCAG--SFVYAVKQ----NHEQFCPFANTVCEYCEMELIRDQLALHCDTDCLKAPVACTFSTFGCREKMTRNELAQHMQEFTQMHMRYMAEFLRSQTLNNCTMPSAAAHLSSDDRGASARSPDSCQCKQELLNLRETVLELEGRLVRQDQQIRELCIHNDTQKNQVTELRRKLVSLEESTRELE-----AQQYQGI-YVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVH--TMQGEFDSQLSWPLQGTIRLAVLDQVEGQHHIEVMETKPDLQAFQRPTVMRNPKGFGYVTFLHLQALRQRGFVKEDVLLVRCEV 520          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 128.642 bits (322), Expect = 1.311e-29
Identity = 126/532 (23.68%), Postives = 225/532 (42.29%), Query Frame = 3
Query: 2889 KIRMVNDTEERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQC--QVKECEWKGRMKEAENH-TNECEYNEILCEKC---QXXXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKD--KVKLKEHWNECIGKPVKCPLELFNCQAQLPIMEMQKH------------------------MIEN--SIEHTEIMMKTIGMIAWEV--------------------KSLQTEMDAQKALMREILESRKSFEKSQG------TIPRKMTEMEEKIQQIIS-----------------NVQDLETTSPVAR--KLPTTPF----IWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTG-----NEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEVEKPD 4220
            K R +   EE+ KC KC+ +L   RQT+CG R C  C   ++ + + +C  C + + KD+     D    +E+  L + C  + + C+    +     H  ++C++ E+ C +    + +  K       K C  RE  C+FC +    ++++K     +E+  C      C + C+ K   + +L  H  EC+  P  C  + + C  +    +++ H                        M++N  S ++  I +    M ++E+                    + ++ + D  K L +EI   R++ +++ G      ++  +++++E   +   S                 +V D+       R   L T  +    IWKI  +  + Q+A  G    L S P Y+   GYK+  R+Y NGDG   GTH+S+F    I +GEYD LL WPFKQ + L +  +   R  +        N     +PT + N A G P F  Q  L    ++++D ++IK+ V+  D
Sbjct:   35 KERFLKPVEEKYKCEKCRLVLCNPRQTECGHRFCETCMNAILSSTSPQCMACEDNITKDK--VFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHLKSDCQFEELSCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQVPLVEMQK-----HEDVDCPSVVISCPHMCSVKSLLRSELNAHLLECVNAPSTCSFKRYGCTFKGTNQQIKAHEASSAVQHVNLMKEWSNYLEAKVSMLQNESSEKNKSIQILHNQMCSFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEIRNLRQTGDEADGMKSNYESLQNRLSQLEVMAKNAASWNPGVLETQINRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLF--FVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSD 557          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: sytl2 (synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-945155])

HSP 1 Score: 125.946 bits (315), Expect = 2.860e-29
Identity = 116/458 (25.33%), Postives = 197/458 (43.01%), Query Frame = 3
Query: 2967 TKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQCQVKE--CEWKGRMKEAENHTNECEYNEILC-EKCQXXX-XXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRN--PNEEQICDFY*GICANNCNRK--DKVKLKEHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMMKT-IGMIAWEVKSLQTEMDAQKALMR-------------EILESRKSFEKSQGTIPRKMTEMEEKIQQIISNVQDLETTSPVARKLPTTPFIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGRE-----------EYRNP---IRTGNEPQMGRPTTDWNT-AIGTPRFYPQQRLRGEGFLREDNLYIKLEVEKPDKTL 4229
            + CG R C  C  E +     KCP   + L  D      D+    ++  L I+C   E  C W G++K+ + H N C +N I C  +C T    +   +     C KR+ +CEFCG+ D   +  ++H+   P E   C+       N C  +   +V  +    EC  +   CP     C  +     +Q H  +     T    +  I  IA E  S   +     AL+              +I  SR   E  +  +    + +  + Q+I+   + +E  S  +  +     IWKI+ ++ K+Q+AK        SPP Y+ K GYKL +  + NG+G+  G+++SV++R  +  GEYD LL WPF   +  ++  +            E  NP    +   +P   R + D +T   G P+F   + +R   ++R++ ++++  VE P K +
Sbjct:   32 STCGHRFCDTCLQEFLSEGVFKCP--EDQLPLDYAKIYPDRDLETQVMGLSIRCIHSEEGCRWSGQLKQLQPHLNICAFNVIPCPNRCSTKLIRRDLPEHMQHDCPKRKVRCEFCGA-DFTGEAYEDHQGCCPQESVYCE-------NKCGARMMRRVLSQHSLVECPKRTQPCPY----CNKEFVFDTIQSHQYQCPRYPTPCPNQCGIASIAREDLSNHLKDSCSSALVLCPFKDSGCKHRGPKITISRHLEENMRAHLSMMSSLVSRQRQEILELRKQVEELSVSSEGV----LIWKISDYSRKVQEAKVRGNFESFSPPFYTHKYGYKLQVSAFLNGNGSGEGSYLSVYIR--VLPGEYDNLLEWPFSYRVTFSLLDQSDPSLSKPQHITETFNPDPNWKNFQKPTGSRNSLDESTLGFGYPKFISHEDIRKRNYVRDNAIFLRASVEIPQKII 469          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 121.324 bits (303), Expect = 1.874e-27
Identity = 124/508 (24.41%), Postives = 214/508 (42.13%), Query Frame = 3
Query: 2889 KIRMVNDTEERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQC--QVKECEWKGRMKEAENH-TNECEYNEILCEKC---QXXXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKD---------------------KVKLKEHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIE---HTEIMMKTIGMIAWEVKSLQTEMDAQKALMREILESRKSFEKSQG------TIPRKMTEMEEKIQQIIS-----------------NVQDLETTSPVAR--KLPTTPF----IWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTG-----NEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEVEKPD 4220
            K R +   EE+ KC KC+ +L   RQT+CG R C  C   ++ + + +C  C + + KD+     D    +E+  L + C  + + C+    +     H  ++C++ E+ C +    + +  K       K C  RE  C+FC +    ++++K     +E+  C      C + C+ K                       V L + W+  +   V   L+  + +    I  +   M    IE   H E +      I    + ++ + D  K L +EI   R++ +++ G      ++  +++++E   +   S                 +V D+       R   L T  +    IWKI  +  + Q+A  G    L S P Y+   GYK+  R+Y NGDG   GTH+S+F    I +GEYD LL WPFKQ + L +  +   R  +        N     +PT + N A G P F  Q  L    ++++D ++IK+ V+  D
Sbjct:   35 KERFLKPVEEKYKCEKCRLVLCNPRQTECGHRFCETCMNAILSSTSPQCMACEDNITKDK--VFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHLKSDCQFEELSCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQVPLVEMQK-----HEDVDCPSVVISCPHMCSVKSLLRSEGTNQQIKAHEASSAVQHVNLMKEWSNYLEAKVS-MLQNESSEKNKSIQILHNQMCSFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEIRNLRQTGDEADGMKSNYESLQNRLSQLEVMAKNAASWNPGVLETQINRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLF--FVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSD 532          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: hspb6 (heat shock protein family B (small) member 6 [Source:Xenbase;Acc:XB-GENE-876273])

HSP 1 Score: 104.375 bits (259), Expect = 1.128e-22
Identity = 54/148 (36.49%), Postives = 75/148 (50.68%), Query Frame = 3
Query: 3789 FIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTGNEPQMG-----RPTTDWNTAIGTPRFYPQQRLRG--EGFLREDNLYIKLEVE 4211
            F+WKI+    K   A  G    L SP  Y+ K GYK+ +R+Y NGDG   GTH+S+F    + KGEYD LL WPFK  +   +      R+ +     P +      RP  D N A G P F P  +L      ++RE+ LYI+  ++
Sbjct:  232 FLWKISDLTNKSHDAVTGRAISLYSPAFYTAKYGYKVCLRIYLNGDGAGKGTHVSLF--FTVMKGEYDALLPWPFKHKVTFVLVDHNN-RDSVFDAFRPDVTSASFQRPINDMNVASGCPLFCPIAKLNSPKHAYIRENTLYIRCIID 376          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 105.531 bits (262), Expect = 1.245e-22
Identity = 66/212 (31.13%), Postives = 107/212 (50.47%), Query Frame = 3
Query: 3591 KSLQTEMDAQKALMREILESRKSFEKSQGTIPRKMTEMEEKIQQIISNVQDLETTSPVARKLPTTPFIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQN---MILTMKGREEYRNPIRTG-NEPQMGRPTTDWNTAIGTPRFYPQQRLRGE-GFLREDNLYIKLEVE 4211
            + ++    A + L R++  +    E++ G     + E+E ++Q+      +L T   V        FIWKI+ F +K Q A +G    + SPP Y+ K GYK+ +R+Y NGDG    TH+S+F    + KG  D LL WPF Q    M+L    RE   +  R   +     RP ++ N A G P F    +L G+  ++R+D +++K+ V+
Sbjct:  254 REVERSSHAAEELARQLRAADTRLERTLGQKELIVAELETRMQE-----SELSTYDGV--------FIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLF--FVVMKGNNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVSSSSFQRPISEMNIASGCPLFCQVSKLEGKNSYVRDDTIFVKVIVD 450          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 151.369 bits (381), Expect = 3.700e-37
Identity = 135/535 (25.23%), Postives = 225/535 (42.06%), Query Frame = 3
Query: 2889 KIRMVNDTEERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQC--QVKECEWKGRMKEAENH-TNECEYNEILCEKC---QXXXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKD--KVKLKEHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMM---------------------KTIGMIAWEVKSLQTEMDAQKALMR--------------------------------------------EILESR----KSFEKSQGTIPRKMTEMEEKIQ---QIISNVQDLETTSPVAR--KLPTTPF----IWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTG-----NEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEVEKPD 4220
            K + V   E++ KC KC+ +L   +QT+CG R C  C   ++ + + KC  C E + KD+     D    +EI  L + C  + + C  +  +     H  NEC++ E+ C +    + +  K       K C  RE  C  C S    IK++K     +E+  C      C + C+ +   + +L  H +EC+  P  C  + + C  Q    +++ H   ++++H  ++                      K+I  +  ++ S + E++ QK ++R                                            E L++R    +S +KS G   R    +E ++    Q++S V D+       R   L T  +    IWKI  +  + Q+A  G    L S P Y+   GYK+  R+Y NGDG   GTH+S+F    I +GEYD LL WPFKQ + L +  +   R  +        N     +PT + N A G P F  Q  L    ++++D ++IK+ V+  D
Sbjct:   39 KEKFVKTVEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKDK--VFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQK-----HEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQAARNTGLLESQLSRHDQMLS-VHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLF--FVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSD 563          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 140.584 bits (353), Expect = 5.089e-34
Identity = 120/481 (24.95%), Postives = 199/481 (41.37%), Query Frame = 3
Query: 2913 EERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCN---------EILEKDEDPTTMDKATNKEINNLLIQCQVKECEWKGRMKEAEN-HTNECEYNEILCEKCQ-XXXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKD--KVKLKEHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMMKTIGMIAWEVKSLQTEMDAQKALMREILESR-KSFEKSQGTIPRKMTEM--------------EEKIQQIISNVQDLETT---------------SPVARKLPTTPFIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQN---MILTMKGREEYRNPIRTG-NEPQMGRPTTDWNTAIGTPRFYPQQRLRGE-GFLREDNLYIKLEVE 4211
            E +  C  CK +L    Q +CG R C+ C   ++ +    C  C           ILE        D A  +E+ +L   C    C WKG +KE E+ H   C +    C  C+  +   +      + C KR   C+ C +    + +E  +      ++C  +   C + C +K   +   ++H   C    V C      C   +    +Q H ++   EH  +++ +  + A        ++  +     +ILE +  +FE     + R++  +              ++KI+ + + VQ LE +               S +        FIWKI+ F  K Q+A  G    + SP  Y+ + GYK+ +R+Y NGDG   GTH+S+F    + KG  D LL WPF Q    M+L    RE   +  R         RP +D N A G P F P  ++  +  ++R+D ++IK  V+
Sbjct:   29 EAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSS--AFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHY------EVCPKFPLTC-DGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSF-LEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLF--FVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 497          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 140.584 bits (353), Expect = 8.089e-34
Identity = 140/512 (27.34%), Postives = 222/512 (43.36%), Query Frame = 3
Query: 2889 KIRMVNDTEERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQC--QVKECEWKGRMKEAENHT-NECEYNEILCEKC---QXXXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRK---------------------DKVKLKEHWNECIGKPV-----------KCPLELFN--CQAQLPIMEMQKHMIENSIEHTEIMMKTIGMIAWEVKSLQTEM----------DAQKALMREILESR----KSFEKSQGTIPRKMTEMEEKIQ---QIISNVQDLETTSPVAR--KLPTTPF----IWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTGNEP-----QMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEVEKPD 4220
            K + V   E++ KC KC+ +L   +QT+CG R C  C   ++ + + KC  C E + KD+     D    +EI  L + C  + + C  +  +     H  NEC++ E+ C +    + +  K       K C  RE  C  C S    IK++K     +E+  C      C + C+ +                       V L + W+  + K V           K    L N  C  ++ I E QK M+ N+      + + I   A ++K L  E+          D+ K+ + E L++R    +S +KS G   R    +E ++    Q++S V D+       R   L T  +    IWKI  +  + Q+A  G    L S P Y+   GYK+  R+Y NGDG   GTH+S+F    I +GEYD LL WPFKQ + L +  +   R  +    +P        +PT + N A G P F  Q  L    ++++D ++IK+ V+  D
Sbjct:   39 KEKFVKTVEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKDK--VFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQK-----HEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEI-ERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSV-ESLQNRVTELESVDKSAGQAARNTGLLESQLSRHDQMLS-VHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLF--FVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSD 538          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 140.584 bits (353), Expect = 8.089e-34
Identity = 140/512 (27.34%), Postives = 222/512 (43.36%), Query Frame = 3
Query: 2889 KIRMVNDTEERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQC--QVKECEWKGRMKEAENHT-NECEYNEILCEKC---QXXXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRK---------------------DKVKLKEHWNECIGKPV-----------KCPLELFN--CQAQLPIMEMQKHMIENSIEHTEIMMKTIGMIAWEVKSLQTEM----------DAQKALMREILESR----KSFEKSQGTIPRKMTEMEEKIQ---QIISNVQDLETTSPVAR--KLPTTPF----IWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTGNEP-----QMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEVEKPD 4220
            K + V   E++ KC KC+ +L   +QT+CG R C  C   ++ + + KC  C E + KD+     D    +EI  L + C  + + C  +  +     H  NEC++ E+ C +    + +  K       K C  RE  C  C S    IK++K     +E+  C      C + C+ +                       V L + W+  + K V           K    L N  C  ++ I E QK M+ N+      + + I   A ++K L  E+          D+ K+ + E L++R    +S +KS G   R    +E ++    Q++S V D+       R   L T  +    IWKI  +  + Q+A  G    L S P Y+   GYK+  R+Y NGDG   GTH+S+F    I +GEYD LL WPFKQ + L +  +   R  +    +P        +PT + N A G P F  Q  L    ++++D ++IK+ V+  D
Sbjct:   39 KEKFVKTVEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKDK--VFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQK-----HEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEI-ERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSV-ESLQNRVTELESVDKSAGQAARNTGLLESQLSRHDQMLS-VHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLF--FVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSD 538          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 136.732 bits (343), Expect = 9.999e-33
Identity = 121/488 (24.80%), Postives = 200/488 (40.98%), Query Frame = 3
Query: 2913 EERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTI-------KCPGCN---------EILEKDEDPTTMDKATNKEINNLLIQCQVKECEWKGRMKEAEN-HTNECEYNEILCEKCQ-XXXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKD--KVKLKEHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMMKTIGMIAWEVKSLQTEMDAQKALMREILESR-KSFEKSQGTIPRKMTEM--------------EEKIQQIISNVQDLETT---------------SPVARKLPTTPFIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQN---MILTMKGREEYRNPIRTG-NEPQMGRPTTDWNTAIGTPRFYPQQRLRGE-GFLREDNLYIKLEVE 4211
            E +  C  CK +L    Q +CG R C+ C   ++   +I        C  C           ILE        D A  +E+ +L   C    C WKG +KE E+ H   C +    C  C+  +   +      + C KR   C+ C +    + +E  +      ++C  +   C + C +K   +   ++H   C    V C      C   +    +Q H ++   EH  +++ +  + A        ++  +     +ILE +  +FE     + R++  +              ++KI+ + + VQ LE +               S +        FIWKI+ F  K Q+A  G    + SP  Y+ + GYK+ +R+Y NGDG   GTH+S+F    + KG  D LL WPF Q    M+L    RE   +  R         RP +D N A G P F P  ++  +  ++R+D ++IK  V+
Sbjct:   29 EAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILRCASILSSSGPQNCAACVYEGLYEEGISILESSS--AFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHY------EVCPKFPLTC-DGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSF-LEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLF--FVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 504          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q60803|TRAF3_MOUSE (TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2)

HSP 1 Score: 151.369 bits (381), Expect = 2.588e-36
Identity = 135/535 (25.23%), Postives = 225/535 (42.06%), Query Frame = 3
Query: 2889 KIRMVNDTEERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQC--QVKECEWKGRMKEAENH-TNECEYNEILCEKC---QXXXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKD--KVKLKEHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMM---------------------KTIGMIAWEVKSLQTEMDAQKALMR--------------------------------------------EILESR----KSFEKSQGTIPRKMTEMEEKIQ---QIISNVQDLETTSPVAR--KLPTTPF----IWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTG-----NEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEVEKPD 4220
            K + V   E++ KC KC+ +L   +QT+CG R C  C   ++ + + KC  C E + KD+     D    +EI  L + C  + + C  +  +     H  NEC++ E+ C +    + +  K       K C  RE  C  C S    IK++K     +E+  C      C + C+ +   + +L  H +EC+  P  C  + + C  Q    +++ H   ++++H  ++                      K+I  +  ++ S + E++ QK ++R                                            E L++R    +S +KS G   R    +E ++    Q++S V D+       R   L T  +    IWKI  +  + Q+A  G    L S P Y+   GYK+  R+Y NGDG   GTH+S+F    I +GEYD LL WPFKQ + L +  +   R  +        N     +PT + N A G P F  Q  L    ++++D ++IK+ V+  D
Sbjct:   39 KEKFVKTVEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKDK--VFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQK-----HEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQAARNTGLLESQLSRHDQMLS-VHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLF--FVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSD 563          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q13114|TRAF3_HUMAN (TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2)

HSP 1 Score: 150.984 bits (380), Expect = 3.515e-36
Identity = 135/535 (25.23%), Postives = 224/535 (41.87%), Query Frame = 3
Query: 2889 KIRMVNDTEERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQC--QVKECEWKGRMKEAENH-TNECEYNEILCEK--C-QXXXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKD--KVKLKEHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMM---------------------KTIGMIAWEVKSLQTEMDAQKALMR--------------------------------------------EILESR----KSFEKSQGTIPRKMTEMEEKIQ---QIISNVQDLETTSPVAR--KLPTTPF----IWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTG-----NEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEVEKPD 4220
            K + V   E++ KC KC  +L   +QT+CG R C  C   ++ + + KC  C E + KD+     D    +EI  L I C  + + C  +  +     H  N+C + E+ C +  C + +  K       K C  RE  C  C S    I ++K     +E+  C      C + C+ +   + +L  H +EC+  P  C  + + C  Q    +++ H   ++++H  ++                      K+I  +  ++ S + E++ QK ++R                                            E L++R    +S +KS G + R    +E ++    Q++S V D+       R   L T  +    IWKI  +  + Q+A  G    L S P Y+   GYK+  R+Y NGDG   GTH+S+F    I +GEYD LL WPFKQ + L +  +   R  +        N     +PT + N A G P F  Q  L    ++++D ++IK+ V+  D
Sbjct:   40 KEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDK--VFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQK-----HEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLS-VHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLF--FVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSD 564          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P39429|TRAF2_MOUSE (TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 3.560e-33
Identity = 120/481 (24.95%), Postives = 199/481 (41.37%), Query Frame = 3
Query: 2913 EERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCN---------EILEKDEDPTTMDKATNKEINNLLIQCQVKECEWKGRMKEAEN-HTNECEYNEILCEKCQ-XXXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKD--KVKLKEHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMMKTIGMIAWEVKSLQTEMDAQKALMREILESR-KSFEKSQGTIPRKMTEM--------------EEKIQQIISNVQDLETT---------------SPVARKLPTTPFIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQN---MILTMKGREEYRNPIRTG-NEPQMGRPTTDWNTAIGTPRFYPQQRLRGE-GFLREDNLYIKLEVE 4211
            E +  C  CK +L    Q +CG R C+ C   ++ +    C  C           ILE        D A  +E+ +L   C    C WKG +KE E+ H   C +    C  C+  +   +      + C KR   C+ C +    + +E  +      ++C  +   C + C +K   +   ++H   C    V C      C   +    +Q H ++   EH  +++ +  + A        ++  +     +ILE +  +FE     + R++  +              ++KI+ + + VQ LE +               S +        FIWKI+ F  K Q+A  G    + SP  Y+ + GYK+ +R+Y NGDG   GTH+S+F    + KG  D LL WPF Q    M+L    RE   +  R         RP +D N A G P F P  ++  +  ++R+D ++IK  V+
Sbjct:   29 EAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSS--AFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHY------EVCPKFPLTC-DGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSF-LEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLF--FVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 497          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q12933|TRAF2_HUMAN (TNF receptor-associated factor 2 OS=Homo sapiens OX=9606 GN=TRAF2 PE=1 SV=2)

HSP 1 Score: 137.502 bits (345), Expect = 3.454e-32
Identity = 126/487 (25.87%), Postives = 200/487 (41.07%), Query Frame = 3
Query: 2913 EERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNE---------ILEKDEDPTTMDKATNKEINNLLIQCQVKECEWKGRMKEAEN-HTNECEYNEILCEKCQXXXXX-XXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKD--KVKLKEHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMMKTIGMIAWEVKSLQTEMDAQKALMREILESRKSFEKSQGT---------------------IPRKMTEMEEKIQQIISNVQDLETT--------SPVARKLPTTP-------FIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQN---MILTMKGREEYRNPIRTG-NEPQMGRPTTDWNTAIGTPRFYPQQRLRGE-GFLREDNLYIKLEVE 4211
            E +  C  C+ +L    Q +CG R C+ C   ++ +    C  C           ILE        D A  +E+ +L   C    C WKG +KE E+ H   C      C  C+ +    +  +     C +R   C  C +      V+  H      ++C  +   C + C +K   + K ++H   C    V C      C   +   + Q+H ++   EH  +++ ++     E K L   +  Q     E+L+  +S EK   T                       R+    ++KI+ + S VQ LE +        + + +K+           FIWKI+ FA K Q+A  G    + SP  Y+ + GYK+ +R+Y NGDG   GTH+S+F    + KG  D LL WPF Q    M+L    RE   +  R         RP  D N A G P F P  ++  +  ++R+D ++IK  V+
Sbjct:   29 EAKYLCSACRNVLRRPFQAQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSS--AFPDNAARREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHH------EVCPKFPLTC-DGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSSV----LEAKPL---LGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLF--FVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 497          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|B6CJY5|TRAF6_MACMU (TNF receptor-associated factor 6 OS=Macaca mulatta OX=9544 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 1.278e-31
Identity = 125/493 (25.35%), Postives = 215/493 (43.61%), Query Frame = 3
Query: 2820 ATIIERIRGSENPSEAKRRIMKD----KIRMVNDTEERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQCQVKECEWKGRMKEAENHTNECEYNEILCEKCQX-XXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRN-PNEEQICDFY*GICANNCNR-KDKVKLKEHWN-ECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMMKTIGMIAWEVKSLQTEMDAQKALMREILESRKSFEKSQGTIPR---KMTEMEEKIQQIISNVQDLETT--------SPVARKLPTTPFIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPN-GDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTGNEPQMG---------RPTTDWNT-AIGTPRFYPQQRLRGEGFLREDNLYIKLEV 4208
            AT  + + G+ +        M+D     +      E + +C  C   L  A QT CG R C  C I+ I     KCP  NEIL   E+    D    +EI +L+++C  + C  K  ++  E+H   CE+  + C +CQ             K C +R+  C+ C ++  +   E   +N P    IC++        CN    + ++  H++ +C   P+ C    F C  ++    + +H+ EN+  H       + M+A  V SL    D+    + E+   +++  + +G + R   ++ E+  K++   + V +L+ T        + +  +     +IWKI  F   L+  ++    ++ SP  Y+ K GYKL +RL+           +IS+FV     +GEYD  L WPF+  + LT+  + E   P+R  +E  M          RPT   N    G   F   + LR   F+++D L ++ EV
Sbjct:   30 ATKDDSVGGTASTGNLSSSFMEDIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILL--ENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALVDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAALVAFEDKEIHDQNCPLANVICEY--------CNTILIREQMPNHYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSH-------MRMLAQAVHSLSLIPDS--GYVSEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSTYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVH--TMQGEYDSHLPWPFQGTIRLTILDQSE--APVRQNHEEIMDAKPDLLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEV 499          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: F1AGB4 (TNF receptor-associated factor (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 278.87 bits (712), Expect = 1.063e-82
Identity = 131/148 (88.51%), Postives = 141/148 (95.27%), Query Frame = 3
Query: 3744 LETTSPVARKLPTTPFIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTGNEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDN 4187
            LET + +ARK PT PFIWKIT FAEKLQ+AKDGTQRILDSPPIYSW+NGYKLGIRLYPNGDGNATGTHISVF+R+G  +G+YDELLTWPFKQNMILTMKG+E+YRNPIRTGNEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDN
Sbjct:    1 LETNNFIARKHPTAPFIWKITEFAEKLQRAKDGTQRILDSPPIYSWENGYKLGIRLYPNGDGNATGTHISVFIRVG--RGDYDELLTWPFKQNMILTMKGQEDYRNPIRTGNEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDN 146          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1DF65 (TRAF-2 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 2.150e-51
Identity = 137/467 (29.34%), Postives = 230/467 (49.25%), Query Frame = 3
Query: 2865 AKRRIMKDKIRMV----NDTEERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQCQVKECEWKGRMKEAENHTNECEYNEILCEKC-QXXXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNE--EQICDFY*GICANNCNRKDKVKLKEHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMMKTIGMIAWEVKSLQTEMDAQ----KALMREILESRKSFEKSQGTIPRKMTEMEEKIQQIISNVQDLETTSPVARKLPTTPFIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTM-------KGREEYRNPIRTGNEPQMGRPTTDWNTAIGTPRFYPQQRLRGE-GFLREDNLYIKLEV 4208
            A  +++KD+ ++        ++R+ C KC  +LI   QT+CGCR+C+ C  E  + +   CPGCNE +    + +  DKA  KEI  L I C  K CE+  ++K+ +NH   CEY E  C  C ++   K+  K     C      CE CG       +EK+H+N NE  + +C  +  IC   C+    V +K+H   C  +PV+C L    C+  LP  EM++H    +  HT ++M  + ++  E + L   +  Q     A ++E+ E   S       +  K+ + +   ++ + N ++L   S    K     + WK+    EK+  AK G    + S   YS   GY++ +++YPNGDG+A G ++SV+    + KG+YD+ + WPF  N I+++       +G +   N     N+   GRP  + N A G P+F    +L  E  F+++  + +++ V
Sbjct:    7 AVLKVIKDRSKLFYFECEQQKQRISCVKCHQVLIEPYQTQCGCRLCSNCLEECSKDEESHCPGCNETMNSPSNYSKHDKAIEKEILELNIICTNKGCEYTCKVKDLDNHLETCEYIEKRCTACNESYPRKELKKHEEFTCKMIITTCEDCGLELSKGDLEKKHKNVNELIDNVCSKWRDICPFKCSEDTLVNIKDHLLTCERRPVECSLNEMGCRKVLPREEMREHFNLEANYHTVLLMDALFLLRKEHQDLSVSVSVQNERNSAEIKELKEKLSSLLTEIEDLKTKLKQFQSMYEK-LENERNLAKCSLSETKERYGEYTWKVENIMEKVNDAKKGVNTQILSESFYSSNPGYRMCLKIYPNGDGSAFGNYLSVY--FVLMKGKYDDQIQWPF--NSIISIRLVNIARRGEDRVLNMRPNINDQCYGRPKEEHNLAAGQPKFVSHLQLVNEDDFIKDGAIILRVNV 468          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1DBK6 (TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 4.411e-51
Identity = 128/441 (29.02%), Postives = 213/441 (48.30%), Query Frame = 3
Query: 2916 ERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQCQVKECEWKGRMKEAENHTNECEYNEILCEKC-QXXXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKDKVKLKEHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMMKTIGMIAWEVKSLQTEMDA---QKALMREILESRK-SFEKSQGTIPRKMTEMEEKIQQIISNVQDLETTSPVARKLPTTPFIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTGNEPQ-----MGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEV 4208
            + LKC  C+ +L+ A QT CGCR C EC    +E    +C    E           D+ATNKEI+ L ++C  + C ++  +K  + H + CEY   +C  C      K+        C+ RE  C++C ++  + +  + H       +C  Y  IC   C  + KV L  H   C  KP++CPL +F+C+  +P  +M +H+  +S EHT  ++  +  +  + K ++  M+    +  L++  LE  K    K+ G+I R  T ++   + I  N +                ++WKI  F++  + A  G    + S   Y+   GYK+ +++YP GDG   GTH+S+F    I KG+YD++L WPFK  +I+T+         +    +P        RP  ++N A G+P+F     L+   FL++D LYI++ V
Sbjct:   27 DNLKCVMCQDILLDAIQTDCGCRYCKECIDNYLENGEKECVAEYEDCRSVITSYIYDRATNKEISLLKVKCLYEGCVFEDTLKSIKGHLDFCEYRNEMCSLCGMEYIIKEESNHLANECLLREVLCQYCRTLLTFKEYNESHLCFESRDLCGKYEAICPYGCTGESKVNLLHHRKSCENKPLECPLHVFDCKQLIPKDQMTEHLNTSSYEHTLTIVTELRKLEKQNKHMEERMNILIEENQLLKATLEVMKLDLPKNSGSISRD-TSLKRANKTIFRNGK----------------YMWKIKSFSKLRENAMRGKNPTILSEAFYTSDFGYKMCMKIYPCGDGVGKGTHLSIF--FVIMKGDYDDILPWPFKNKVIITIFDDFSKSTNLSDTFKPDPKSICYQRPEEEYNIASGSPKFISFSELK--NFLKKDTLYIQINV 446          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: D5JG59 (TNF receptor-associated factor-2-like protein A OS=Dugesia japonica OX=6161 GN=TRAF-2A PE=2 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 3.376e-45
Identity = 105/353 (29.75%), Postives = 181/353 (51.27%), Query Frame = 3
Query: 3177 HTNECEYNEILCEKCQXXX-XXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKDKVKLKEHWNECIGKPVKCPLELFNCQA-QLPIMEMQKHMIENSIEHTEIMMKTIGMIAWEVKSLQTEMDAQKALMREILESRKSFEKSQGTIPRKMTEMEEKIQQIISNVQDLETTSPVARKLPTTPFIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTGNEPQ-----MGRPTTDWNTAIGTPRFYPQQRLRGEG-FLREDNLYIKLEVE 4211
            H   C+  EI CEKC      K+        C  R   C++CG   +   +   H NP+ +++C  Y GIC+NNCN   KV LK+H   C  K ++CP   F+C+  ++   ++ KH+ E    HT  ++  +  +  ++  L++E+  Q  + +E+ E  K   +S+  I + + E+++K     +++Q ++  + + R      FIWK T F  +   A+ G +  + S   Y+ + GYK+ +R+YP GDG   GTH+SVF    I KGE+D+LL+WPFKQ + L++  +E    P     +P        +PT + N A G P+F     +     + + D +++K+ V+
Sbjct:    4 HIESCDLREITCEKCGIKFGAKEKANHDKDKCEMRMVNCDYCGITMKSKDLNIIHLNPDRDELCSKYVGICSNNCNETRKVNLKDHLKICPNKKLECPFHQFDCKIDKMTKEKLMKHLDEEYFNHTSSLINKVKDLESKIIDLESELHNQILITKELFEMNKKSSESRLKIEKTIEELKKKAPA--TSIQTIDNKNVIFR---NASFIWKFTDFEVRRVDAESGGRVSVTSDAFYTSEFGYKMCLRVYPAGDGVGKGTHLSVF--FAIMKGEFDDLLSWPFKQKVTLSILDQESGSKPHSDTFKPDARSACYQKPTDECNIASGFPKFILLSLIMNNSIYCKNDTIFLKIAVD 349          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: D5JG60 (TNF receptor-associated factor-2-like protein B OS=Dugesia japonica OX=6161 GN=TRAF-2B PE=2 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 2.325e-44
Identity = 130/425 (30.59%), Postives = 201/425 (47.29%), Query Frame = 3
Query: 2907 DTEERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKC--PGCNEILEKDEDPTTMDKATNKEINNLLIQCQVKECEWKGRMKEAENHTNECEYNEILCEKC-QXXXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKDKVKLKEHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMMKTIGMIAWEVKSLQTEMDAQKALMREILESRKSFEKSQGTIPRKMTEMEEKIQQIISNVQDLETTSPVARKLPTTPFIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTGNEPQM-----GRPTTDWNTAIGTPRFYPQQRL 4157
            +  + LKC  C  LL+ A QT CGCR C EC  E       KC   GC ++          D A N+EI  L ++C    CE    +K+  +H + C +  I C+ C + +T  +  +   K C  R   C  CG   E+  + + H N + E++C    G C   C+   +V L +H   C  KPV C      C   +   ++ KH  E S++H+ ++MK I  +  ++  L+      K L   IL  +  F K Q  I  K+  + EKI +  S       +S          FIWKI  F+E   +A+ G +  + S   Y+ + GYK+ +++YP GDG   GTH+SVF    + +GE+D+LL WPFK  + LT+  ++   N      +P +      +PT D+N A G+P+F    +L
Sbjct:   23 NISDNLKCIICSQLLLEALQTDCGCRYCKECLKEYQAKGKTKCLTDGCGDL-----GNIIPDNAVNREIGKLTVKCLFPGCEHSELLKDIGDHLDSCIHQTINCKSCNEELTKIELKEHTEKKCPMRLVSCTHCGEEMEYSNLTELHLNVHTEKLCAKLVGKCPYKCDNGKEVNLLDHRKSCSKKPVTCLFSEIGCNRVMTKEDLIKHNNEESLQHSRLLMKEIITMKNDISELK-----MKTLEFNIL--KIEFSKFQSEILDKIKSL-EKIPRHTSPSTSSVRSSEEKTVYRNGVFIWKIERFSELKSEAERGNRISITSDYFYTKEFGYKMSMKIYPAGDGVGKGTHLSVF--FTLMRGEFDDLLQWPFKNKVTLTILDQKNKTNDHSDTFKPDVRSTCYQQPTDDYNIASGSPKFITFSQL 432          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 160.999 bits (406), Expect = 8.721e-41
Identity = 136/504 (26.98%), Postives = 214/504 (42.46%), Query Frame = 3
Query: 2913 EERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNE--ILEKDEDPTTM-----DKATNKEINNLLIQCQVKECEWKGRMKEAE-NHTNECEYNEILCEKCQXX-XXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKD--KVKLKEHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMMKTIGMI--------AWEVKS----------------------------LQTEMDAQK----ALMREILESRKSFEKSQGTIPRKMTEMEEKIQQIISNVQDLETT-----------SPVARKLPTTP----FIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQN---MILTMKGREEYRNPIRTG-NEPQMGRPTTDWNTAIGTPRFYPQQRLRGE-GFLREDNLYIKLEVE 4211
            E + +C +CKG+L    Q +CG R C  C  ++  +  I C  C    I E +    ++     D A  +EI+ L  +C    C W G +KE E  H   CE+  + CE CQ +       + + + C  R   C++C  +    K  K H     ++IC  +   C  +C +K   + K  EH   C      C      C+A +   +  +H   + IEH  +M+  +  +         W+  S                            +Q +M A +     L RE+  +    E     + R+    +EKI+ + + V+ LE T               R+L        F+WKI+ F+ + Q A  G    + SP  YS K GYK+ +RLY NGDG   G+H+S+F    + +G+YD LL WPF Q    M+L    RE   +  R   +     RP ++ N A G P F P  +L G+  +LR+D ++IK  V+
Sbjct:   37 EPKYQCQQCKGVLRKPFQAQCGHRFCVFCFKQLTSSGPIPCEACRAEGIFEMEHSMLSITEAFPDNAARREIDGLPAKCPNDGCSWNGTLKEYEVQHEGRCEFERVKCEACQMMILLSDKDRHNERECEARTLNCKYC-KVTFSFKDIKAH-----DEICQKFPMQC-KDCGKKKIPREKFAEHSKSCAKSKSACQFSEIGCRAVVDNGKQHEHEQSSIIEHLRLMLAVLSTVRVRSDGPGEWQEDSGLGLYRGPEDAAPPGAHAAAHNAAGGPGVQQKMTALENIVCVLNREVERTVLRLE----ALTRQQQLDQEKIENLSNKVRQLERTLTMRDLQLAESEQALRELQFCTYDGVFVWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLF--FVVMRGKYDALLKWPFSQKVTLMLLDQNNREHIIDAFRPDISSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVD 527          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 131.724 bits (330), Expect = 4.964e-31
Identity = 126/475 (26.53%), Postives = 212/475 (44.63%), Query Frame = 3
Query: 2913 EERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQCQVKECEWKGRMKEAENHTNECEYNEILCEKCQXXX-XXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRK-DKVKLKEHWN-ECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMMKTI------GMIAWEVKSLQTEMDAQKAL---------------MREI---LESR--------KSFEKSQGTIPRKMTEMEEKIQQIISNVQDLETTSPVARKLPTTPFIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLY---PNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTG-NEPQM---GRPTTDWNT-AIGTPRFYPQQRLRGEGFLREDNLYIKLEV 4208
            E + +C  C   L  A QT CG R C  C  + I     KCP  NE+L   ED    D    +EI +L ++C+   C  K  ++  ENH   C++  + C +CQ      +  +  ++ C  R   C  C   +  I  EK+      EQ+C F   +C   CN +  + +L  H + +C+  PV C   +F C+ ++   ++  HM E +  H   M   +      G+I+    S  +  D++ A                MRE    LESR        +       T   +MTE+ +K+  +  ++++L+     A++     ++W++ GF+  ++  + G   +L SPP Y+ + GYKL +RL+   PN        +IS+FV     +GE+D  L+WP +  + L +  + E ++ +     +P +    RPT   N    G   F   Q L   GF+R+D L ++ EV
Sbjct:   65 ESKYECPICLMGLRSAVQTPCGHRFCNCCIRKSIRDTGQKCPVDNEVL--TEDQLFPDNFAKREILSLTVRCRNVGCMEKMELRHLENHIPHCKFATVPCPQCQESVWKSELEEHINQECSHRLITCPDCA--ENIIYAEKQF----HEQLCLFANTVC-EYCNMELIRNQLASHCDTDCLKAPVACTFSIFGCREKMLRNDLALHMQEFTQMHMRYMADVLRNQTINGLISSHSASAASPTDSRGASSRPEGACQCNQELQQMRETVLELESRLVRQDHKLRELSIRNETQSTQMTELRKKLASLEESMRELQ-----AQQYQGV-YVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNAP--RCSNYISLFVH--TMQGEFDSQLSWPLQGTIRLAVLDQAEGQHHVEVMETKPDLQAFQRPTVQRNPKGFGYVTFMQLQALHQRGFVRDDVLMVRCEV 520          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 131.724 bits (330), Expect = 4.964e-31
Identity = 126/475 (26.53%), Postives = 212/475 (44.63%), Query Frame = 3
Query: 2913 EERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQCQVKECEWKGRMKEAENHTNECEYNEILCEKCQXXX-XXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRK-DKVKLKEHWN-ECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMMKTI------GMIAWEVKSLQTEMDAQKAL---------------MREI---LESR--------KSFEKSQGTIPRKMTEMEEKIQQIISNVQDLETTSPVARKLPTTPFIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLY---PNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTG-NEPQM---GRPTTDWNT-AIGTPRFYPQQRLRGEGFLREDNLYIKLEV 4208
            E + +C  C   L  A QT CG R C  C  + I     KCP  NE+L   ED    D    +EI +L ++C+   C  K  ++  ENH   C++  + C +CQ      +  +  ++ C  R   C  C   +  I  EK+      EQ+C F   +C   CN +  + +L  H + +C+  PV C   +F C+ ++   ++  HM E +  H   M   +      G+I+    S  +  D++ A                MRE    LESR        +       T   +MTE+ +K+  +  ++++L+     A++     ++W++ GF+  ++  + G   +L SPP Y+ + GYKL +RL+   PN        +IS+FV     +GE+D  L+WP +  + L +  + E ++ +     +P +    RPT   N    G   F   Q L   GF+R+D L ++ EV
Sbjct:   65 ESKYECPICLMGLRSAVQTPCGHRFCNCCIRKSIRDTGQKCPVDNEVL--TEDQLFPDNFAKREILSLTVRCRNVGCMEKMELRHLENHIPHCKFATVPCPQCQESVWKSELEEHINQECSHRLITCPDCA--ENIIYAEKQF----HEQLCLFANTVC-EYCNMELIRNQLASHCDTDCLKAPVACTFSIFGCREKMLRNDLALHMQEFTQMHMRYMADVLRNQTINGLISSHSASAASPTDSRGASSRPEGACQCNQELQQMRETVLELESRLVRQDHKLRELSIRNETQSTQMTELRKKLASLEESMRELQ-----AQQYQGV-YVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNAP--RCSNYISLFVH--TMQGEFDSQLSWPLQGTIRLAVLDQAEGQHHVEVMETKPDLQAFQRPTVQRNPKGFGYVTFMQLQALHQRGFVRDDVLMVRCEV 520          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf5 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:103031120])

HSP 1 Score: 129.413 bits (324), Expect = 3.348e-30
Identity = 129/526 (24.52%), Postives = 226/526 (42.97%), Query Frame = 3
Query: 2892 IRMVNDTEERLKCCKCKGLLIGARQTKCGCRICTECTIEVIET-KTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQC-QVKECEWKGRMKEAENHTNECEYNEILC--EKCQXXXXXXXX-XXXXXXCVKREEKCEFCGS---IDEWIKVEKEHRNPNEEQICDFY*GICANNC-NRKDKVKLKEHWNECIGKPVKCPLELFNC-----QAQLPIMEMQK--HMIENSIEHTEIMMKTIGMIAWE----------------------------VKSLQTEMDAQKAL----------MREILES----------RKSFE--KSQGTIPRKMTEMEEKIQQIIS--------NVQDLETTSPVARKLPTTPF----IWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTGNEPQMG-----RPTTDWNTAIGTPRFYPQQRL---RGEGFLREDNLYIKLEVE 4211
            +  V   +++  C  C G++    QT CG   C+ C   ++E  +T KCP  + IL K E+    D    +E+ NL + C     C     +   ++H   C+Y  + C    C  I  +K +       C  R E C +C     + +    EK      E Q        C N C +   + KLK+H +EC  +   C  + + C     + Q+ + E  +  H +   +E    ++K +  +  +                            V ++Q  ++ Q+ L          +R++LE+          R S +  + Q  + + + E    + Q           +VQ L+ +    ++L +T +    IWK+  +    +K + GT   L+SPP Y+  +GYKL  R+Y  G+G A GTH+S++V   + +G++D LL WPF+QN+ L +  +   RN +     P +      RPT++ N A+G PRF     L   R   ++R+D L+IK++V+
Sbjct:   35 LSFVVKLDDQFVCPACGGVVFNPHQTGCGHIFCSPCIRVILENNETSKCPF-DGILIKPEE-VFQDNCCKRELLNLEVFCTNSPACSQTIPLCNLQDHLKSCQYEALQCPNSSCTDILLRKNLPDHQRSHCSYRTELCRYCQKPYPVSQLTDHEKTSCPEAEVQ--------CPNKCIHLVKRHKLKDHADECPEQETDCIYKKYGCTVRNKRGQVKVHEQTEFNHHVLLLLESNSKLIKQVDQLQQDFAAQQGELKERNLLVSNLKREVSKCDTTVSAMQRSVEEQRELVSSVKRELKDLRDVLEADLTKEELVSLRASLDSLREQVAMTQSLREHLGALGQTCQSHTRLLDIHVQQLQCSEQRFQQLESTSYDGKLIWKVHDYH---RKKEAGT--ALNSPPFYTSHSGYKLSARVYLGGEGTARGTHLSLYVM--LMRGDFDSLLPWPFRQNVTLAVLDQSGNRNHVSLSFTPDLASNNFRRPTSETNAALGFPRFITHADLEAPRNAAYVRDDTLFIKVKVD 543          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 127.102 bits (318), Expect = 5.840e-30
Identity = 119/478 (24.90%), Postives = 201/478 (42.05%), Query Frame = 3
Query: 2898 MVNDTEERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQCQVKECEWKGRMKEAE-NHTNECEYNEILCEKC-QXXXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRK-------DKVKL--------KEHWNEC---IGKP----VKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMMKT----IGMIAWEVKSLQTEMDAQKALMR------EILESR-KSFEKSQGTIPRKMTEMEEKIQQIISNVQDLETTSPVARKLPTTPFIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQN---MILTMKGREEYRNPIRTG-NEPQMGRPTTDWNTAIGTPRFYPQQRLRGE-GFLREDNLYIKLEVE 4211
            + N  E++  C  C+ +L    Q +CG R                                 D A  +E+  L   C  + C W G +KE E  H  +C++  I C  C + +   +  + + + C +R   C++C     +  + K H     ++IC  Y  IC     +K       D +KL        + H   C   + KP    +  P +L      +P+ + +   +    +  E+ + T    + ++  E++   T M+A     R      EIL ++ +  E++ G     + EME K++++ +   D               F+WKI+ F++K Q A  G    + SP  Y+ K GYK+ +R+Y NGDG   GTH+S+F    + +G  D LL WPF Q    M+L    RE   +  R   +     RP +D N A G P F P  +L  +  ++R+D ++IK  V+
Sbjct:   24 LANKLEDKHLCNICQKILRRPFQAQCGHRFSPASAFP-------------------------DNAAKREVEALEAVCINEGCSWTGTIKEYEATHEGQCDFMIIPCPSCKELLRANELERHNERECPERTLNCKYCKEPFHFKNI-KAH-----DEICPKYPMICEGCAKKKIPREKYVDHIKLCTKFRTPCRFHVVGCDMSVSKPQWNLILTPRDLLYTSFTVPLSQTKVAELSRRCQELELKVGTFENIVCVLNREMERSATTMEAYNRQHRLDQDKIEILNNKVRQLERTVGLRDLSIVEMEGKMREMSAATYD-------------GVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLF--FVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVD 455          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 109.768 bits (273), Expect = 4.617e-25
Identity = 98/422 (23.22%), Postives = 168/422 (39.81%), Query Frame = 3
Query: 3189 CEYNEILCE--KCQXXXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKD--KVKLKEHWNECIGKPVKCPLELFNC------------------QAQLPI-------MEMQKHMIENSIE-HTEI----------------------------MMKTIGMIAWEVKSLQTEMDAQKALMREILESRKSFEKSQGTIPRKMTEMEEKI--------------QQIISNVQDLETTSPVARKLPTTPF----IWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTGNEP-----QMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEVE 4211
            C +  +LC+  +C T   +  +  H   C  R E C++C +      +E+ H+   EE  C  Y   C NNC      + +L +H + C      C   +  C                  ++   +       +E+Q   ++ SIE HT +                            +  T+ M+    + LQ+   AQ+A  R+      +  +   T+  ++  +E  +              Q++  +   L+T     + L T  +    +WKI  +A + Q+A  G    L S P Y+   GYK+  R Y NGDG   GTH+S+F    + +GEYD LL WPF++ + L++  +   R  +     P        RP  D N A G P F     L G  +L +D +++++ V+
Sbjct:    1 CPHERVLCDFPRCGTSVQRTRLAAHRASCPHRAEFCKYCSAAVTCSLLERHHK---EE--CAQYPLPCPNNCEEHGIPRAELSQHMSACAMSTKLCGFHMLGCTFKQGTSESVREHEESAVRSHFTLVISRNSELELQCARLQCSIEDHTNMSEMLTQRVAQLEQDLSHWSTLTGSNNTRLGSTLEMLTQHNEQLQSLHVAQRAPQRDA--DTAALRRDMATLRERLRALEAALGNPGPCEERCHMHEQRLTMHDGLLDTAERRLQVLETAGYSGKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLF--FVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDTFTPDPASGSFRRPDGDMNVASGCPLFVSHVALEGSSYLVDDTVFVRVVVD 413          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.457 bits (267), Expect = 4.262e-24
Identity = 65/224 (29.02%), Postives = 109/224 (48.66%), Query Frame = 3
Query: 3594 SLQTEMDAQKALMREILESRKSFEKSQGTI-----PRKMTEMEEKIQ----QIISNVQDLETTSPVARKLPTTPF----IWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTGNEP-----QMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEVE 4211
            +L+ ++D   A + E+     + E+S G++     P ++  ++  +     Q+ ++   L       + L T  +    +WKI  +A + Q A  G    L S P Y+   GY++  R Y NGDG   GTH+S+F    + +GEYD LL WPF+Q + LT+  +   R  +    +P        RPT+D N A G P F     L    +L++D ++IK+ V+
Sbjct:  249 ALRGDLDGTAATLHELGTRVAAIEESGGSVTHSSTPTRLAALDSALSRHDTQLFAHDTRLAEMDLRFQVLETASYNGKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLF--FVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSDTFKPDPASSSFRRPTSDMNIASGCPLFVSHVALESASYLQDDTIFIKVVVD 470          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008091.1 (pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 gene:ENSPMAG00000007312.1 transcript:ENSPMAT00000008091.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.6557 bits (213), Expect = 1.359e-17
Identity = 101/412 (24.51%), Postives = 170/412 (41.26%), Query Frame = 3
Query: 2919 RLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNEILEKDE----DPTTM--DKATNKEINNLLIQCQVKECEWKGRMKEAE-NHTNECEYNEI---LCEKCQXXXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKE--HRNPNEEQICDFY*GICANNCNRKDKVKLKEHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIE-HTEIMMKTIG-----MIAWEVKSLQ-------TEMDAQKALM-REILESRKSFEKS---------QGTIPRKMT-EMEEKIQQIISNVQDLE-TTSPVARKLPTTP-------FIWKITGFAEKLQKAKDGTQRI--LDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFK 4016
            R  C  C+GLL  A QT CG R C  C   +I   T     CN+ L         PT    D A  +E+  L ++C  + CEW+GR+ E +  H   C++  +   L      +   +  +   + C  R   C  C  +  + +++K   H      + C     +C      +DK +  E    C+     CP     C  +     +  H  +NS+E H  I+          +I     +++          +AQ A M R + E  K  E+          QG I R  T  ++ K+ ++  + Q+ E +   + R+L           F+WKI     +L++A +G +R   +DSP  ++ + GY+L +RL  +G+      H+S +    +G G YD  L WP++
Sbjct:    2 RFACGSCQGLLRDAVQTHCGHRFCKPCIARLI---TSVHRSCNDTLMNSNFLVYSPTQFFPDAALRREMGVLPVRCVSEGCEWRGRLLEYDVAHVERCDWVLVPCLLAGCALLLPRAELHRHVAQECSVRPVPCAACAQLLPYRQLQKHQLHCRSRRTRECK----LCGQKSIPEDKWQHHEE-RRCMKNRDTCPYSPLGCLYRGHGESLHNH-DKNSVEVHLAIVYDAFKKTFEQLIKGHADNIKHPPSARLVAAEAQLATMDRRVEEVAKRVERDVRVSEASTRQGNIDRDETARLQNKMARVEHSDQETERSILGLTRRLAELENTAYNGMFLWKIKHVINRLREAGNGAERPPQIDSPAFFTTRYGYRLRLRLCRSGE------HVSAYAM--LGPGPYDATLAWPYQ 396          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 78.9518 bits (193), Expect = 8.334e-15
Identity = 111/508 (21.85%), Postives = 194/508 (38.19%), Query Frame = 3
Query: 2913 EERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTI--KCPGCNEILEKDEDPTTMDKATNKEINNLLIQCQVKECEWKGRMKEAENHTNECEYNEILCEKCQXXX-XXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKDKVKLKEHWN-ECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMMKTIGMIAWEV-KSLQTEMDAQKALMREILESRKS----------FEKSQGTIPRKMTE--------------MEEKIQQIISNVQDL------------ETTSPV----AR------KLPTTPFIWKITGFAEKLQK------AKDGTQ----RILDSPPIYSWKNGYKLGIRL-------YPNGDGNAT------GTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRT----GNEPQMG---RPTTDWNT-AIGTPRFYPQQRLRGEGFLREDNL 4190
            E + +C  C   L    QT CG R C  C +  +  +    KCP  N +L + +     D    +EI +L ++C  K C  +G ++  + H   CEY ++ C +C+     +   K   + C++R   C  C     +   +      N EQ+C      C +      + +L  H   +C    V C      C+AQ+    +  HM E++  H  ++   + ++  +V +  Q    A  +     L    S            +SQG+  R   +              +EE++   +  +++L            E T  V    AR      +L    F W++  F+  L        A DG       ++ S   Y+   GY+L +RL        P G  + +        H+++FV   + +G+YD  L WPFK  + +++  + E R+ +        +PQ+    RP+   N    G   F     L    +LR+D L
Sbjct:   60 ESKYECPICLMALREPVQTPCGHRFCRACILHSMRLRDAGPKCPVDNAVLHEGQ--LFPDNFAKREILSLTVRCPNKPCGHRGELRALQEHQLRCEYAQVPCVRCEMPVCRRDLAKHEEQECMRRIVTCLHCCEKMAYKDSK------NHEQMCPLVVVNCKHCQQELIREQLGPHLEVDCQQAQVPCTFSPLGCEAQMVRSLLAAHMHEHTQVHMRLLANGLKILRIQVGQGAQPSSAAGSSAPPNSLSWLSSTSGGDVQTAGASRSQGSRDRAACDCAQELDRLREITRTLEERVVLQLHQIRELSAKTDNQQGLLAEATRLVRSLEARVAESESRLCAGIFTWRVERFSRLLPGGLASGFASDGMHPDAPAVMHSSGFYTGVPGYRLCLRLQVLSGREVPAGAASPSVLLAGRQPHLALFVH--LLQGDYDHRLPWPFKGRIRISVVDQCE-RDSVHVTEMMDADPQLSAFQRPSVHRNPKGFGYMNFMDINTLHHRSYLRDDCL 556          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: birc2 (baculoviral IAP repeat containing 2 [Source:ZFIN;Acc:ZDB-GENE-030825-6])

HSP 1 Score: 56.6102 bits (135), Expect = 7.891e-8
Identity = 19/50 (38.00%), Postives = 30/50 (60.00%), Query Frame = 3
Query: 5376 EQYQCVTCWQKHVEIIYMPCGHMVTCEACGIKVDICPVCRKPINGRIKGF 5525
            EQ+ C  C  K V ++++PCGH+V C  C   +  CP+CR  + G ++ F
Sbjct:  525 EQHTCKVCMDKEVSVVFIPCGHLVVCRDCASSLRKCPICRAVVRGTVRTF 574          

HSP 2 Score: 53.5286 bits (127), Expect = 6.328e-7
Identity = 26/70 (37.14%), Postives = 36/70 (51.43%), Query Frame = 3
Query: 4572 EEQRYLTFKDNKVFTDRQSKEMAAQGFYFTGTPELPDEVTCIYCKGKLAKWEKGETAKREHLRKFSTCPF 4781
            E  R L+F      +  +  ++A  G Y+ G P   D V C YC G +  WE+G+   +EH R FSTC F
Sbjct:  166 EANRLLSFSTWPESSPVRPADLARAGLYYVG-PN--DRVACFYCSGVMRDWEEGDVPAKEHERHFSTCAF 232          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO32851 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV5])

HSP 1 Score: 152.525 bits (384), Expect = 7.709e-39
Identity = 128/467 (27.41%), Postives = 215/467 (46.04%), Query Frame = 3
Query: 2898 MVNDTEERLKCCKCKGLLIGARQTK-CGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQCQVKE--CEWKGRMKEAENHTNECEYNEILCEK--CQXXXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQI--CDFY*GICANNCNRK---DKVKLKEHW-NECIGKPVKCPLELFNCQAQLPIME-------MQKHMIENSIEHTEIMMKTIGMIAWEVKSLQTEMDAQKALMREILESRKSFEKSQGTIPRKMTEMEEKIQQIISNVQDLETTSPVARKLPTTPFIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTM-------KGREEYRNPIR----TGNEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEVE 4211
             V   +++  C  C+GLL    Q K CG R+CT+C  +++ + + +CPGC +  E +E+   +DKA ++EI  L ++C+  E  C+W+G + E  +H  +C+Y++ILCE         +   K   K C ++   C +C         EK  R   +  +  C      C N C++K    + +L  H  N+C    + C  E+  C  ++  +E       M KH   N I H    +K +  +A + K L         +MR                  K++E    I++    + DLE       K+  +  IW+I  +  K+++AK G    L SP   + K+GY+L   +  NGDG   GTH+SVF  I + KG +D LL WPF   +   +         R+  R  I+      NEP +GRP  + N + G  +F   + +    +++ED +++K+ V+
Sbjct:   35 FVYPLQKKYICLDCEGLLWYPVQIKPCGHRVCTKCYTKLLSS-SARCPGCMD--ELNENIPDIDKAFHEEIQELDVKCRNVEWNCKWEGCVNEFSSHVEKCDYSDILCENDCGAKFQRRFLTKHLDKDCPEKLITCLYCD--------EKHLRKDKKGHLENCPLLPCPCPNKCDKKLTIHRCELDSHVENDCPRTKLMCEYEVLGCGHRITGLEGGGSREKMPKHNKTNIIAH----VKMVADLALKNKEL---------IMR---------------FSEKLSEHGTLIEKHEKRLNDLE-------KIAHSQLIWRIEDYTRKMKEAKAGNTDTLFSPTFTTSKHGYRLCASVCLNGDGKGKGTHMSVF--ISVLKGAFDALLKWPFDYRVTFVLLDQNDDPAQRKHIRFSIKPNPCADNEPFLGRPRLEKNASFGGAKFAKHEEIVSRNYIKEDTIFLKISVD 453          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO41243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z7])

HSP 1 Score: 148.673 bits (374), Expect = 1.684e-37
Identity = 123/478 (25.73%), Postives = 200/478 (41.84%), Query Frame = 3
Query: 2898 MVNDTEERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKT-IKCPGCNEILEKDEDPTTMDKATNKEINNLLIQCQVKECEWKGRMKEAENHTNECEYNEILCEK---CQXXXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQI-----------------------CDFY*GICANNCNRKDKVKLKEHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMMKTIGMIAWEVKSLQTEMDAQKALMREILE----SRKSFEKSQGTIPRKMTEMEEKIQQIISNVQDLETTSPVARKLPTTPFIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEY--------RNPIRTGNEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEVEK 4214
             V    E   C  C   L    QTKCG R C EC  E    K+  +CP   E L+  +D   +DKA  + I + L++C  K C+W+  +++ E H   C+Y  + C        +      +     C  R   CE+CG    +   +   RN + + +                       CD+   +C    +       K+H N+C   PV CP    +C  Q+   +++ H  E              ++    +    E++ Q  LM + L+    S  +   +Q  + R       ++QQ +  V +L              F+W+I  FA+ L++AK G +  LDS P ++ KNGYKL   LYPNG  +   THIS FV   I +GEYD +L WPF + + +T+  ++E         +  I   +     RP T  N   G+  F   ++L  E ++ +  L++++EV  
Sbjct:   15 FVIAVAEEYTCRICHLPLRVPVQTKCGHRFCKECLDEASRRKSRAECPMDREPLDLKKD-VFLDKAAERTILSFLVKCPCKGCKWEAELRDLEAHARNCDYELVTCSNPMCSAQLPRMDVDEHLLVECDWRLIVCEYCGDESPYCLQKAHARNCDYKLVTCSNPMCSAQLPRMDVDEHLLVECDWRLIVCEYCGDESPYCLQKDHSNQCDKFPVLCP---NDCGTQITREKLRDHQSEEC---------QFAVVPCAFRDFGCEVEIQNRLMDQHLDTNIQSHLNMTCNQLLLSRDSGAQFHELQQGLGRVNELLKMR----------FVWRIPDFADSLRQAKLGLKVRLDSEPFFTEKNGYKLRATLYPNGTMSGKNTHISAFV--SINRGEYDGILAWPFTRVIKITLLDQKENVLQRRNVEKTIIPNPSLENFHRPKTVSNNGRGSATFVSHEKLWTENYVVDGTLFMQVEVSS 467          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO38873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBN4])

HSP 1 Score: 145.976 bits (367), Expect = 1.552e-36
Identity = 124/476 (26.05%), Postives = 213/476 (44.75%), Query Frame = 3
Query: 2928 CCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQC--QVKECEWKGRMKEAENHTNECEYNEILC---EKCQXXXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNR--KDKVKLKEHWNECIGKPVKCPLELF-NCQAQLPIMEMQKHMIE-----------NSIEHTEIM----MKTIGMIAWEVKSLQTEMDAQKALMREILESRKSFEKSQGTIPRKMTEMEEKIQQI------------ISN--VQDLETTSPVARKLPTTPF----IWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRT----GNEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEVEKPD 4220
            C KC+ ++  A QT CG R C+ C   ++    I+C  C   + K E  T  DK  ++EI  L + C  Q   C W+G ++  +NH  +CE+N I C   E  + ++  K  +     C  REE C +C       ++++ H     E+ C  Y      NC +  K+ ++++ H      +P    LE    C+  L ++E  +  I+           N ++   I      + IG +   V +++ +    + L+ E   +     +  G +  K+ E ++ I+++            + N  + DLE        L  T F    +WKIT  A K  +A  G      SP  ++  +GYK+  R+Y NGDG     H+S+F    I +GE+D LL WPF+Q + L +  ++   + I       +     RP  + N A G P F   ++L    ++R+D +++K+ V+KPD
Sbjct:   24 CAKCRLIVKDAVQTACGHRYCSPCISPLLSRGPIQCDVCGSTITKPE--TFRDKFADREILELHVHCVNQPHGCPWEGELRHRQNHHTKCEFNPISCVHPECGKKLSVAKLPEHLQNECQYREETCSYCEQPVVVARMKEHH-----EKTCPSY----PVNCPKCSKELIRVEVHSTPFTREP---RLEKGRGCENTLEVLEDHESRIKKLEQRGGGIGVNGLQSMRISENIDNEAIGDVLRRVANVEAKGADHEVLVVEAHSAVDELRREVGRLNVKLQESDDIIRRLERQLELHDQGTGLRNLAIADLEER---LNTLQGTTFDSVLLWKITNVANKRSEATSGRVTSFYSPCFFTGPHGYKMCARIYLNGDGMGRNHHVSLF--FVIMRGEFDALLRWPFRQKVTLMLLDQDNVEHVIDAFRPDPSSSSFQRPRAEMNIASGCPLFCSHEQLTQHAYIRDDTMFLKIIVDKPD 480          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO32849 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV3])

HSP 1 Score: 141.739 bits (356), Expect = 2.816e-35
Identity = 127/488 (26.02%), Postives = 212/488 (43.44%), Query Frame = 3
Query: 2826 IIERIRGSENP----SEAKRRIMKDKIRMVNDTEERLKCCKCKGLLIGARQTK-CGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQCQVKE--CEWKGRMKEAENHTNECEYNEILCEK--CQXXXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKV-EKEHRNPNEEQICDFY*GICANNCNRKDKV---KLKEHW-NECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMMKTIGMIAWEVKSLQTEMDAQKALMREILESRKSFEKSQGTIPRKMTEMEEKIQQIISNVQDLETTSPVARKLPTTPFIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREE------------YRNPIRTGNEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEVE 4211
            +I+++   E+      + +R + K+  +     E +  C  C+ + +   Q K CG R+C  C   +  +   KCP C+  L  D+    +D+A   ++N L  +C   E  C+ +    +   H  ECEY++ILC+         +   K   K C K+   C +C   D  ++  +KEH      + C      C N C++   +   +L EH   EC    + C  E   CQ +    +M KHM    I H +++   +                        LE ++  +       +K  E E  ++Q+ S V DLE       K+  +  IW+I  +  KL++AK G    L SP   + K+GY+L   +  NGDG   GTH+SVFV   + KG +D LL WPF   +   +  + E              NPI   NEP +GRP  + N + G  +F   + +    F+++D +++K+ V+
Sbjct:   17 VIQQVNNDEDKMPEIEKVERPLTKNYFKKPPFEERKHLCPVCEDIFVSPVQIKECGHRLCQHCYKTIWRSPEPKCPKCSGDL--DDKIPDVDQAFENDMNELPCRCINHEWGCKVEVPFTQMITHKGECEYSDILCDNDCGAKFQRRFKQKHLDKDCPKKIISCPYCD--DRHLRENKKEHL-----EDCLLIPLPCPNKCDKTLTIPRGQLDEHIEKECPRAKLMCEFESLGCQHRCSREKMAKHMKSEIIGHVKMIFGVV------------------------LEQKEKLDNHA----QKFEEHETIMKQVDSRVGDLE-------KIAHSQIIWRIEDYTRKLKEAKAGNAETLFSPTFTTSKHGYRLCASVCLNGDGKGKGTHMSVFV--SVLKGAFDALLKWPFHYRVTFFLLNQHENPEERKHVKFSIKPNPI-PDNEPFLGRPRLEKNASFGGAKFIKHEEIESGNFIKDDTVFLKVSVD 457          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO37750 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SER6])

HSP 1 Score: 118.242 bits (295), Expect = 2.170e-27
Identity = 113/483 (23.40%), Postives = 192/483 (39.75%), Query Frame = 3
Query: 2898 MVNDTEERLKCCKCKGLLIGARQTK-CGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQCQVKE--CEWKGRMKEAENHTNECEYNEILCEKC--QXXXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKDKVKLKE----------------------------HWNECIGKPVKCPLELFNCQ-AQLPIMEMQKHMIENSIEHTEIMMKTIGMIAWEVKSLQTEMDAQKALMREILESRKSFEKSQGTIPRKMTEMEEKIQQIISNVQDLETTSPVARKLPTTPFIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTGNEPQMGRPTTDWNT-----------AIGTPRFYPQQRLRGEGFLREDNLYIKLEVE 4211
             V    E L C  C   +  A Q   CG R C  C    +    ++CP  N  +  D      D  TN+ I +L + C   +  C+WKG++++ + H  EC++    C       I  ++  +   K C KR   C  C +   + ++    R  NE  +   +   C  NC  + +V+ K                             H   C   P+ CP    NC  AQ+P  E++ H+  +    + IM      +         +   Q++L R I ES          + + +  + E   Q    +  L+      +    +  +W+I  F E   + K      L SP  Y+   GYK  + L+P G+G+  GTH+S+++R  +  GEYD LL WPF+  + LT+  +   +   R  +  Q   P  +W +             G P+F   + L   G++R+D L++K+ ++
Sbjct:    8 FVPAVRENLLCRICHLPVRNAVQVSVCGHRFCDSCLNHALGETRLRCPVDNTAI--DYSQVYADDVTNQMIMSLTVICDYYQAGCKWKGQLRKLQGHLAECKFVSADCSNSCGARIQKRRMSEHTSKDCPKRRVCCARCKAEMSYEQLRVSLRYRNEGALVSDH-VTCPRNCGERMRVQDKARHMREDCLNRWVFCQYCNTEIVFRDRQTHHQSCPSFPLSCP---NNCGVAQIPRGEVELHLSRDC--RSNIMQCPFRHVGCH------KQFPQRSLQRHIEES----------VQQHLELVSELAIQQQKEINSLKEIVRHCKPYHDSKLLWRIDDFWEAFDEGKRKPGTELHSPVFYTSNYGYKFKVVLFPYGNGSGEGTHLSLYIR--LLPGEYDSLLPWPFEGQITLTLLDQSTDKRAKR--HISQSFSPDPNWKSFQRPSKNSTSLGFGYPQFVSHRGLESIGYVRDDVLFLKVTID 462          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 157.532 bits (397), Expect = 9.633e-40
Identity = 134/498 (26.91%), Postives = 221/498 (44.38%), Query Frame = 3
Query: 2913 EERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTM--------DKATNKEINNLLIQCQVKECEWKGRMKEAE-NHTNECEYNEILCEKCQXXXXXXXXXXXXXX-CVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKD--KVKLKEHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMMKTI----------------------GMI---------AWEVKSLQTEMDAQK------ALMREILESR---KSFEKSQGTIPRKMTEMEEKIQQIISN--VQDLETTSP--VARKLPTTP----FIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQN---MILTMKGREEYRNPIRTG-NEPQMGRPTTDWNTAIGTPRFYPQQRLRGEG-FLREDNLYIKLEVE 4211
            E++ KC +C  +L    Q +CG R C  C  ++  +    C  C +  E  E+P ++        D A  +EI +L  +C  + C+W G +KE E  H   CE+ +I CE CQ +  +K    H+   C +R   C++C     +  + K H     ++IC  +   C  +C +K   + K  +H   C      CP     C++ +   ++ +H   +++EH  +++  +                      G+          A  V S+  +            L RE+  S    ++F         K+  +  KI+Q+  +  V+DL+ +    + R+L        F+WKIT F+ + Q+A  G    + SP  YS K GYK+ +RLY NGDG   GTH+S+F    + + +YD LL WPF Q    M+L    RE   +  R         RP ++ N A G P F P  +L G+  +LR+D ++IK  V+
Sbjct:   25 EDKYKCQQCLQVLRKPVQAQCGHRFCVHCFRQLTSSGPKPCQACRK-EEIYEEPMSILNSSEAFPDNAAGREIASLPARCLNQGCDWTGSIKEYEAKHEGRCEFEQIQCEACQALVLRKDKDRHNDRECEERTLNCKYCKVTFNFKDI-KAH-----DEICQKFPLQC-KDCGKKKIPREKFNDHAKSCAKSKSACPFSEVGCKSVVENGKISEHEHSSTMEHLRLLLPMVLSMTRTRLDTSPSGEWQEDSGLGLYRAPDDGCGAAASVPSVDLDKKVSALENIVCVLNREVERSSLTLEAFSHQHRLDQEKIENLSNKIRQLERSLTVKDLQLSEAEQMVRELQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLF--FVVMRSKYDALLKWPFSQKVTLMLLDQNNREHIIDAFRPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIVD 512          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 157.532 bits (397), Expect = 1.177e-39
Identity = 134/498 (26.91%), Postives = 221/498 (44.38%), Query Frame = 3
Query: 2913 EERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTM--------DKATNKEINNLLIQCQVKECEWKGRMKEAE-NHTNECEYNEILCEKCQXXXXXXXXXXXXXX-CVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKD--KVKLKEHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMMKTI----------------------GMI---------AWEVKSLQTEMDAQK------ALMREILESR---KSFEKSQGTIPRKMTEMEEKIQQIISN--VQDLETTSP--VARKLPTTP----FIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQN---MILTMKGREEYRNPIRTG-NEPQMGRPTTDWNTAIGTPRFYPQQRLRGEG-FLREDNLYIKLEVE 4211
            E++ KC +C  +L    Q +CG R C  C  ++  +    C  C +  E  E+P ++        D A  +EI +L  +C  + C+W G +KE E  H   CE+ +I CE CQ +  +K    H+   C +R   C++C     +  + K H     ++IC  +   C  +C +K   + K  +H   C      CP     C++ +   ++ +H   +++EH  +++  +                      G+          A  V S+  +            L RE+  S    ++F         K+  +  KI+Q+  +  V+DL+ +    + R+L        F+WKIT F+ + Q+A  G    + SP  YS K GYK+ +RLY NGDG   GTH+S+F    + + +YD LL WPF Q    M+L    RE   +  R         RP ++ N A G P F P  +L G+  +LR+D ++IK  V+
Sbjct:   32 EDKYKCQQCLQVLRKPVQAQCGHRFCVHCFRQLTSSGPKPCQACRK-EEIYEEPMSILNSSEAFPDNAAGREIASLPARCLNQGCDWTGSIKEYEAKHEGRCEFEQIQCEACQALVLRKDKDRHNDRECEERTLNCKYCKVTFNFKDI-KAH-----DEICQKFPLQC-KDCGKKKIPREKFNDHAKSCAKSKSACPFSEVGCKSVVENGKISEHEHSSTMEHLRLLLPMVLSMTRTRLDTSPSGEWQEDSGLGLYRAPDDGCGAAASVPSVDLDKKVSALENIVCVLNREVERSSLTLEAFSHQHRLDQEKIENLSNKIRQLERSLTVKDLQLSEAEQMVRELQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLF--FVVMRSKYDALLKWPFSQKVTLMLLDQNNREHIIDAFRPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIVD 519          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 139.428 bits (350), Expect = 3.976e-34
Identity = 118/453 (26.05%), Postives = 194/453 (42.83%), Query Frame = 3
Query: 2895 RMVNDTEERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQC--QVKECEWKGRMKEAENHTNECEYNEILCE--KCQXXXXXXXXXXXXX-XCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKDKVKLKEHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMMKTIGMIAWEVKSLQTEMDAQKALMREILES-RKSFEKSQGTIPRKMTEMEEKIQQIISNVQDLETTSPVARKLPTTPFIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTGNEP-----QMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEVEKPD 4220
              V   E +  C  C+ +L   RQT+CG R C  C  +++      CP   E L KD+     D   ++EI  L + C  +   C+ +  +++  +H N C + E+ C   KC+    +K I +H    C  RE  CEFC +     +++K     ++E +C  +   C N+C                              + LP  E         +   E+ ++++  +  E++SL+  +D  +  +  + +  R S E         ++  E ++  +    Q LET S           IWKI  +  + Q A  G    L S P Y+   GYK+  R+Y NGDG   GTH+S+F    + +GEYD LL WPFKQ + L +  +   R  +    +P        RP  + N A G P F  Q  L    ++++D ++IK+ V+  D
Sbjct:   37 HFVEAPEAKYCCEACRLVLCQPRQTECGHRFCYSCINDILSCPNPVCPADMEPLFKDK--IFRDVCCHREIMALKVYCRSEANGCQEQMSLQQIPDHVNVCPFFEVPCPLGKCKERMMRKEIPEHLAWKCKYRESTCEFCKNKMPLTELQK-----HKETVCPAFPVSCPNHCT----------------------------SSSLPRSEKLMSSHTEKLLELELELRSLRQLRDEMESLRGTLDTVRTRLSALEQGGRASLETQLNRHDDMLSVHEIRLADMDLRFQVLETASY------NGTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLF--FVVMRGEYDALLPWPFKQKVTLMLMDQGPSRKHLGDAFKPDPSSSSFRRPVAEMNIASGCPLFVSQSVLESGTYIKDDTIFIKVTVDTSD 446          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 117.857 bits (294), Expect = 7.793e-27
Identity = 116/494 (23.48%), Postives = 206/494 (41.70%), Query Frame = 3
Query: 2895 RMVNDTEERLKCCKC-KGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQCQVKE--CEWKGRMKEAENHTNECEYNEILC-EKCQXXXXXXXX-XXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKDKVKL----------------------------KEHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMMKTIGMIAWEVKSLQTEMDAQK-ALMREILESRKSFEKSQGTIPRKMTEMEEKIQQIISNVQDLETTSPVARKLPTTPFIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGRE-----------EYRNPI---RTGNEPQMGRPTTDWNT-AIGTPRFYPQQRLRGEGFLREDNLYIKLEVEKPDKTL 4229
            + +   + R +C  C K +    + + CG R C  C  E +     KCP   + L  D      D    ++I +L I+C   E  C W G+MK+ + H + C +N I C  +C    T++ +       C KR+ KCEFCGS  E+     E    N + +C      C N C  +   +L                            + H   C   PV+CP +       +   ++  H+ +N             ++    K    +    K A+ R + ++ KS       +   ++   ++I ++   +++L  +            IWK+  ++ KLQ+AK  +     SPP Y+ + GYKL +  + NG+G+  G+H+SV++R  +  GEYD LL WPF   +  ++  +            E  NP    +   +P   R + D +T   G P+F   + ++   ++R++ ++IK  +E P K +
Sbjct:    7 KFLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCP--EDQLPLDYAKIYPDPELEQQILSLPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIPCPNRCSVKLTRRDLPDHLQHDCPKRKVKCEFCGS--EFTGEAFE----NHQGVCPQESVYCENKCGARMMRRLLSQHGMAECPKRTQPCKYCGKEFVFDTIQNHQFHCPRFPVQCPNQCGT--PNIAREDLANHVKDNC---------GSALVLCPFKDAGCKHRCPKLAIGRHLEDTTKSHLTMMCNL---VSRQRQEILELRREMEELSVSHDGV-------LIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIR--VLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSTRNSLDESTLGFGYPKFISHEEIKKRNYIRDNCIFIKASIEIPQKIM 469          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 118.242 bits (295), Expect = 8.227e-27
Identity = 116/494 (23.48%), Postives = 206/494 (41.70%), Query Frame = 3
Query: 2895 RMVNDTEERLKCCKC-KGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQCQVKE--CEWKGRMKEAENHTNECEYNEILC-EKCQXXXXXXXX-XXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKDKVKL----------------------------KEHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMMKTIGMIAWEVKSLQTEMDAQK-ALMREILESRKSFEKSQGTIPRKMTEMEEKIQQIISNVQDLETTSPVARKLPTTPFIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGRE-----------EYRNPI---RTGNEPQMGRPTTDWNT-AIGTPRFYPQQRLRGEGFLREDNLYIKLEVEKPDKTL 4229
            + +   + R +C  C K +    + + CG R C  C  E +     KCP   + L  D      D    ++I +L I+C   E  C W G+MK+ + H + C +N I C  +C    T++ +       C KR+ KCEFCGS  E+     E    N + +C      C N C  +   +L                            + H   C   PV+CP +       +   ++  H+ +N             ++    K    +    K A+ R + ++ KS       +   ++   ++I ++   +++L  +            IWK+  ++ KLQ+AK  +     SPP Y+ + GYKL +  + NG+G+  G+H+SV++R  +  GEYD LL WPF   +  ++  +            E  NP    +   +P   R + D +T   G P+F   + ++   ++R++ ++IK  +E P K +
Sbjct:    7 KFLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCP--EDQLPLDYAKIYPDPELEQQILSLPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIPCPNRCSVKLTRRDLPDHLQHDCPKRKVKCEFCGS--EFTGEAFE----NHQGVCPQESVYCENKCGARMMRRLLSQHGMAECPKRTQPCKYCGKEFVFDTIQNHQFHCPRFPVQCPNQCGT--PNIAREDLANHVKDNC---------GSALVLCPFKDAGCKHRCPKLAIGRHLEDTTKSHLTMMCNL---VSRQRQEILELRREMEELSVSHDGV-------LIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIR--VLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSTRNSLDESTLGFGYPKFISHEEIKKRNYIRDNCIFIKASIEIPQKIM 469          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000023758.1 (SMESG000023758.1)

HSP 1 Score: 1490.32 bits (3857), Expect = 0.000e+0
Identity = 755/919 (82.15%), Postives = 816/919 (88.79%), Query Frame = 3
Query: 2784 TTSSN*RIIVHMATIIERIRGSENPSEAKRRIMKDKIRMVNDTEERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQCQVKECEWKGRMKEAENHTNECEYNEILCEKCQXXXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKDKVKLKEHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMMKTIGMIAWEVKSLQTEMDAQKALMREILESRKSFEKSQGTIPRKMTEMEEKIQQIISNVQDLETTSPVARKLPTTPFIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTGNEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEVEKPDKTL*RXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDI*MASGISEEITVQMREGPDSIWTKLWKKPDEEEKIKTLTIAIQHYSSFDSAGRPWRMREVLYSQRRVKYEQLRKEEQRYLTFKDNKVFTDRQSKEMAAQGFYFTGTPELPDEVTCIYCKGKLAKWEKGETAKREHLRKFSTCPFRINIDVRNQAMNRLEGLRQSELXXXXXXXXXXXXXXXSFEDPAELIWEKETINRTFEERIKTFKGNPRAAEFASQGYCQTARGIMCEGCKNQQPVPDQNVKKLKHKGKCMYKQEKESKXXXXXXXXXXXXXXLDRPKTRTLMLLSGVDTQKMRKIIKERLANNLEWYDSTQAVIRAIKRYQEKPKENRDKSIIKEAILEQYQCVTCWQKHVEIIYMPCGHMVTCEACGIKVDICPVCRKPINGRIKGFRFADQ 5540
             TSSN +I V M TIIERIRGSENPSE  RRIMK+KIR+VND +ERLKCCKC+ LLIGARQTKCGCRICT+CTIEVIET+TIKCPGC+E +E+DEDPTTMDKATNKEINNLLIQCQVKECEWKG MKEAE+HTNECEYNEILCEKCQTI TKKT+K+HHK+C+KREEKCEFCG IDEWIK+E EHRNP EEQICD Y G CANNC++KDKVKLKEHWNEC GKPVKCPLEL  CQ +LPI EMQKHM+ENSIEHTEIMMKTIGM+AWEVKSL+TE DAQKAL+REILESRK+FE+SQG   +KM E+E+K+QQ+ +++++LET S +ARK PT PFIWKIT FAEKLQ+AKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVF+R  +G+G+YDELLTWPFKQNMILTMKG+E+YRNPIRTGNEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLY KLE                                                 M SG SEEITVQMREGPDSIWT+LWKKP+EEEK+ TL  AI +Y  +D   RP R+ + +YSQ RV+ E+LRKEEQRYLTFKDNKVFTDRQSKEMAA+GFYFTGTPELPDEVTCIYCKGKLAKWEKGETAKREHLRKFSTCPFRINIDVRNQAMNRLEGLRQSE+D DEKGGEKKITIIKSFEDPAELIWEKETINRTFEERIKTFKGNPRAAEFASQGYCQTARGIMCEGCKNQQP+PDQNVKKLKHKGKCMYKQEKESKNIEIIITNQQIEDILDRPKTRT+MLLSGVDTQKMRKIIKERLANNLEWYDSTQAVIRAIKRYQEKPKENRDKS+IKEAILEQYQCVTCWQKHVEIIY+PCGHMVTCEACG+KV+ICPVCRKPINGRIKGFRFADQ
Sbjct: 3558 ATSSNQKIFVDMQTIIERIRGSENPSETTRRIMKNKIRVVNDIKERLKCCKCRELLIGARQTKCGCRICTDCTIEVIETQTIKCPGCDETMERDEDPTTMDKATNKEINNLLIQCQVKECEWKGLMKEAESHTNECEYNEILCEKCQTILTKKTMKEHHKVCIKREEKCEFCGVIDEWIKIEMEHRNPKEEQICDLYEGTCANNCDKKDKVKLKEHWNECSGKPVKCPLELLKCQVRLPITEMQKHMMENSIEHTEIMMKTIGMLAWEVKSLRTENDAQKALIREILESRKNFERSQGNTLKKMAEIEKKMQQMTNSLKELETNSSIARKPPTAPFIWKITEFAEKLQRAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFIR--VGRGDYDELLTWPFKQNMILTMKGQEDYRNPIRTGNEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYKKLE-------------------------------------------------MTSGTSEEITVQMREGPDSIWTRLWKKPEEEEKVNTLAAAIIYYKDYDGIRRPTRIIKAIYSQMRVRDEELRKEEQRYLTFKDNKVFTDRQSKEMAAEGFYFTGTPELPDEVTCIYCKGKLAKWEKGETAKREHLRKFSTCPFRINIDVRNQAMNRLEGLRQSEIDSDEKGGEKKITIIKSFEDPAELIWEKETINRTFEERIKTFKGNPRAAEFASQGYCQTARGIMCEGCKNQQPIPDQNVKKLKHKGKCMYKQEKESKNIEIIITNQQIEDILDRPKTRTVMLLSGVDTQKMRKIIKERLANNLEWYDSTQAVIRAIKRYQEKPKENRDKSMIKEAILEQYQCVTCWQKHVEIIYIPCGHMVTCEACGLKVNICPVCRKPINGRIKGFRFADQ 4425          

HSP 2 Score: 853.973 bits (2205), Expect = 0.000e+0
Identity = 459/573 (80.10%), Postives = 513/573 (89.53%), Query Frame = 1
Query: 5761 KEVVAEDKESKLTIKDQPEPLKEASEEVEQWKQRTMQLKEMLLIAEEELIQETLKTKMMREKWVKQIEQRITYPGGKEKTYKEREEELMKEFMQNQTRITNQRKEIRALE*DKQDQQGEIERLREIIXXXXXXXXXXXXXXXXXLNQMQEEIEQIGTQYRIEKTKRTSMEQAKEWAKRQARYWKIKWTEDREQSRSNWESRIRHYIQQIAEEEDRTRAYKAKWENAKIEINKLRNQGPKPSKKIREPRDDRQERMLTQITDQARKWRIECRILEDANAKQFNHIVKLEQEVEYKQTRIKEMQIEHDEAHRQRRIQRIKTEKKESWIKLEAGKWKDQYQEAKKEIRRLPKKLLNTEDWELWEQIEEQKHTLDDYSNQIQTLEFNERIRKNTIDRLRKTEKAHRKWIDQLNQKILETLNEQTDERRQIQQLNERITELQQEVNGHRGVVVFKEIQLRHQLEVNDQLKEQVEAEIKAIKQGYEENEQNLRKEIEKLKALENTHRLETRVEELTENTEYLAYLLDEEIQISNALREEVNMLQSRPPILLMPLYPTEMLTQVPAEPDEGFGETDEAAI 7479
            KEVV E +ESK TIKDQPE +K  +EEVE W+QRT+QLKEMLLIAEEEL+QETLKTKMM+EKW KQ+EQ+I YP G+EKTY+EREEE+MKEFMQNQTRI +QRKEIR LE +KQDQQ EIERLRE+IKDKE EI+EEGEE IKI+ QMQEEI QI TQYRIEKTKRT +EQAKEWAKRQARYWKIKWTEDRE SRSNWESRIRHYIQQIAEEEDRTRAYKAKWENAKIEINKLRNQGPKPSKKIREPRDDRQERMLTQITDQARKWRIEC+I EDANAKQ ++IVKLEQEVEY+QTR+KEMQIE DEAHR+ + Q+ KTE KE  IK EA KWK+ +QEAKKEIR L K++LN EDWELWEQ+E QK T+++ + Q+Q LEF E+IR+ TI RLR+ EK + +  +++ ++  ET N+ TDE+RQ QQLNE+ITELQQEVNGHRGV VFKEIQLRHQ EVN+QLKEQVEAEIK IKQGYEENEQNLRKEIEKLKALENTHRLE +VEELTENTEYLAYLLDEEIQISNALREE+N LQ+RPPILLMPLYPTE+LTQVPAEPDEGFGETDEAAI
Sbjct: 4434 KEVVTEAEESKPTIKDQPESIKVINEEVELWRQRTLQLKEMLLIAEEELVQETLKTKMMKEKWEKQLEQKIIYPEGEEKTYQEREEEMMKEFMQNQTRIISQRKEIRMLEQEKQDQQSEIERLREVIKDKEAEIREEGEETIKIIQQMQEEIGQISTQYRIEKTKRTHLEQAKEWAKRQARYWKIKWTEDREHSRSNWESRIRHYIQQIAEEEDRTRAYKAKWENAKIEINKLRNQGPKPSKKIREPRDDRQERMLTQITDQARKWRIECKIWEDANAKQSSYIVKLEQEVEYQQTRVKEMQIEQDEAHRKEQKQQWKTEIKEKAIKREAKKWKEHFQEAKKEIRLLLKRILNMEDWELWEQVEVQKATIEELNEQVQNLEFREKIRQGTIRRLRRHEKEYEQQFNEMYKRSAETRNQLTDEKRQNQQLNEKITELQQEVNGHRGVAVFKEIQLRHQHEVNEQLKEQVEAEIKTIKQGYEENEQNLRKEIEKLKALENTHRLEMQVEELTENTEYLAYLLDEEIQISNALREEINALQNRPPILLMPLYPTEILTQVPAEPDEGFGETDEAAI 5006          

HSP 3 Score: 387.111 bits (993), Expect = 0.000e+0
Identity = 213/239 (89.12%), Postives = 228/239 (95.40%), Query Frame = 2
Query: 7574 MNPNEIEIRMNLEDGEYVPSPIQLVEPIEQDPLRYYSKKWRAXXXXXXXXXXXXXXXIARINQQLIQSKQLANTIKRKLTSSMGENRNQKRENEQLKRELAEIKTRVILEDYWKTEAERMRDSRKSEQRYVLQLEDSCKEAREIKESHQQTQDEIKTLTEQLQEARRKLEKQTAKRINYKRQLKRKQAKERNLQMKIYNQQRVIKENKERLKELPKITERLIRAQVLIMRFSENKTKEE 8290
            MN N++EIRMNLE GE VPSPIQLVEPIEQDPLRYYSK+WRAERKEWQE+VEEQESEIARI+QQLIQSKQL N IKRKLTSSM ENRNQKRENE+L+RELAE+KTRVILEDYWKTEAERMR+SRKSEQRYVLQLEDSCKEAREIKE+HQQTQDE K LTEQLQE +RKLEKQT KR+NYKRQLKRKQ KERNLQMKIYNQQR+IKENKERLKELPK+TERLI+AQVLIMRFSENKTKEE
Sbjct: 5007 MNSNKVEIRMNLEGGECVPSPIQLVEPIEQDPLRYYSKRWRAERKEWQELVEEQESEIARIHQQLIQSKQLGNMIKRKLTSSMEENRNQKRENERLRRELAEMKTRVILEDYWKTEAERMRESRKSEQRYVLQLEDSCKEAREIKENHQQTQDEFKALTEQLQETKRKLEKQTTKRVNYKRQLKRKQTKERNLQMKIYNQQRIIKENKERLKELPKLTERLIKAQVLIMRFSENKTKEE 5245          

HSP 4 Score: 442.58 bits (1137), Expect = 2.822e-153
Identity = 248/402 (61.69%), Postives = 300/402 (74.63%), Query Frame = 1
Query: 1531 RTVTRKPPKSVTTNQPE-KETRRPPKSKTTKQSEKGVT--DSHLSIHEALQLQKSFKNVQQRGQIIXXXXXXXXXXXKPNETNYATKMIGITSAVTSIVLMLIIIQLVRTTNXXXXXXXXXRLWPAIEKFNYDIKMEQYNAERSEEYKVIGNSSTNRLWLKESPIIETPQEWSDDLDVYQITNERYGDIRTLRIEPPQTMV*NKRKRCI*CRILYNSSNSMYDYV*ILYKMHKE*ITNQKENADKLITYCNQ*MDPNNDNRQYQARIPPFVEVIQQPTASNEPIEIVELDRGIYQDQAVEVIWRRQCELMTQITNNAQAQWTNTYMVLTESVNRGLHQADRIQEQQRTILQLQRMNEQLTNQVRWQAEEIRRLRSSQQNIEPGSWVEWISTMPEFTPEPYST 2727
            RT+T+KP KS  T+Q   K+++R P+++T K   KG+   DSHLSIHEALQLQK+ KNVQ +  I+ETT  RE TT +PNE NY  KMI IT+AV S ++MLIIIQLVRTT   K+  KK RLWPA+EKFNYDI++ QY+ ER+EEY++IGNSST+ LWLKE PIIE  Q+WS++ DVYQI NE+YGDIRTLRIE P+TMV              NS  +                     NAD+L+   NQ MDPNN N+  Q RIPPF E IQQP A+N PIEIVEL++GIYQDQ +E  WRRQCELMT ITNNAQ QWTNT++VLTESVNRGL QA R++EQQRTILQLQRMNEQL +QVRWQA+EIRRLR++QQ+++P SWVEWI++MPEFTPEP ST
Sbjct: 3190 RTITKKPLKSNATDQTIIKQSKRKPRNETWK---KGMIMDDSHLSIHEALQLQKALKNVQPKEGIMETTNARENTTMQPNEKNYMIKMIWITTAVISSIVMLIIIQLVRTTKCRKKSAKK-RLWPAVEKFNYDIELGQYDVERTEEYEIIGNSSTSGLWLKEPPIIEA-QQWSNECDVYQIMNEKYGDIRTLRIESPETMV--------------NSEQTEI-------------------NADELMMCYNQQMDPNNVNQPNQVRIPPFTEGIQQPAAANVPIEIVELNQGIYQDQGIETTWRRQCELMTLITNNAQTQWTNTHLVLTESVNRGLQQAIRLEEQQRTILQLQRMNEQLADQVRWQADEIRRLRNNQQHVDPASWVEWIASMPEFTPEPDST 3553          

HSP 5 Score: 122.479 bits (306), Expect = 2.822e-153
Identity = 57/91 (62.64%), Postives = 75/91 (82.42%), Query Frame = 2
Query: 1250 TKEEPYKRRIRENKATIIKVEPNTANGEEVIVENMGEEPITRVCVYEAKKNGTVNKRIQCKSNEDVKNQRYCIPNKRKLGKYEVHIQKEKH 1522
            TKEEPY+R+IRE+KA II +E N  N EE+++EN GE+PIT++CVYE K+N  VNKRIQC++++ VKNQ+Y IP KRKLGKY ++IQK  H
Sbjct: 3096 TKEEPYQRQIRESKAVIITIESNAGNEEEILIENTGEKPITKICVYEPKRNEPVNKRIQCETSKTVKNQKYRIPTKRKLGKYVINIQKGTH 3186          

HSP 6 Score: 246.899 bits (629), Expect = 1.001e-64
Identity = 118/201 (58.71%), Postives = 159/201 (79.10%), Query Frame = 2
Query:  926 IQPEYLSSCPITKETCRDAKKEDKSIRIQVNPGIGNLQIVNIGTKEIKQI*VQDLVTDCWRMNLGK*QKCAWDSLKGDTEYIICAGNNRIITCTIARTLGEKPVIASTTKEEPYKRRIRENKATIIKVEPNTANGEEVIVENMGEEPITRVCVYEAKKNGTVNKRIQCKSNEDVKNQRYCIPNKRKLGKYEVHIQKEKHIY 1528
            I+ E  SSC  TK+ CR+A  ED++++IQV PG+G L+I+N G + I+Q+ +Q+ + DCW+MN+   +KC WDSL+G+ EYIICA N+ IITCT+A+TLGEK    +T KEEPY+RR RENK  IIKVE N  +GEE+IVENMG+EPIT+VC++E KKNGT+N+RI+C++NED+KNQ+Y IP KRK GKY VH+QK +  Y
Sbjct: 2879 IRSENSSSCQTTKDVCRNAT-EDRNVKIQVKPGLGKLRIINRGIETIEQVCIQNKIIDCWKMNMKAGKKCEWDSLEGNAEYIICANNDIIITCTLAKTLGEK---FTTPKEEPYQRRTRENKEIIIKVESNPKSGEEIIVENMGKEPITKVCIFETKKNGTINERIKCQANEDIKNQKYRIPTKRKRGKYIVHVQKGRDDY 3075          

HSP 7 Score: 62.3882 bits (150), Expect = 7.090e-9
Identity = 35/110 (31.82%), Postives = 66/110 (60.00%), Query Frame = 3
Query: 3897 LGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTM-KGRE-EYRNPIRTGNEPQ---MGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEVE 4211
            + +R+YPNGDG   G ++SV+    + +G YD  L WPF + + +++ K R+ E ++  + G +P+     +P +  N A G P+F  ++ +  + F+++D +YI +EVE
Sbjct:    1 MKLRVYPNGDGVGKGKYLSVY--FLLARGRYDGKLEWPFNRKVTISIAKPRKWEEQHSEKLGVDPRSMISQKPRSTENVAGGVPQFLLKKYITPQ-FVKDDTIYITIEVE 107          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000012882.1 (SMESG000012882.1)

HSP 1 Score: 1481.46 bits (3834), Expect = 0.000e+0
Identity = 762/919 (82.92%), Postives = 825/919 (89.77%), Query Frame = 3
Query: 2784 TTSSN*RIIVHMATIIERIRGSENPSEAKRRIMKDKIRMVNDTEERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQCQVKECEWKGRMKEAENHTNECEYNEILCEKCQXXXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKDKVKLKEHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMMKTIGMIAWEVKSLQTEMDAQKALMREILESRKSFEKSQGTIPRKMTEMEEKIQQIISNVQDLETTSPVARKLPTTPFIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTGNEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEVEKPDKTL*RXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDI*MASGISEEITVQMREGPDSIWTKLWKKPDEEEKIKTLTIAIQHYSSFDSAGRPWRMREVLYSQRRVKYEQLRKEEQRYLTFKDNKVFTDRQSKEMAAQGFYFTGTPELPDEVTCIYCKGKLAKWEKGETAKREHLRKFSTCPFRINIDVRNQAMNRLEGLRQSELXXXXXXXXXXXXXXXSFEDPAELIWEKETINRTFEERIKTFKGNPRAAEFASQGYCQTARGIMCEGCKNQQPVPDQNVKKLKHKGKCMYKQEKESKXXXXXXXXXXXXXXLDRPKTRTLMLLSGVDTQKMRKIIKERLANNLEWYDSTQAVIRAIKRYQEKPKENRDKSIIKEAILEQYQCVTCWQKHVEIIYMPCGHMVTCEACGIKVDICPVCRKPINGRIKGFRFADQ 5540
             TSSN +I V M TIIERIRGSENPSE  RRIMK+KI++VND +ERLKCCKCK LLIGARQTKCGCRICT+C IEVIETKTIKCPGC+E +E+DEDPTTMDKATNKEINNLL+QCQVKECEW+G MKEAE+H NECEY+EILCEKCQTI TKKTIK+HHK+C+KREEKCEFCG IDEWIK+E EHRNP EEQICD Y GIC NNC+RK++VKLKEHWNEC+GKP+KCPLELFNCQAQLPIMEMQKHM+ENSIEHTEIMMKTIGM+AWEVKSL+TE DAQKAL+REILESRK+FEKSQG   +KMTEME+K+QQ+ +++++LET   VA K  T PFIWKIT FAEKLQ+AKDGTQRILDSPPIYSW+NGYKLGIRLYPNGDGNATGTHISVF+R  +G+G+YDELL WPFKQNMILTMKG+E+YRNPIRTGNEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLE                                                 MASGISEEITVQMREGPDSIWT+LWKKP+EEEKIKTL IAIQHY+SFD+ GRPW+MR+V+YSQR+V+YE+LRKEEQRYLTFKDNKVFTDRQSKEMAAQGF+F+GTPELPDEVTCIYC+G+L+ WEKGETAKREHLRKFSTCPFRINIDV NQA+NRLEGLRQSELDKDEKGGEKKITIIK FEDPAELIWEKETINRTFEERIKTFKGNPRAAEFASQGYCQTARGIMCEGCKNQQP+PDQNV KLKHK KCMYKQEKESKNIEIIITNQQIEDILDRPKTRTLMLLSG+DTQKMRKIIKERLANNLEWYDSTQAVIRAIKRYQEKPKENRDKSIIKEAILEQYQCVTCWQKHVEIIY PCGHMVTCEACG+KVDICPVCRKPINGRIKGFRFAD 
Sbjct: 2638 ATSSNQKIFVDMQTIIERIRGSENPSETTRRIMKEKIKVVNDIKERLKCCKCKELLIGARQTKCGCRICTDCAIEVIETKTIKCPGCDETMERDEDPTTMDKATNKEINNLLVQCQVKECEWEGLMKEAESHANECEYSEILCEKCQTIITKKTIKEHHKVCIKREEKCEFCGVIDEWIKIEMEHRNPKEEQICDLYEGICENNCDRKERVKLKEHWNECMGKPIKCPLELFNCQAQLPIMEMQKHMMENSIEHTEIMMKTIGMLAWEVKSLRTENDAQKALIREILESRKNFEKSQGNTLKKMTEMEKKMQQMTNSLKELETNGSVAGKHLTAPFIWKITEFAEKLQRAKDGTQRILDSPPIYSWENGYKLGIRLYPNGDGNATGTHISVFIR--VGRGDYDELLAWPFKQNMILTMKGQEDYRNPIRTGNEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLE-------------------------------------------------MASGISEEITVQMREGPDSIWTRLWKKPEEEEKIKTLVIAIQHYTSFDTTGRPWKMRKVIYSQRKVRYEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVGNQAINRLEGLRQSELDKDEKGGEKKITIIKGFEDPAELIWEKETINRTFEERIKTFKGNPRAAEFASQGYCQTARGIMCEGCKNQQPIPDQNVTKLKHKRKCMYKQEKESKNIEIIITNQQIEDILDRPKTRTLMLLSGMDTQKMRKIIKERLANNLEWYDSTQAVIRAIKRYQEKPKENRDKSIIKEAILEQYQCVTCWQKHVEIIYTPCGHMVTCEACGLKVDICPVCRKPINGRIKGFRFADH 3505          

HSP 2 Score: 374.785 bits (961), Expect = 1.531e-103
Identity = 196/246 (79.67%), Postives = 212/246 (86.18%), Query Frame = 2
Query: 7574 MNPNEIEIRMNLEDGEYVPSPIQLVEPIEQDPLRYYSKKWRAXXXXXXXXXXXXXXXIARINQQLIQSKQLANTIKRKLTSSMGENRNQKRENEQLKRELAEIKTRVILEDYWKTEAERMRDSRKSEQRYVLQLEDSCKEAREIKESHQQTQDEIKTLTEQLQEARRKLEKQTAKRINYKRQLKRKQAKERNLQMKIYNQQRVIKENKERLKELPKITERLIRAQVLIMRFSENKTKEECEIHSTP 8311
            MNPNEIE R N EDGEYVPSPIQLVEPIEQDPLRYYSKKW + +K            +AR +       +L +TIKRKLTSSMG NR QKRENEQLKRELAEIKTRVILEDYWKTEAERMRDSRKSEQRYV+QLE+SCKEAREIKESHQQ Q+EIKTLT+QLQEA+RKLEKQT KR+NYKRQLKRKQ KERNLQMKI+NQQR+IKE KERLKELPK+TERLI+AQVLIMRFSENK KEECE HSTP
Sbjct: 3506 MNPNEIETRTNPEDGEYVPSPIQLVEPIEQDPLRYYSKKWESRKKG-----------MARASG----GTRLTHTIKRKLTSSMGGNREQKRENEQLKRELAEIKTRVILEDYWKTEAERMRDSRKSEQRYVIQLENSCKEAREIKESHQQAQEEIKTLTDQLQEAKRKLEKQTTKRVNYKRQLKRKQTKERNLQMKIHNQQRIIKEGKERLKELPKLTERLIKAQVLIMRFSENKIKEECERHSTP 3736          

HSP 3 Score: 217.238 bits (552), Expect = 8.057e-74
Identity = 131/202 (64.85%), Postives = 162/202 (80.20%), Query Frame = 1
Query: 1528 LRTVTRKPPKSVTTNQP-EKETRRPPKSKTTKQSEKGVT--DSHLSIHEALQLQKSFKNVQQRGQIIXXXXXXXXXXXKPNETNYATKMIGITSAVTSIVLMLIIIQLVRTTNXXXXXXXXXRLWPAIEKFNYDIKMEQYNAERSEEYKVIGNSSTNRLWLKESPIIETPQEWSDDLDVYQITNERYGDIRTLRIEPPQTMV 2124
             RT+TRKP KS  T+QP  K++ R P+++T K   KG+   DSHLSIHEALQLQK+ KNVQ + +I+ETT  RE TT +PNE NY  KMI IT+AV S V+MLI+IQLVRTT  C++KP KKRLWPA+EKFNYDI++ QY+AE +EEY++IGNSST+ LWLKE PIIE  Q+WS++ DVYQI NE+YGDIRTLRIE P+TMV
Sbjct: 2289 CRTITRKPLKSNATDQPITKQSERKPRNETWK---KGMIMDDSHLSIHEALQLQKALKNVQPKERIMETTNARENTTMQPNEKNYMIKMIWITTAVISSVVMLIVIQLVRTTK-CRKKPAKKRLWPAVEKFNYDIELGQYDAEGTEEYEIIGNSSTSGLWLKEPPIIEA-QQWSNESDVYQIMNEKYGDIRTLRIESPETMV 2485          

HSP 4 Score: 83.1889 bits (204), Expect = 8.057e-74
Identity = 43/91 (47.25%), Postives = 61/91 (67.03%), Query Frame = 2
Query: 1250 TKEEPYKRRIRENKATIIKVEPNTANGEEVIVENMGEEPITRVCVYEAKKNGTVNKRIQCKSNEDVKNQRYCIPNKRKLGKYEVHIQKEKH 1522
            TKE+PY+R+IRE+KA II +E N  N EE+++EN                  TVNKRIQC++++++ N++Y IP KRKLGKY ++IQK  H
Sbjct: 2214 TKEKPYQRQIRESKAVIINIESNAVNEEEIVIEN------------------TVNKRIQCETSKNITNRKYRIPTKRKLGKYVINIQKGTH 2286          

HSP 5 Score: 242.662 bits (618), Expect = 7.468e-65
Identity = 116/201 (57.71%), Postives = 157/201 (78.11%), Query Frame = 2
Query:  926 IQPEYLSSCPITKETCRDAKKEDKSIRIQVNPGIGNLQIVNIGTKEIKQI*VQDLVTDCWRMNLGK*QKCAWDSLKGDTEYIICAGNNRIITCTIARTLGEKPVIASTTKEEPYKRRIRENKATIIKVEPNTANGEEVIVENMGEEPITRVCVYEAKKNGTVNKRIQCKSNEDVKNQRYCIPNKRKLGKYEVHIQKEKHIY 1528
            I+ E  SSC  TK+ CRDA K D++++IQV PGIG L+I+N G + I+Q+ +Q+ + DCW+MN+   +KC WDSL+G  EYIICA N+ IITCT+A+TLGEK    +T KEEPY+RR RENK  IIK+E +  +GEE+IVENMG+EPIT+VC++E KKNGT+N+RI+C+SN+D+ NQ+Y IP KRK GKY VH+Q+ +  Y
Sbjct: 1997 IRSENSSSCQTTKDVCRDATK-DRNVKIQVEPGIGKLRIINRGIETIEQVCIQNKIIDCWKMNMKAGKKCEWDSLEGKAEYIICANNDIIITCTLAKTLGEK---FTTPKEEPYQRRARENKEIIIKLEADPKSGEEIIVENMGKEPITKVCIFETKKNGTINERIKCQSNDDINNQKYRIPTKRKRGKYIVHVQRGRDDY 2193          

HSP 6 Score: 27.7202 bits (60), Expect = 7.468e-65
Identity = 13/33 (39.39%), Postives = 23/33 (69.70%), Query Frame = 1
Query: 1531 RTVTRKPPKSVTTNQPEKETRRPPKSKTTKQSE 1629
            +++TRK  +SVTT + EKET+  P  +  ++S+
Sbjct: 2195 KSITRKLLESVTTKRSEKETKEKPYQRQIRESK 2227          

HSP 7 Score: 231.876 bits (590), Expect = 3.975e-60
Identity = 108/141 (76.60%), Postives = 128/141 (90.78%), Query Frame = 1
Query: 2311 QARIPPFVEVIQQPTASNEPIEIVELDRGIYQDQAVEVIWRRQCELMTQITNNAQAQWTNTYMVLTESVNRGLHQADRIQEQQRTILQLQRMNEQLTNQVRWQAEEIRRLRSSQQNIEPGSWVEWISTMPEFTPEPYSTED 2733
            Q RIPPFVEVIQQP A+N PIEIVEL++GI+QDQ +E  WRRQCELMT ITNNAQ QWTNT++VLTESVNRGL QA R++EQQRTILQL+R+NEQLT+QVRWQA+EIRRLR++QQ+++P SWVEWI++MPEFTPEP ST D
Sbjct: 2496 QVRIPPFVEVIQQPAAANVPIEIVELNQGIHQDQGIEATWRRQCELMTLITNNAQTQWTNTHLVLTESVNRGLQQAIRLEEQQRTILQLERINEQLTDQVRWQADEIRRLRNNQQHVDPASWVEWIASMPEFTPEPDSTVD 2636          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000074160.1 (SMESG000074160.1)

HSP 1 Score: 1451.8 bits (3757), Expect = 0.000e+0
Identity = 732/901 (81.24%), Postives = 800/901 (88.79%), Query Frame = 3
Query: 2784 TTSSN*RIIVHMATIIERIRGSENPSEAKRRIMKDKIRMVNDTEERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQCQVKECEWKGRMKEAENHTNECEYNEILCEKCQXXXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKDKVKLKEHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMMKTIGMIAWEVKSLQTEMDAQKALMREILESRKSFEKSQGTIPRKMTEMEEKIQQIISNVQDLETTSPVARKLPTTPFIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTGNEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEVEKPDKTL*RXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDI*MASGISEEITVQMREGPDSIWTKLWKKPDEEEKIKTLTIAIQHYSSFDSAGRPWRMREVLYSQRRVKYEQLRKEEQRYLTFKDNKVFTDRQSKEMAAQGFYFTGTPELPDEVTCIYCKGKLAKWEKGETAKREHLRKFSTCPFRINIDVRNQAMNRLEGLRQSELXXXXXXXXXXXXXXXSFEDPAELIWEKETINRTFEERIKTFKGNPRAAEFASQGYCQTARGIMCEGCKNQQPVPDQNVKKLKHKGKCMYKQEKESKXXXXXXXXXXXXXXLDRPKTRTLMLLSGVDTQKMRKIIKERLANNLEWYDSTQAVIRAIKRYQEKPKENRDKSIIKEAILEQYQCVTCWQKHVEIIYMPCGHMVTCEACGIKVDICP 5486
             T SN +I V M TIIERIRGSENPSE  RRIMK+KIRMVND +ERLKCCKCK LLIGARQTKCGCRICT+CTIEVIET+TIKCPGC+EIL++DEDPTTMDKATNKEINNL IQCQVKECEWKG MKEAE+H NECEYNEILCEKCQT  TKKT+K+HH++C+KREEKCEFCG IDEWIK+E EHRN  EEQICD Y GIC NNC+++DKVKLKEHWNECIGKPVKCPLELFNCQ QLPI EMQKHMIENSIEHTEI+MKTIGM+AWEVKSL+TE D+QKA++REILESRK+FEKSQG   +K+ E+E+K+QQ+ +++++LET S VA K  T PFIWKIT FAEKLQ+AKDGTQRILDSPPIYSW+NGYKLG+RLYPNGDGNATGT+ISVF+R  +G+G+YDELL WPFKQNMILTMKG+E+YRNPIRTGNEPQMGRPTTDWNTAIG PRFYPQQRLRGEGFLREDNLYIKLE                                                 MASGI EEI VQMREGPDSIWT+LWKKP+EEE+IKTL IAIQHY+SFD+ GRPW+MR+V+YSQRRV+YE+LRKEEQRYLTFKDNKVFTDRQSKEMAAQGF+F+GTPELPDEVTCIYC+G+L+ WEKGETAKREHLRKFSTCPFRINIDV NQA+NRLEGLRQSE+D DEKGGEKKITIIK+FEDP ELIWEKETINRTFEER+KTFKGNPRAAEFASQGYCQTARGIMCEGCKNQQP+PDQNVKKLKHK KCMYKQEKESKNIEIIITNQQIEDILDRPKTRT+MLLSGVDTQKMRKIIKERLANNLEWYDSTQAVIRAIKRYQEKPKENRDKSIIKEAILEQYQCVTCWQKHVEIIY P GHMVTCEACGIKV+ICP
Sbjct: 4098 ATLSNLKIFVDMQTIIERIRGSENPSETTRRIMKNKIRMVNDIKERLKCCKCKELLIGARQTKCGCRICTDCTIEVIETETIKCPGCDEILKRDEDPTTMDKATNKEINNLSIQCQVKECEWKGLMKEAESHANECEYNEILCEKCQTSATKKTMKEHHQVCIKREEKCEFCGVIDEWIKIEMEHRNLKEEQICDLYEGICTNNCDKRDKVKLKEHWNECIGKPVKCPLELFNCQIQLPIAEMQKHMIENSIEHTEIIMKTIGMLAWEVKSLRTENDSQKAIIREILESRKNFEKSQGNTLKKIVEIEKKMQQMTNSLKELETNSSVAGKHLTAPFIWKITEFAEKLQRAKDGTQRILDSPPIYSWENGYKLGLRLYPNGDGNATGTYISVFIR--VGRGDYDELLAWPFKQNMILTMKGQEDYRNPIRTGNEPQMGRPTTDWNTAIGIPRFYPQQRLRGEGFLREDNLYIKLE-------------------------------------------------MASGIGEEIMVQMREGPDSIWTRLWKKPEEEERIKTLAIAIQHYTSFDTTGRPWKMRKVIYSQRRVRYEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVGNQAINRLEGLRQSEIDSDEKGGEKKITIIKNFEDPTELIWEKETINRTFEERMKTFKGNPRAAEFASQGYCQTARGIMCEGCKNQQPIPDQNVKKLKHKRKCMYKQEKESKNIEIIITNQQIEDILDRPKTRTIMLLSGVDTQKMRKIIKERLANNLEWYDSTQAVIRAIKRYQEKPKENRDKSIIKEAILEQYQCVTCWQKHVEIIYTPWGHMVTCEACGIKVNICP 4947          

HSP 2 Score: 919.457 bits (2375), Expect = 0.000e+0
Identity = 490/594 (82.49%), Postives = 534/594 (89.90%), Query Frame = 1
Query: 5701 IDINI-QKTVINLIETKTQLIKEVVAEDKESKLTIKDQPEPLKEASEEVEQWKQRTMQLKEMLLIAEEELIQETLKTKMMREKWVKQIEQRITYPGGKEKTYKEREEELMKEFMQNQTRITNQRKEIRALE*DKQDQQGEIERLREIIXXXXXXXXXXXXXXXXXLNQMQEEIEQIGTQYRIEKTKRTSMEQAKEWAKRQARYWKIKWTEDREQSRSNWESRIRHYIQQIAEEEDRTRAYKAKWENAKIEINKLRNQGPKPSKKIREPRDDRQERMLTQITDQARKWRIECRILEDANAKQFNHIVKLEQEVEYKQTRIKEMQIEHDEAHRQRRIQRIKTEKKESWIKLEAGKWKDQYQEAKKEIRRLPKKLLNTEDWELWEQIEEQKHTLDDYSNQIQTLEFNERIRKNTIDRLRKTEKAHRKWIDQLNQKILETLNEQTDERRQIQQLNERITELQQEVNGHRGVVVFKEIQLRHQLEVNDQLKEQVEAEIKAIKQGYEENEQNLRKEIEKLKALENTHRLETRVEELTENTEYLAYLLDEEIQISNALREEVNMLQSRPPILLMPLYPTEMLTQVPAEPDEGFGETDEAAI 7479
            I +NI  KT++N  ETK     EVV E +ESK  IKDQPE +K  SEEVE W+QRT+QLKEMLLIAEEEL+QETLKTKMM+EKW KQ+EQ+I YP GKEKTY+EREEE+MKEFMQNQTRI NQRKEI+ LE +KQDQQ EIE+LRE+IKDKE EI+EEGEE IKI+ QMQEEI QI TQYRIEKTKRT MEQAKEWAKRQARYWKIKWTEDREQSRSNWESRIRHYIQQIAEEEDRTRAYKAKWENAKIEINKLRNQGPKP+KKIREPRDDRQERMLTQITDQARKWRIECRI EDANAKQ N+IVKLEQE+ YKQTRIKEMQIE DEAHRQRRIQRIKTEKKE WIK EA +WK+QYQEAKKEIR LPKK+LN EDWELWEQ+E QK T+++ + +IQT+E++ER R+NTI RLRKT+K  RKWIDQLNQKI E L+EQTDERRQIQQLNERITELQQEVNGHRGV VFKEIQLRHQ EVN+QLKEQVE EIK +KQGYEENEQNLRKEIEKLKALENTHRLE +VEELTEN EYLAYLLDEEIQISNALREE+N LQ+RPPILLMPLYPTE+ TQVPAEPDEGFGETDE  +
Sbjct: 4941 IKVNICPKTIMNPNETK-----EVVKEAEESKPAIKDQPESIKVTSEEVELWRQRTLQLKEMLLIAEEELMQETLKTKMMKEKWEKQLEQKIIYPEGKEKTYQEREEEMMKEFMQNQTRIKNQRKEIQTLEQEKQDQQSEIEKLREVIKDKEAEIREEGEETIKIIQQMQEEIGQISTQYRIEKTKRTHMEQAKEWAKRQARYWKIKWTEDREQSRSNWESRIRHYIQQIAEEEDRTRAYKAKWENAKIEINKLRNQGPKPAKKIREPRDDRQERMLTQITDQARKWRIECRIFEDANAKQSNYIVKLEQEIAYKQTRIKEMQIEQDEAHRQRRIQRIKTEKKEKWIKSEARRWKNQYQEAKKEIRLLPKKILNMEDWELWEQVEVQKETIEELNEEIQTMEYHERARQNTIRRLRKTDKDLRKWIDQLNQKISEILHEQTDERRQIQQLNERITELQQEVNGHRGVAVFKEIQLRHQHEVNEQLKEQVEVEIKTMKQGYEENEQNLRKEIEKLKALENTHRLEMQVEELTENAEYLAYLLDEEIQISNALREEINTLQNRPPILLMPLYPTEIPTQVPAEPDEGFGETDETIV 5529          

HSP 3 Score: 408.297 bits (1048), Expect = 0.000e+0
Identity = 223/243 (91.77%), Postives = 234/243 (96.30%), Query Frame = 2
Query: 7562 CIFSMNPNEIEIRMNLEDGEYVPSPIQLVEPIEQDPLRYYSKKWRAXXXXXXXXXXXXXXXIARINQQLIQSKQLANTIKRKLTSSMGENRNQKRENEQLKRELAEIKTRVILEDYWKTEAERMRDSRKSEQRYVLQLEDSCKEAREIKESHQQTQDEIKTLTEQLQEARRKLEKQTAKRINYKRQLKRKQAKERNLQMKIYNQQRVIKENKERLKELPKITERLIRAQVLIMRFSENKTKEE 8290
            CIFSMN N+IEIRMNLEDG+ +PSPIQLVEPIEQDPLRYYSK+WRAERKEWQE+VEEQ+SEIARINQQLIQSKQL N IKRKLTSSMGEN NQKRENE+L+RELAEIKTRVILEDYWKTEAERMRDSRKSEQRYV+QLEDSCKEAREIKE+HQQ QDEIK LTEQLQEARRKLEKQTAKRIN KRQLKRKQ KERNLQMKIYNQQRVIKENKERLKELPKITERLI+AQVLIMRFSENKTKEE
Sbjct: 5531 CIFSMNSNKIEIRMNLEDGKCIPSPIQLVEPIEQDPLRYYSKRWRAERKEWQELVEEQDSEIARINQQLIQSKQLVNMIKRKLTSSMGENGNQKRENERLRRELAEIKTRVILEDYWKTEAERMRDSRKSEQRYVIQLEDSCKEAREIKENHQQAQDEIKALTEQLQEARRKLEKQTAKRINSKRQLKRKQTKERNLQMKIYNQQRVIKENKERLKELPKITERLIKAQVLIMRFSENKTKEE 5773          

HSP 4 Score: 416.001 bits (1068), Expect = 5.023e-144
Identity = 245/402 (60.95%), Postives = 297/402 (73.88%), Query Frame = 1
Query: 1531 RTVTRKPPKSVTTNQPE-KETRRPPKSKTTKQSEKGVT--DSHLSIHEALQLQKSFKNVQQRGQIIXXXXXXXXXXXKPNETNYATKMIGITSAVTSIVLMLIIIQLVRTTNXXXXXXXXXRLWPAIEKFNYDIKMEQYNAERSEEYKVIGNSSTNRLWLKESPIIETPQEWSDDLDVYQITNERYGDIRTLRIEPPQTMV*NKRKRCI*CRILYNSSNSMYDYV*ILYKMHKE*ITNQKENADKLITYCNQ*MDPNNDNRQYQARIPPFVEVIQQPTASNEPIEIVELDRGIYQDQAVEVIWRRQCELMTQITNNAQAQWTNTYMVLTESVNRGLHQADRIQEQQRTILQLQRMNEQLTNQVRWQAEEIRRLRSSQQNIEPGSWVEWISTMPEFTPEPYST 2727
            RT+TRKP KS  T+QP  K++ R  +++T K   KG+   DSHLSIHEALQLQK+ KNVQ +  I+ETT  RE TT +PNE NY  KMI IT+AV S V+MLIIIQLVRTT   K+  K+ RLWPA+EKFNYDI++  Y+AER+EEY++IGNSST+ LWLKE PIIE  Q+W ++ DVYQITNE+YGDIRTLRIE P+TMV +K+                                    N D+L    NQ M+PNN N+Q Q RIPPFVE IQQP A+N PIEI EL++GIYQD  +E  WRRQCELMT ITNNAQ QWTNT++VLTESVNRGL QA R++EQQRTILQLQR+NEQL +QVRWQA+EIRRLR++QQ+++P SWVEWI++MPEFTPEP ST
Sbjct: 3730 RTITRKPLKSNATDQPIIKQSGRKTRNETWK---KGMIMDDSHLSIHEALQLQKALKNVQPKEGIMETTNARENTTRQPNEKNYMIKMIWITTAVISSVVMLIIIQLVRTTKCRKKSTKR-RLWPAVEKFNYDIELGPYDAERAEEYEIIGNSSTSGLWLKEPPIIEA-QQWPNEFDVYQITNEKYGDIRTLRIESPETMVNSKQTEM---------------------------------NTDELTMCYNQQMNPNNANQQNQVRIPPFVEGIQQPAAANVPIEIAELNQGIYQDPGIEATWRRQCELMTLITNNAQTQWTNTHLVLTESVNRGLQQAIRLEEQQRTILQLQRINEQLADQVRWQADEIRRLRNNQQHVDPASWVEWIASMPEFTPEPDST 4093          

HSP 5 Score: 118.242 bits (295), Expect = 5.023e-144
Identity = 54/91 (59.34%), Postives = 75/91 (82.42%), Query Frame = 2
Query: 1250 TKEEPYKRRIRENKATIIKVEPNTANGEEVIVENMGEEPITRVCVYEAKKNGTVNKRIQCKSNEDVKNQRYCIPNKRKLGKYEVHIQKEKH 1522
            TKEEPY+R+IRE++A II +E N AN EE+++EN GE+PIT++CVYE K+N  VNKRIQC++++ + N++Y IP KRKLGKY ++IQK  H
Sbjct: 3636 TKEEPYQRQIRESEAVIINIESNAANEEEIVIENTGEKPITKICVYEPKRNEPVNKRIQCETSKTITNRKYRIPTKRKLGKYVINIQKGTH 3726          

HSP 6 Score: 249.595 bits (636), Expect = 1.658e-65
Identity = 121/201 (60.20%), Postives = 159/201 (79.10%), Query Frame = 2
Query:  926 IQPEYLSSCPITKETCRDAKKEDKSIRIQVNPGIGNLQIVNIGTKEIKQI*VQDLVTDCWRMNLGK*QKCAWDSLKGDTEYIICAGNNRIITCTIARTLGEKPVIASTTKEEPYKRRIRENKATIIKVEPNTANGEEVIVENMGEEPITRVCVYEAKKNGTVNKRIQCKSNEDVKNQRYCIPNKRKLGKYEVHIQKEKHIY 1528
            I+ E  SSC  TK+ CRDA K DK+++IQV PGIG L+I+N G + I+Q+ +Q+ + DCW+MN+   +KC WDSL+G+ EYIICA N+ IITCT+A+TLGEK    +T KEEPY+RR RENK  IIKVE +  +GEE+IVENMG+EPIT+VCV+E KKNGT+N+RI+C++NED+KNQ+Y IP KRK GKY VH+QK +  Y
Sbjct: 3419 IRSENSSSCQTTKDVCRDATK-DKNVKIQVKPGIGKLRIINRGIETIEQVCIQNKIIDCWKMNMKAGKKCEWDSLEGNAEYIICANNDIIITCTLAKTLGEK---FTTPKEEPYQRRARENKEIIIKVESDPKSGEEIIVENMGKEPITKVCVFETKKNGTINERIKCQANEDIKNQKYRIPTKRKRGKYIVHVQKGRDDY 3615          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000073574.1 (SMESG000073574.1)

HSP 1 Score: 1447.95 bits (3747), Expect = 0.000e+0
Identity = 737/910 (80.99%), Postives = 810/910 (89.01%), Query Frame = 3
Query: 2811 VHMATIIERIRGSENPSEAKRRIMKDKIRMVNDTEERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQCQVKECEWKGRMKEAENHTNECEYNEILCEKCQXXXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKDKVKLKEHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMMKTIGMIAWEVKSLQTEMDAQKALMREILESRKSFEKSQGTIPRKMTEMEEKIQQIISNVQDLETTSPVARKLPTTPFIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTGNEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEVEKPDKTL*RXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDI*MASGISEEITVQMREGPDSIWTKLWKKPDEEEKIKTLTIAIQHYSSFDSAGRPWRMREVLYSQRRVKYEQLRKEEQRYLTFKDNKVFTDRQSKEMAAQGFYFTGTPELPDEVTCIYCKGKLAKWEKGETAKREHLRKFSTCPFRINIDVRNQAMNRLEGLRQSELXXXXXXXXXXXXXXXSFEDPAELIWEKETINRTFEERIKTFKGNPRAAEFASQGYCQTARGIMCEGCKNQQPVPDQNVKKLKHKGKCMYKQEKESKXXXXXXXXXXXXXXLDRPKTRTLMLLSGVDTQKMRKIIKERLANNLEWYDSTQAVIRAIKRYQEKPKENRDKSIIKEAILEQYQCVTCWQKHVEIIYMPCGHMVTCEACGIKVDICPVCRKPINGRIKGFRFADQ 5540
             +M TIIERIRGSENPSE  RRIMK+KIRMVND +ERLKCCKCK LLIGARQTKCGCRICT+CTIEVIETKTIKCPGC+E +E+DEDPTTMDKATNKEINNLL+QC+VKECEWKG MKEAE+H NECEYNEILCEKCQT  TKKT+K+HHK+C+KREEKCEFCG IDEWIK+E EHRNP EEQICD Y GICANNC++KDKVKLKEHWNEC GKPVKCPLELFNCQ QLPI EMQKHMIENSIEHTEIMMKTIGM+AWEVKSL+TE DAQKAL++EILESRK+ E+SQG   +KM E E+K+Q++ +++++LET   +A K  T PFIWKIT FAEKLQ+AKDGTQRILDSPPIYSW+NGYKLGIRLYPNGDGNATGTHISVF+R  + +G+YDELLTWPFKQNMILTMKG+E+YRNPIRTGNEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIK+   +  + + +K++                                    MA+GISEEI +QMREGPDSIWT+LWKKP+EEEK+ TL  AI +Y  +D   RP ++ + +YSQ RV+ E+LRKEEQRYLTFKDNKVFT+RQS+EMAAQGFYFTGTPELPDEVTCIYCKGKLAKWEKGETAKREHLRKF TCPFRINIDVRNQAMNRLEG+RQSE+D DEKGGEKKITIIK+FEDPAELIWEKETINRTFEERIKTFKGNPRAAEFASQGYCQTARGIMCEGCKNQQP+PDQNVKKLKHKGKCMYKQEKESKNIEIIITNQQIEDILDRPKTRT+MLLSGVDTQKMRKII+ERLANNLEWYDSTQA+IRAIKRYQ KPKENR+KSIIKEAILEQYQCVTCWQ+HVEIIY PCGHMVTCEACGIKVDICPVCRKPINGRIKGFRFADQ
Sbjct: 1022 ANMQTIIERIRGSENPSETTRRIMKNKIRMVNDIKERLKCCKCKELLIGARQTKCGCRICTDCTIEVIETKTIKCPGCDETIERDEDPTTMDKATNKEINNLLVQCRVKECEWKGFMKEAESHANECEYNEILCEKCQTSATKKTMKEHHKVCIKREEKCEFCGVIDEWIKIEMEHRNPKEEQICDLYEGICANNCDKKDKVKLKEHWNECSGKPVKCPLELFNCQTQLPITEMQKHMIENSIEHTEIMMKTIGMLAWEVKSLRTENDAQKALIKEILESRKNLERSQGDTLKKMVETEKKMQKMTNSLKELETNGSIAGKHLTAPFIWKITEFAEKLQRAKDGTQRILDSPPIYSWENGYKLGIRLYPNGDGNATGTHISVFIR--VRRGDYDELLTWPFKQNMILTMKGQEDYRNPIRTGNEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKIRSGEARQDVVKKKES-----------------------------------MANGISEEIMIQMREGPDSIWTRLWKKPEEEEKVNTLAAAIIYYKDYDGTRRPTQVIKAIYSQMRVRDEELRKEEQRYLTFKDNKVFTERQSQEMAAQGFYFTGTPELPDEVTCIYCKGKLAKWEKGETAKREHLRKFPTCPFRINIDVRNQAMNRLEGIRQSEIDSDEKGGEKKITIIKNFEDPAELIWEKETINRTFEERIKTFKGNPRAAEFASQGYCQTARGIMCEGCKNQQPIPDQNVKKLKHKGKCMYKQEKESKNIEIIITNQQIEDILDRPKTRTIMLLSGVDTQKMRKIIQERLANNLEWYDSTQAIIRAIKRYQGKPKENREKSIIKEAILEQYQCVTCWQRHVEIIYTPCGHMVTCEACGIKVDICPVCRKPINGRIKGFRFADQ 1894          

HSP 2 Score: 202.601 bits (514), Expect = 3.269e-81
Identity = 123/200 (61.50%), Postives = 153/200 (76.50%), Query Frame = 1
Query: 1531 RTVTRKPPKSVTTNQPEKETRRPPKSKTTKQSEKGVT--DSHLSIHEALQLQKSFKNVQQRGQIIXXXXXXXXXXXKPNETNYATKMIGITSAVTSIVLMLIIIQLVRTTNXXXXXXXXXRLWPAIEKFNYDIKMEQYNAERSEEYKVIGNSSTNRLWLKESPIIETPQEWSDDLDVYQITNERYGDIRTLRIEPPQTMV 2124
            RT+TRKP KS  T+QP     +P + K+ +  +KG+   DSHLSIHEALQLQK+ KNVQ +  I+ETT  RE TT +PNE +Y  KMI IT+AV S V+MLIIIQL RTT   K+  KK RLWPA+EKFNYDI++ QY+AER+EEY++I NSST+ LWLKE PIIE  Q+WS++ DVYQI NE+YGDIRTLRI  P+TM+
Sbjct:  700 RTITRKPLKSNATDQP---IIKPLEGKS-ETWKKGMIMDDSHLSIHEALQLQKALKNVQPKEGIMETTNARENTTMQPNEKSYMIKMIWITTAVISSVVMLIIIQLARTTKCKKKPAKK-RLWPAVEKFNYDIELGQYDAERTEEYEIIRNSSTSGLWLKEPPIIEA-QQWSNESDVYQIMNEKYGDIRTLRIGSPETMM 893          

HSP 3 Score: 122.094 bits (305), Expect = 3.269e-81
Identity = 56/91 (61.54%), Postives = 77/91 (84.62%), Query Frame = 2
Query: 1250 TKEEPYKRRIRENKATIIKVEPNTANGEEVIVENMGEEPITRVCVYEAKKNGTVNKRIQCKSNEDVKNQRYCIPNKRKLGKYEVHIQKEKH 1522
            T+E+PY+R+IRE+KA II +E N AN EE+++EN GE+PIT++CVYE K+N  VNKRIQC+++E++KNQ+Y IP KRKLGKY ++IQK  H
Sbjct:  606 TREQPYQRQIRESKAVIINIESNAANEEEIVIENTGEKPITKICVYEPKRNEPVNKRIQCETSENIKNQKYRIPTKRKLGKYVINIQKGTH 696          

HSP 4 Score: 190.66 bits (483), Expect = 8.334e-48
Identity = 91/119 (76.47%), Postives = 107/119 (89.92%), Query Frame = 1
Query: 2317 RIPPFVEVIQQPTASNEPIEIVELDRGIYQDQAVEVIWRRQCELMTQITNNAQAQWTNTYMVLTESVNRGLHQADRIQEQQRTILQLQRMNEQLTNQVRWQAEEIRRLRSSQQNIEPGS 2673
            RIPPFVE IQQP A+N PIEIVEL++GIYQDQ VE  WRRQCELMT ITNNAQ QWTNT++VLTESVNRGL QA R++EQQRTILQLQR+NEQLT+QVRWQA+EIRRLR++ Q+++P +
Sbjct:  905 RIPPFVEGIQQPAAANVPIEIVELNQGIYQDQGVEATWRRQCELMTLITNNAQTQWTNTHLVLTESVNRGLQQAIRLEEQQRTILQLQRINEQLTDQVRWQADEIRRLRNNHQHVDPAN 1023          

HSP 5 Score: 96.6709 bits (239), Expect = 3.301e-22
Identity = 46/80 (57.50%), Postives = 65/80 (81.25%), Query Frame = 2
Query: 1289 KATIIKVEPNTANGEEVIVENMGEEPITRVCVYEAKKNGTVNKRIQCKSNEDVKNQRYCIPNKRKLGKYEVHIQKEKHIY 1528
            KA IIK   +  +GEE+IVEN+G+EPIT+VC++E KKNGT+N+R++C+SN+D+KNQ+Y I  KRK GKY VH+Q+ +  Y
Sbjct:  507 KARIIK-NHDPKSGEEIIVENVGKEPITKVCIFETKKNGTINERVKCQSNDDIKNQKYRITTKRKRGKYIVHVQRGRDDY 585          

HSP 6 Score: 30.4166 bits (67), Expect = 3.301e-22
Identity = 14/33 (42.42%), Postives = 24/33 (72.73%), Query Frame = 1
Query: 1531 RTVTRKPPKSVTTNQPEKETRRPPKSKTTKQSE 1629
            +++TRK  +S+TT +PEKETR  P  +  ++S+
Sbjct:  587 KSITRKLLESITTKRPEKETREQPYQRQIRESK 619          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000016682.1 (SMESG000016682.1)

HSP 1 Score: 1421.37 bits (3678), Expect = 0.000e+0
Identity = 732/907 (80.71%), Postives = 797/907 (87.87%), Query Frame = 3
Query: 2820 ATIIERIRGSENPSEAKRRIMKDKIRMVNDTEERLKCCKCKGLLIGARQTKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNLLIQCQVKECEWKGRMKEAENHTNECEYNEILCEKCQXXXXXXXXXXXXXXCVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*GICANNCNRKDKVKLKEHWNECIGKPVKCPLELFNCQAQLPIMEMQKHMIENSIEHTEIMMKTIGMIAWEVKSLQTEMDAQKALMREILESRKSFEKSQGTIPRKMTEMEEKIQQIISNVQDLETTSPVARKLPTTPFIWKITGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTGNEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEVEKPDKTL*RXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDI*MASGISEEITVQMREGPDSIWTKLWKKPDEEEKIKTLTIAIQHYSSFDSAGRPWRMREVLYSQRRVKYEQLRKEEQRYLTFKDNKVFTDRQSKEMAAQGFYFTGTPELPDEVTCIYCKGKLAKWEKGETAKREHLRKFSTCPFRINIDVRNQAMNRLEGLRQSELXXXXXXXXXXXXXXXSFEDPAELIWEKETINRTFEERIKTFKGNPRAAEFASQGYCQTARGIMCEGCKNQQPVPDQNVKKLKHKGKCMYKQEKESKXXXXXXXXXXXXXXLDRPKTRTLMLLSGVDTQKMRKIIKERLANNLEWYDSTQAVIRAIKRYQEKPKENRDKSIIKEAILEQYQCVTCWQKHVEIIYMPCGHMVTCEACGIKVDICPVCRKPINGRIKGFRFADQ 5540
             TIIERIR SENPSE  RRIMK+KIRMVND +ERLKCCKCK LLIGARQTKCGCRICT+CTIEVIET+TIKCPGC+E +E+DEDPTTMDKATNKEINNLL+QC+VKECEWKG MKEAENH NECEYNEILCEKCQTITTKKTIKDHHKIC+KREEKCEFCG IDEWIK+E +HRNP EEQICD Y G+CANNC++KDKVKLKEHWNEC GKPVKCPLELFNCQ QLP+ EMQKHM+ENSIEHTEIMMKTIGM+AWEVKSL+TE DAQKA++REILESRK+FEKSQG   +KM EME+K+QQ+ +N+++LET + +ARK  T PFIWKIT FAEKLQ+AKDGTQRILDSPPIYSW+NGYKLGIRLYPNGDGNATGTHISVF+R  +G+G+YDELLTWPFKQNMILTMKG+E+YRNPIRTGNEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLE                                                 MASGISEEIT+Q+REG DSIWT+LWKKP+EEEK   LT AI +Y+ FD   RP ++R  +Y   RVK E LRKEEQRYLTFKDNKVFTD+QSKEMAAQGFYFTGTPE PDEVTCI+C+GKLA+W+KGETAKREH  K   CPF +N+DVRNQ MNR EGLRQSE DKDEKGGEKKITIIK+FEDP ELIWEKETINRTFEERIKTFKGNPRAAEFASQGYCQTARGIMCEGCKNQQP+PD+NVK+LKHKGKCMYKQEKESKNIEIIITNQQIEDILDRPKTRT+MLLSGVDTQKMRKII+ERLANNLEWYDSTQA+IRAIKRYQEKPKENR+KSIIKEAILEQYQCVTCWQKHVEIIYMPCGHMVTCEACGIKV+ICPVCRK INGRIKGFRFADQ
Sbjct: 1353 TTIIERIRRSENPSETTRRIMKNKIRMVNDIKERLKCCKCKELLIGARQTKCGCRICTDCTIEVIETQTIKCPGCDETIERDEDPTTMDKATNKEINNLLVQCRVKECEWKGLMKEAENHANECEYNEILCEKCQTITTKKTIKDHHKICIKREEKCEFCGVIDEWIKIEMQHRNPKEEQICDRYEGVCANNCDKKDKVKLKEHWNECSGKPVKCPLELFNCQTQLPMAEMQKHMMENSIEHTEIMMKTIGMLAWEVKSLRTENDAQKAIIREILESRKNFEKSQGDTLKKMVEMEKKMQQMTNNIKELETNNSIARKYLTAPFIWKITEFAEKLQRAKDGTQRILDSPPIYSWENGYKLGIRLYPNGDGNATGTHISVFIR--VGRGDYDELLTWPFKQNMILTMKGQEDYRNPIRTGNEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLE-------------------------------------------------MASGISEEITIQIREGSDSIWTRLWKKPEEEEKTNILTAAITYYADFDVEERPQQIRTKVYPPMRVKDENLRKEEQRYLTFKDNKVFTDQQSKEMAAQGFYFTGTPERPDEVTCIFCQGKLAQWKKGETAKREHREKLPRCPFMLNLDVRNQVMNRSEGLRQSESDKDEKGGEKKITIIKNFEDPTELIWEKETINRTFEERIKTFKGNPRAAEFASQGYCQTARGIMCEGCKNQQPIPDRNVKQLKHKGKCMYKQEKESKNIEIIITNQQIEDILDRPKTRTIMLLSGVDTQKMRKIIQERLANNLEWYDSTQAIIRAIKRYQEKPKENREKSIIKEAILEQYQCVTCWQKHVEIIYMPCGHMVTCEACGIKVNICPVCRKSINGRIKGFRFADQ 2208          

HSP 2 Score: 443.736 bits (1140), Expect = 1.579e-169
Identity = 258/405 (63.70%), Postives = 311/405 (76.79%), Query Frame = 1
Query: 1531 RTVTRKPPKSVTTNQPEKETRRPPKSKTTKQS-EKGVT--DSHLSIHEALQLQKSFKNVQQRGQIIXXXXXXXXXXXKPNETNYATKMIGITSAVTSIVLMLIIIQLVRTTNXXXXXXXXXRLWPAIEKFNYDIKMEQYNAERSEEYKVIGNSSTNRLWLKESPIIETPQEWSDDLDVYQITNERYGDIRTLRIEPPQTMV*NKRKRCI*CRILYNSSNSMYDYV*ILYKMHKE*ITNQKE---NADKLITYCNQ*MDPNNDNRQYQARIPPFVEVIQQPTASNEPIEIVELDRGIYQDQAVEVIWRRQCELMTQITNNAQAQWTNTYMVLTESVNRGLHQADRIQEQQRTILQLQRMNEQLTNQVRWQAEEIRRLRSSQQNIEPGSWVEWISTMPEFTPEPYST 2727
            R +TRKP KS TT+QP     +P + KT+ ++ +KG+   DSHLSIHEALQLQK  KNVQ +  I+ETT  RE TT +PNE NY  KMI IT+AV S V+MLIIIQLVRTT K K+KP K+RLWPA+EKFNYDI++ QY+ ER+EEY++IGNSST+ LW+KE PIIE  Q+WS++ DVYQI NE+YGDIRTLRIE P+TM              YNSSN MY     +YK   + + N K+   N D+L+ Y NQ M+PNN N+  Q RIPPF E  QQP A+N PIEIVEL++GIYQDQ VE  WRRQCELMT ITNNAQ QWTNT++VLTESVNRGL QA R++EQQRTILQLQRMNEQL +QVRWQA+EIRRLRS+QQ+++P SWVEWI++MPEFTPEP ST
Sbjct:  973 RMITRKPLKSNTTDQP---IIKPAERKTSNETWKKGMIMDDSHLSIHEALQLQKVLKNVQPKEGIMETTNARENTTMQPNEKNYMIKMIWITTAVISSVVMLIIIQLVRTT-KRKKKPAKRRLWPAVEKFNYDIELGQYDVERTEEYEIIGNSSTSGLWIKEPPIIEA-QQWSNESDVYQIMNEKYGDIRTLRIESPETM--------------YNSSNGMY-----IYKYCTKCVRNNKQTGMNTDELMMYYNQQMNPNNVNQPNQVRIPPFAEGSQQPAAANVPIEIVELNQGIYQDQGVEATWRRQCELMTLITNNAQTQWTNTHLVLTESVNRGLQQAIRLEEQQRTILQLQRMNEQLADQVRWQADEIRRLRSNQQHVDPASWVEWITSMPEFTPEPDST 1353          

HSP 3 Score: 175.252 bits (443), Expect = 1.579e-169
Identity = 103/264 (39.02%), Postives = 148/264 (56.06%), Query Frame = 2
Query:  926 IQPEYLSSCPITKETCRDAKKEDKSIRIQVNPGIGNLQIVNIGTKEIKQI*VQDLVTDCWRMNLGK*QKCAWDSLKGDTEY---------IIC---------------------AGNNRIITC-----------TIARTLGEKPVI------------------------ASTTKEEPYKRRIRENKATIIKVEPNTANGEEVIVENMGEEPITRVCVYEAKKNGTVNKRIQCKSNEDVKNQRYCIPNKRKLGKYEVHIQKEKH 1522
            I+ E  SSC  TK+ CR+A  ED++++IQV PGIG L+I+N G + I+Q+ +Q+ + DCW+MN+   +KC WDSL+G+ EY         I C                     A  N+ IT             I   +G++P+                            T+ +PY+R+IRE+KA II +E N AN EE+++EN GE+PIT++C+YEAK N  VNKRIQC+ ++ +KNQ+Y IP KRKLGKY ++IQK  H
Sbjct:  707 IRSENSSSCQTTKDVCRNAT-EDRNVKIQVKPGIGKLRIINRGIETIEQVCIQNKIIDCWKMNMKAGKKCEWDSLEGNAEYVICANNDIIITCTLAKTLGEKFTTPKEEPYQRRARENKEITIKVEADPKSGEEIIVENMGKEPITKKGRDDYWKSITRKLLESITTKRPEKETRGKPYQRQIRESKAVIINIESNAANEEEIVIENTGEKPITKICIYEAKGNEPVNKRIQCEISKTIKNQKYRIPTKRKLGKYVINIQKGTH 969          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF37.319e-3725.23TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF37.319e-3725.23TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF33.943e-3327.34TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF33.943e-3327.34TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF27.192e-3325.87TNF receptor associated factor 2 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-13.406e-2023.83TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
trf-21.370e-729.41TNF Receptor Associated Factor (TRAF) homolog [So... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf45.886e-2124.52gene:FBgn0026319 transcript:FBtr0334401[more]
Traf46.403e-2123.92gene:FBgn0026319 transcript:FBtr0077429[more]
Traf-like1.432e-823.28gene:FBgn0030748 transcript:FBtr0074275[more]
Traf-like1.742e-823.28gene:FBgn0030748 transcript:FBtr0074273[more]
Traf-like1.847e-823.28gene:FBgn0030748 transcript:FBtr0308606[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2b7.826e-4026.89Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b9.204e-4026.89Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b9.204e-4026.89Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf61.344e-2925.05TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf61.344e-2925.05TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ssh21.311e-2923.68slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
sytl22.860e-2925.33synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-9... [more]
ssh21.874e-2724.41slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
hspb61.128e-2236.49heat shock protein family B (small) member 6 [Sour... [more]
TRAF21.245e-2231.13TNF receptor associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf33.700e-3725.23TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf25.089e-3424.95TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf38.089e-3427.34TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf38.089e-3427.34TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf29.999e-3324.80TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q60803|TRAF3_MOUSE2.588e-3625.23TNF receptor-associated factor 3 OS=Mus musculus O... [more]
sp|Q13114|TRAF3_HUMAN3.515e-3625.23TNF receptor-associated factor 3 OS=Homo sapiens O... [more]
sp|P39429|TRAF2_MOUSE3.560e-3324.95TNF receptor-associated factor 2 OS=Mus musculus O... [more]
sp|Q12933|TRAF2_HUMAN3.454e-3225.87TNF receptor-associated factor 2 OS=Homo sapiens O... [more]
sp|B6CJY5|TRAF6_MACMU1.278e-3125.35TNF receptor-associated factor 6 OS=Macaca mulatta... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
F1AGB41.063e-8288.51TNF receptor-associated factor (Fragment) OS=Schmi... [more]
T1DF652.150e-5129.34TRAF-2 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
T1DBK64.411e-5129.02TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
D5JG593.376e-4529.75TNF receptor-associated factor-2-like protein A OS... [more]
D5JG602.325e-4430.59TNF receptor-associated factor-2-like protein B OS... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2b8.721e-4126.98TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf64.964e-3126.53TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf64.964e-3126.53TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf53.348e-3024.52TNF receptor-associated factor 5 [Source:NCBI gene... [more]
traf2a5.840e-3024.90TNF receptor-associated factor 2-like [Source:NCBI... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002130.14.617e-2523.22pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
ENSPMAT00000000074.14.262e-2429.02pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
ENSPMAT00000008091.11.359e-1724.51pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 ... [more]
traf68.334e-1521.85TNF receptor-associated factor 6 [Source:NCBI gene... [more]
birc27.891e-838.00baculoviral IAP repeat containing 2 [Source:ZFIN;A... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO328517.709e-3927.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412431.684e-3725.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388731.552e-3626.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328492.816e-3526.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO377502.170e-2723.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2b9.633e-4026.91TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b1.177e-3926.91TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf33.976e-3426.05TNF receptor associated factor 3 [Source:NCBI gene... [more]
traf4a7.793e-2723.48TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4a8.227e-2723.48TNF receptor associated factor 4 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023758.12.822e-15382.15SMESG000023758.1[more]
SMESG000012882.11.531e-10382.92SMESG000012882.1[more]
SMESG000074160.15.023e-14481.24SMESG000074160.1[more]
SMESG000073574.13.269e-8180.99SMESG000073574.1[more]
SMESG000016682.11.579e-16980.71SMESG000016682.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014140 ID=SMED30014140|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=8420bp
GGAAACACTGCCAGTTTGTTTTTATTATTGCTTTTAAAATAGAGTTTGAT
AAATACGATATTTGATGACATTTAATATGATATTTAATATAACCTGTCAG
TAAAAATAGACGGAAGAATTCCAAGCCGCATGTGATACCTTAATTCCTTG
GTGGCAAGTTTACTGTATTCACAATAAGCATATATCAGTGGTTCCCAGTG
GAAGCCAGTTTATCACCGTCTAGATGCAGGTTTGTTGTGGCGAGTATCAT
CAACCCATTCAAATTTGAATCATTTAGGCGATCTCGATTTTTGTTTTTTA
TGAGTTTCATTGCTGAAAATGATTGCTCACATCTGTACGTATAACGTTTA
GACAAACGACTGCAAACTTTCAATTCATTTGCTGGAAACAAACGCCAGAA
GGATATCATATCATTGGCAGTTGGCGCGCCAAGAAGCTCAACAAATCTGG
CTTTCAGAATCGAGTTACATTTCAAATCATTAATTTCAAGTTGCAAATTT
TCTTCAAGCATATTTATCTTCTCATCAGAAAAAACAAAAGGATTTGTGAA
AAGTCCAACGTTGTTTGTTTCTTCACAAACGGTTAAAGTCAGGAATCAAA
AGCACATCATAAATTTATTTAGTTGATTCGGCGGTATATATATACAAAAT
GGGAAACGTCCCATAAACCCAATAAGCTGTTCATTAATTTTGATATTTGA
ACTCGGCTTGTACCACTTTTTGCAATTAAGTTTAAACTTTTCCCAAAATT
CTCTGAATGGTGCAAATTTGTCTGTAGCTCTTCTCATTTACTTTGTCCTA
TTCTCATCAAATCGGCAACATATTATCAAAAAAGTAAATTTCTCAGCAGT
CATACAAGCGCTGAAAATTCAACAATTTTTTTATGTCAAATAAAGTTCAC
ATATGCAAATTATTGCCTTTTTCTTATACAACCAGAATATCTATCATCCT
GCCCTATTACAAAAGAAACATGCAGAGATGCGAAGAAGGAAGACAAAAGC
ATAAGAATTCAGGTAAACCCAGGGATAGGCAACCTACAAATAGTGAACAT
AGGAACAAAAGAAATTAAACAAATATGAGTACAAGACCTAGTTACCGATT
GTTGGAGAATGAACCTGGGAAAATGACAAAAATGTGCATGGGACAGTCTA
AAAGGTGATACAGAATACATCATATGCGCAGGGAATAACAGGATAATAAC
CTGTACAATAGCCAGAACATTAGGAGAAAAACCCGTAATAGCAAGCACAA
CAAAGGAAGAACCATATAAACGTCGGATACGGGAGAATAAAGCGACGATA
ATAAAAGTAGAACCAAACACAGCAAATGGGGAAGAAGTAATAGTCGAAAA
CATGGGTGAGGAACCCATTACAAGAGTCTGTGTGTACGAAGCCAAGAAAA
ACGGAACGGTAAACAAAAGAATTCAATGTAAGTCAAATGAAGATGTTAAG
AATCAGAGATACTGCATCCCAAACAAAAGAAAACTCGGGAAATATGAAGT
ACACATCCAAAAAGAGAAACACATCTATTGAGGACGGTAACAAGAAAACC
ACCAAAATCAGTCACGACAAACCAGCCGGAAAAGGAAACAAGAAGACCAC
CCAAGTCAAAAACAACAAAACAATCGGAGAAGGGAGTAACCGACAGTCAC
CTTTCAATTCATGAGGCGTTACAACTTCAGAAATCATTCAAAAACGTACA
ACAAAGAGGACAGATAATAGAAACAACCACCACAAGAGAAGCAACAACAG
CGAAACCTAACGAAACGAACTATGCGACAAAAATGATCGGGATAACAAGC
GCAGTAACAAGCATTGTATTAATGTTAATAATAATTCAACTTGTGAGAAC
CACTAACAAATGTAAGCAGAAGCCCAAAAAGAAAAGACTATGGCCAGCAA
TAGAAAAATTCAATTATGATATCAAAATGGAACAGTACAACGCAGAAAGA
TCAGAGGAATACAAAGTCATCGGAAACTCAAGTACAAACAGACTCTGGTT
AAAAGAATCACCCATTATTGAGACACCACAAGAATGGTCAGACGATCTCG
ATGTATATCAAATAACTAACGAGAGGTACGGGGACATACGAACACTACGT
ATAGAACCCCCGCAGACAATGGTATGAAACAAGAGGAAACGATGTATATA
GTGTAGAATATTGTATAATAGTAGTAATAGTATGTATGATTATGTATAAA
TATTGTATAAAATGCACAAAGAATAAATAACTAACCAGAAAGAGAACGCA
GATAAATTAATAACGTATTGTAATCAATAGATGGACCCGAATAACGATAA
TCGACAATATCAAGCCAGAATACCCCCATTCGTAGAAGTAATCCAGCAAC
CAACAGCCTCAAATGAACCTATAGAGATAGTAGAATTAGATCGAGGGATA
TATCAAGATCAAGCAGTTGAGGTAATATGGAGACGTCAATGTGAATTGAT
GACACAAATAACCAACAACGCGCAAGCACAATGGACGAATACTTACATGG
TATTGACAGAAAGCGTAAATCGAGGCCTACATCAAGCGGATAGAATTCAA
GAACAACAAAGAACCATATTACAACTACAAAGAATGAACGAACAATTAAC
CAATCAAGTCAGATGGCAAGCTGAAGAAATTAGAAGGTTACGAAGTAGTC
AACAGAATATAGAACCAGGAAGCTGGGTCGAATGGATATCAACGATGCCA
GAATTTACCCCAGAGCCATATTCAACAGAAGATTAAAATAGGGCGTACCA
TGTAAATATGTGTAAATAAACCGATAAAAGTAAACGACGTCAAGTAATTA
GAGAATTATTGTACATATGGCGACAATTATCGAGAGAATTAGAGGAAGCG
AGAATCCGTCCGAAGCTAAGAGACGAATAATGAAAGACAAGATTAGAATG
GTGAACGATACAGAAGAAAGATTAAAATGTTGTAAATGTAAAGGGTTACT
GATTGGAGCGAGACAGACGAAATGTGGATGCAGAATATGTACAGAGTGTA
CAATAGAAGTGATAGAAACAAAAACAATAAAATGCCCTGGATGTAACGAA
ATATTGGAAAAAGATGAAGATCCTACAACAATGGATAAAGCCACCAACAA
AGAGATCAACAATCTATTAATTCAATGCCAAGTAAAAGAATGTGAATGGA
AAGGACGTATGAAGGAAGCCGAAAATCACACAAATGAATGCGAATATAAC
GAGATATTATGCGAAAAATGTCAAACCATCACAACGAAAAAGACGATAAA
AGACCATCACAAAATATGTGTCAAGAGAGAGGAAAAATGCGAATTCTGTG
GATCCATCGACGAATGGATAAAAGTAGAAAAGGAACATCGGAATCCAAAT
GAGGAACAAATATGCGATTTCTACTAAGGAATATGCGCAAACAACTGCAA
CAGGAAAGATAAAGTCAAATTAAAAGAACATTGGAACGAATGCATCGGCA
AACCGGTCAAATGTCCATTAGAATTATTCAATTGTCAAGCGCAATTACCA
ATTATGGAGATGCAAAAACATATGATAGAAAATAGTATCGAGCATACCGA
AATCATGATGAAAACGATAGGAATGATAGCATGGGAAGTGAAAAGTCTAC
AAACAGAAATGGATGCACAAAAGGCACTAATGAGAGAAATATTGGAATCC
AGAAAGAGTTTCGAGAAAAGCCAAGGAACTATACCCAGAAAAATGACCGA
GATGGAAGAGAAAATACAACAGATAATCAGCAACGTACAGGACCTAGAAA
CAACCAGCCCGGTAGCCAGAAAACTACCTACAACACCATTTATCTGGAAA
ATAACTGGATTCGCAGAGAAACTTCAAAAAGCAAAAGATGGAACACAGAG
AATCCTAGATAGTCCACCGATATATAGTTGGAAAAATGGATACAAATTGG
GCATTAGACTATATCCAAATGGAGATGGAAATGCAACAGGCACCCATATC
AGCGTTTTTGTTAGAATAGGAATAGGAAAAGGAGAATATGATGAACTATT
AACATGGCCTTTCAAACAAAATATGATACTAACAATGAAAGGACGAGAGG
AATATCGTAACCCAATCAGAACAGGAAATGAACCACAGATGGGAAGACCA
ACAACCGACTGGAATACAGCGATTGGGACACCACGTTTCTATCCACAACA
ACGATTGAGAGGAGAAGGATTCTTGCGAGAAGATAATCTGTATATAAAAT
TAGAAGTGGAGAAGCCAGACAAGACGTTGTAAAGAAAACGGAAAGTGTAA
ATAAATGTAAATAAAATAATAAAAATCAAATAAAAATCAAAAAATTACAA
ATAATCAGAAAAATCAGAAAAACAAAAATTCAAAAATAATGACGATATTT
AGATGGCAAGCGGAATCAGCGAAGAGATAACAGTACAGATGAGAGAAGGA
CCAGATTCAATATGGACGAAACTATGGAAAAAACCAGATGAAGAGGAAAA
AATCAAAACATTAACAATCGCAATTCAGCATTATTCCAGCTTCGACTCAG
CCGGACGGCCCTGGCGAATGAGGGAAGTGTTATACTCACAGAGAAGAGTA
AAATATGAACAGCTGAGAAAAGAGGAACAAAGATATTTAACATTTAAAGA
CAATAAAGTATTTACCGACCGACAAAGTAAGGAGATGGCCGCACAAGGAT
TTTATTTTACGGGAACACCAGAACTACCAGACGAAGTAACATGCATCTAT
TGTAAAGGAAAACTCGCAAAATGGGAAAAGGGAGAGACAGCAAAACGAGA
ACACCTGAGAAAATTTTCAACCTGTCCATTTAGAATTAATATTGATGTCA
GAAACCAAGCGATGAACAGACTAGAAGGACTTCGACAATCGGAGTTAGAC
AAAGATGAAAAGGGAGGTGAGAAAAAGATAACGATAATAAAGAGTTTCGA
AGACCCAGCAGAATTAATATGGGAAAAAGAGACTATAAATAGAACATTCG
AAGAGAGAATTAAAACCTTCAAAGGAAACCCAAGAGCAGCAGAATTTGCG
AGTCAAGGGTATTGTCAAACAGCCAGAGGAATAATGTGCGAAGGATGCAA
AAATCAACAACCAGTACCAGATCAGAATGTCAAAAAGCTAAAACATAAAG
GAAAATGCATGTATAAGCAAGAAAAAGAGTCAAAGAATATTGAAATAATA
ATTACCAACCAACAAATAGAAGATATTTTGGATCGACCGAAAACGAGAAC
CCTAATGCTATTATCAGGAGTGGATACTCAAAAGATGAGAAAAATAATCA
AAGAAAGATTAGCTAACAATTTAGAGTGGTATGACTCAACACAAGCAGTA
ATCCGAGCAATCAAGCGATATCAAGAGAAACCAAAAGAGAATCGAGACAA
ATCAATAATAAAAGAAGCTATTTTGGAACAGTATCAATGTGTAACATGTT
GGCAGAAGCATGTAGAAATAATTTATATGCCTTGTGGACATATGGTCACA
TGTGAAGCGTGCGGGATAAAAGTTGATATATGTCCAGTATGTAGAAAGCC
GATCAACGGGCGGATCAAAGGATTCCGTTTCGCTGATCAGTAGATAGAAA
ACGAAAACAATGTGTAAAAAGTGTAAATAAAGATAAACGTAAAAACAAAA
AATTATAAAAAAACCAAAAATTACGAAAAACCTGATACGCGAATATAAAT
TATGATATAAATAATGATTTAAATTTTTACATGATTGAGAAGAGAAAATA
ATCGATATTAATATTCAGAAAACAGTTATAAACCTGATCGAGACAAAAAC
CCAACTAATAAAAGAAGTCGTAGCAGAAGATAAAGAGTCAAAACTAACAA
TCAAAGATCAACCAGAACCACTAAAGGAAGCAAGCGAAGAAGTAGAACAA
TGGAAACAAAGAACGATGCAGTTAAAGGAAATGCTACTAATCGCAGAAGA
AGAATTAATACAAGAGACTTTAAAAACCAAAATGATGAGAGAAAAGTGGG
TAAAACAAATAGAACAAAGAATAACTTATCCAGGAGGAAAGGAGAAAACG
TACAAAGAGCGAGAAGAGGAACTGATGAAGGAATTTATGCAAAATCAGAC
GAGAATCACAAACCAAAGGAAAGAGATACGAGCCCTGGAATAAGACAAGC
AGGATCAACAAGGTGAGATAGAAAGACTACGAGAAATAATAAAAGATAAA
GAAACAGAGATACAAGAAGAAGGGGAGGAAAATATTAAAATCTTAAATCA
AATGCAAGAAGAAATAGAACAAATAGGAACCCAATACCGAATAGAGAAGA
CCAAGAGAACAAGTATGGAACAAGCCAAAGAATGGGCAAAAAGACAAGCG
CGATATTGGAAAATCAAATGGACAGAAGATAGAGAACAATCAAGAAGTAA
TTGGGAATCGCGGATCAGACATTATATTCAGCAAATAGCCGAAGAAGAAG
ATAGAACAAGAGCGTACAAAGCTAAATGGGAGAACGCAAAGATCGAAATC
AATAAACTGAGAAATCAAGGGCCAAAACCATCAAAGAAAATTAGAGAGCC
CAGAGACGATAGACAAGAAAGAATGCTGACTCAGATAACTGATCAAGCAA
GAAAATGGCGAATAGAATGTAGAATACTCGAAGACGCCAACGCAAAACAA
TTCAATCATATAGTGAAATTGGAGCAGGAAGTCGAATATAAACAGACCAG
AATAAAAGAGATGCAGATCGAGCATGACGAAGCTCACCGACAAAGACGAA
TACAACGAATAAAAACGGAAAAGAAAGAAAGTTGGATTAAATTAGAAGCA
GGAAAATGGAAGGACCAGTATCAGGAAGCCAAAAAAGAGATAAGACGATT
ACCCAAGAAATTGTTGAATACCGAAGATTGGGAGCTATGGGAGCAGATTG
AAGAGCAGAAACATACACTCGACGATTACAGTAACCAAATACAAACATTA
GAATTCAACGAACGAATCAGAAAGAATACAATAGACAGGCTCAGAAAAAC
CGAAAAGGCCCACAGAAAATGGATTGATCAATTAAATCAGAAGATACTGG
AAACCTTAAATGAACAAACTGATGAAAGACGACAAATCCAACAATTAAAC
GAGAGGATAACAGAACTCCAGCAGGAGGTGAATGGACACCGAGGAGTTGT
AGTATTTAAAGAAATTCAGTTGAGACATCAACTCGAAGTCAACGATCAGT
TGAAAGAACAAGTTGAAGCAGAGATAAAAGCGATAAAGCAAGGATATGAG
GAAAATGAACAGAATCTGAGAAAAGAAATTGAAAAGTTAAAAGCGTTAGA
AAACACGCATCGGTTGGAAACGCGAGTGGAGGAATTAACCGAAAATACAG
AATATCTTGCCTATCTCTTAGACGAAGAGATACAAATATCAAACGCTTTA
CGTGAAGAGGTAAATATGTTACAAAGTCGACCACCAATCCTGCTTATGCC
GTTATATCCGACGGAAATGCTAACTCAAGTACCCGCCGAACCCGATGAAG
GATTCGGGGAGACGGACGAAGCGGCAATATAAACCTAAAAAGGAAAAATT
GTAAAAAGTGTAAAAAGACAATAAAAATAATAAAAACGATAAAAACAAAA
ATTGTAATCGATGTATATTTAGTATGAATCCAAATGAAATAGAAATCCGA
ATGAATCTAGAAGACGGAGAATACGTACCAAGCCCAATTCAATTAGTAGA
ACCAATAGAGCAAGACCCACTGAGGTATTATAGTAAAAAGTGGAGAGCCG
AAAGAAAAGAGTGGCAAGAAATAGTGGAGGAGCAAGAATCAGAAATCGCC
CGGATAAATCAACAATTAATACAATCTAAACAGTTAGCCAATACGATAAA
GCGAAAACTAACATCCAGCATGGGAGAAAATAGAAATCAAAAGAGAGAAA
ACGAACAATTGAAACGAGAATTAGCTGAAATAAAAACCCGCGTAATCCTG
GAAGACTATTGGAAAACCGAAGCAGAACGAATGCGAGACAGCAGAAAAAG
CGAACAGAGATACGTGCTACAACTAGAAGACAGTTGTAAAGAAGCCAGAG
AGATAAAAGAAAGTCATCAACAAACTCAGGACGAAATTAAAACATTAACA
GAACAGCTCCAGGAAGCGAGACGAAAGCTGGAAAAGCAAACAGCTAAACG
AATAAATTATAAACGTCAACTTAAAAGAAAGCAAGCGAAAGAAAGAAATC
TCCAAATGAAAATCTACAATCAACAGAGGGTAATCAAAGAAAACAAAGAA
CGATTAAAAGAACTCCCGAAAATAACCGAGCGATTAATAAGAGCCCAAGT
CCTAATAATGAGATTTTCAGAAAACAAAACTAAAGAGGAGTGCGAGATAC
ACTCAACCCCAGAAAAAGAGAAAGAATAAAAAGGGCTAAAACTCCACTGT
AAATAAACGAAATAACCTTGTAAATAAATATCAAATTAATTACGTATCAA
AAATAGAAGTTATGAACCCA
back to top

protein sequence of SMED30014140-orf-1

>SMED30014140-orf-1 ID=SMED30014140-orf-1|Name=SMED30014140-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=109bp
MLEENLQLEINDLKCNSILKARFVELLGAPTANDMISFWRLFPANELKVC
SRLSKRYTYRCEQSFSAMKLIKNKNRDRLNDSNLNGLMILATTNLHLDGD
KLASTGNH*
back to top

protein sequence of SMED30014140-orf-2

>SMED30014140-orf-2 ID=SMED30014140-orf-2|Name=SMED30014140-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=397bp
MASGISEEITVQMREGPDSIWTKLWKKPDEEEKIKTLTIAIQHYSSFDSA
GRPWRMREVLYSQRRVKYEQLRKEEQRYLTFKDNKVFTDRQSKEMAAQGF
YFTGTPELPDEVTCIYCKGKLAKWEKGETAKREHLRKFSTCPFRINIDVR
NQAMNRLEGLRQSELDKDEKGGEKKITIIKSFEDPAELIWEKETINRTFE
ERIKTFKGNPRAAEFASQGYCQTARGIMCEGCKNQQPVPDQNVKKLKHKG
KCMYKQEKESKNIEIIITNQQIEDILDRPKTRTLMLLSGVDTQKMRKIIK
ERLANNLEWYDSTQAVIRAIKRYQEKPKENRDKSIIKEAILEQYQCVTCW
QKHVEIIYMPCGHMVTCEACGIKVDICPVCRKPINGRIKGFRFADQ*
back to top

protein sequence of SMED30014140-orf-3

>SMED30014140-orf-3 ID=SMED30014140-orf-3|Name=SMED30014140-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=243bp
MEMQKHMIENSIEHTEIMMKTIGMIAWEVKSLQTEMDAQKALMREILESR
KSFEKSQGTIPRKMTEMEEKIQQIISNVQDLETTSPVARKLPTTPFIWKI
TGFAEKLQKAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHIS
VFVRIGIGKGEYDELLTWPFKQNMILTMKGREEYRNPIRTGNEPQMGRPT
TDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEVEKPDKTL*
back to top

protein sequence of SMED30014140-orf-4

>SMED30014140-orf-4 ID=SMED30014140-orf-4|Name=SMED30014140-orf-4|organism=Schmidtea mediterranea sexual|type=polypeptide|length=252bp
MNPNEIEIRMNLEDGEYVPSPIQLVEPIEQDPLRYYSKKWRAERKEWQEI
VEEQESEIARINQQLIQSKQLANTIKRKLTSSMGENRNQKRENEQLKREL
AEIKTRVILEDYWKTEAERMRDSRKSEQRYVLQLEDSCKEAREIKESHQQ
TQDEIKTLTEQLQEARRKLEKQTAKRINYKRQLKRKQAKERNLQMKIYNQ
QRVIKENKERLKELPKITERLIRAQVLIMRFSENKTKEECEIHSTPEKEK
E*
back to top

protein sequence of SMED30014140-orf-5

>SMED30014140-orf-5 ID=SMED30014140-orf-5|Name=SMED30014140-orf-5|organism=Schmidtea mediterranea sexual|type=polypeptide|length=427bp
MQEEIEQIGTQYRIEKTKRTSMEQAKEWAKRQARYWKIKWTEDREQSRSN
WESRIRHYIQQIAEEEDRTRAYKAKWENAKIEINKLRNQGPKPSKKIREP
RDDRQERMLTQITDQARKWRIECRILEDANAKQFNHIVKLEQEVEYKQTR
IKEMQIEHDEAHRQRRIQRIKTEKKESWIKLEAGKWKDQYQEAKKEIRRL
PKKLLNTEDWELWEQIEEQKHTLDDYSNQIQTLEFNERIRKNTIDRLRKT
EKAHRKWIDQLNQKILETLNEQTDERRQIQQLNERITELQQEVNGHRGVV
VFKEIQLRHQLEVNDQLKEQVEAEIKAIKQGYEENEQNLRKEIEKLKALE
NTHRLETRVEELTENTEYLAYLLDEEIQISNALREEVNMLQSRPPILLMP
LYPTEMLTQVPAEPDEGFGETDEAAI*
back to top

protein sequence of SMED30014140-orf-6

>SMED30014140-orf-6 ID=SMED30014140-orf-6|Name=SMED30014140-orf-6|organism=Schmidtea mediterranea sexual|type=polypeptide|length=152bp
MDPNNDNRQYQARIPPFVEVIQQPTASNEPIEIVELDRGIYQDQAVEVIW
RRQCELMTQITNNAQAQWTNTYMVLTESVNRGLHQADRIQEQQRTILQLQ
RMNEQLTNQVRWQAEEIRRLRSSQQNIEPGSWVEWISTMPEFTPEPYSTE
D*
back to top

protein sequence of SMED30014140-orf-7

>SMED30014140-orf-7 ID=SMED30014140-orf-7|Name=SMED30014140-orf-7|organism=Schmidtea mediterranea sexual|type=polypeptide|length=187bp
MATIIERIRGSENPSEAKRRIMKDKIRMVNDTEERLKCCKCKGLLIGARQ
TKCGCRICTECTIEVIETKTIKCPGCNEILEKDEDPTTMDKATNKEINNL
LIQCQVKECEWKGRMKEAENHTNECEYNEILCEKCQTITTKKTIKDHHKI
CVKREEKCEFCGSIDEWIKVEKEHRNPNEEQICDFY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0042981regulation of apoptotic process
GO:0043123positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0016567protein ubiquitination
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR013083Znf_RING/FYVE/PHD
IPR001293Znf_TRAF
IPR001370BIR_rpt
IPR001841Znf_RING
IPR008974TRAF-like
IPR002083MATH/TRAF_dom
IPR029526PGBD
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 84..103