LIM homeobox 1b

Overview
NameLIM homeobox 1b
Smed IDSMED30014138
Length (bp)1560
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of LIM homeobox 1b (SMED30014138) t-SNE clustered cells

Violin plots show distribution of expression levels for LIM homeobox 1b (SMED30014138) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of LIM homeobox 1b (SMED30014138) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for LIM homeobox 1b (SMED30014138) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014138

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30014138h1SMcG0010849 Contig4742GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30014138h1SMcG0010849 Contig4742GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30014138h1SMcG0010849 Contig4742GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30014138h1SMcG0022167 Contig4742GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30014138h1SMcG0022167 Contig4742GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30014138h1SMcG0022167 Contig4742GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30014138h1SMcG0022167 dd_Smed_v4_8252_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30014138h1SMcG0022167 dd_Smed_v4_8252_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of LIM homeobox 1b vs. Ensembl Human
Match: LHX1 (LIM homeobox 1 [Source:HGNC Symbol;Acc:HGNC:6593])

HSP 1 Score: 148.288 bits (373), Expect = 5.313e-39
Identity = 93/255 (36.47%), Postives = 129/255 (50.59%), Query Frame = 1
Query:  250 CYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDN---DKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            C  C +PI D+F+  + D +WH +C++C +C C LT KCF  + +  C  D+ R    KC+ C   I PSD V    S  +FH NCF C  C+++L +G+  Y     +  VC+ DY                          + +    K N  H  TT      S  S     DD       +V +     N   D++   +RR PRTTIKA QL++LKA F+ TPKP+R +RE+LA+ TGL+MRVIQVWFQN
Sbjct:    4 CAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCAQGISPSDLVRRARS-KVFHLNCFTCMMCNKQLSTGEELYIID-ENKFVCKEDY--------------------------LSNSSVAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKEAGSNENDDQNLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQN 230          
BLAST of LIM homeobox 1b vs. Ensembl Human
Match: LHX1 (LIM homeobox 1 [Source:HGNC Symbol;Acc:HGNC:6593])

HSP 1 Score: 148.288 bits (373), Expect = 5.313e-39
Identity = 93/255 (36.47%), Postives = 129/255 (50.59%), Query Frame = 1
Query:  250 CYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDN---DKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            C  C +PI D+F+  + D +WH +C++C +C C LT KCF  + +  C  D+ R    KC+ C   I PSD V    S  +FH NCF C  C+++L +G+  Y     +  VC+ DY                          + +    K N  H  TT      S  S     DD       +V +     N   D++   +RR PRTTIKA QL++LKA F+ TPKP+R +RE+LA+ TGL+MRVIQVWFQN
Sbjct:    4 CAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCAQGISPSDLVRRARS-KVFHLNCFTCMMCNKQLSTGEELYIID-ENKFVCKEDY--------------------------LSNSSVAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKEAGSNENDDQNLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQN 230          
BLAST of LIM homeobox 1b vs. Ensembl Human
Match: LHX5 (LIM homeobox 5 [Source:HGNC Symbol;Acc:HGNC:14216])

HSP 1 Score: 141.354 bits (355), Expect = 1.473e-36
Identity = 94/259 (36.29%), Postives = 139/259 (53.67%), Query Frame = 1
Query:  250 CYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDL---VSEIDPSVD---ETYCSDN-DKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            C  C +PI D+F+  + D +WH +C++C +C   L+ KCF  + +  C  D+ R+   KC+ C   I PSD V    S  +FH NCF C  C+++L +G+  Y     +  VC+ DY                ++ + L    ++S               +S+   RS S +L D L     E D S     ET  ++N +++   +RR PRTTIKA QL++LKA F+ TPKP+R +RE+LA+ TGL+MRVIQVWFQN
Sbjct:    5 CAGCERPILDRFLLNVLDRAWHIKCVQCCECKTNLSEKCFSREGKLYCKNDFFRRFGTKCAGCAQGISPSDLVRKARS-KVFHLNCFTCMVCNKQLSTGEELYVID-ENKFVCKDDY----------------LSSSSLKEGSLNS---------------VSSCTDRSLSPDLQDALQDDPKETDNSTSSDKETANNENEEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQN 230          
BLAST of LIM homeobox 1b vs. Ensembl Human
Match: LMX1B (LIM homeobox transcription factor 1 beta [Source:HGNC Symbol;Acc:HGNC:6654])

HSP 1 Score: 117.087 bits (292), Expect = 4.766e-28
Identity = 81/280 (28.93%), Postives = 132/280 (47.14%), Query Frame = 1
Query:  187 IKLEIASTNPEV----VLLKMTVP---ICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            IK+E  +  P      VLL    P   +C  C +PI+D+F+ R+ + SWH++CL+C  C   LT+ C+  D +  C +DY +    KCS C   I P++ V+      ++H  CF C  C+++L  GD +        ++C+ DY                  K + + S +   E++             + +S    G++             ++  S +D     R + PRT +   Q  + KA+F ++ KP R++RE LA  TGLS+RV+QVWFQN
Sbjct:   28 IKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCYFRDRKLYCKQDYQQLFAAKCSGCMEKIAPTEFVMRALEC-VYHLGCFCCCVCERQLRKGDEFVLKE--GQLLCKGDY-----------------EKEKDLLSSVSPDESD-------------SVKSEDEDGDM-----KPAKGQGSQSKGSGDDGKDPRRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQN 269          
BLAST of LIM homeobox 1b vs. Ensembl Human
Match: LMX1B (LIM homeobox transcription factor 1 beta [Source:HGNC Symbol;Acc:HGNC:6654])

HSP 1 Score: 117.472 bits (293), Expect = 5.164e-28
Identity = 81/280 (28.93%), Postives = 132/280 (47.14%), Query Frame = 1
Query:  187 IKLEIASTNPEV----VLLKMTVP---ICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            IK+E  +  P      VLL    P   +C  C +PI+D+F+ R+ + SWH++CL+C  C   LT+ C+  D +  C +DY +    KCS C   I P++ V+      ++H  CF C  C+++L  GD +        ++C+ DY                  K + + S +   E++             + +S    G++             ++  S +D     R + PRT +   Q  + KA+F ++ KP R++RE LA  TGLS+RV+QVWFQN
Sbjct:   28 IKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCYFRDRKLYCKQDYQQLFAAKCSGCMEKIAPTEFVMRALEC-VYHLGCFCCCVCERQLRKGDEFVLKE--GQLLCKGDY-----------------EKEKDLLSSVSPDESD-------------SVKSEDEDGDM-----KPAKGQGSQSKGSGDDGKDPRRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQN 269          
BLAST of LIM homeobox 1b vs. Ensembl Celegans
Match: lin-11 (pep chromosome:WBcel235:I:10248256:10255327:1 gene:WBGene00003000.1 transcript:ZC247.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-11)

HSP 1 Score: 133.265 bits (334), Expect = 5.456e-34
Identity = 86/261 (32.95%), Postives = 123/261 (47.13%), Query Frame = 1
Query:  250 CYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSC---------EIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            C  C +PI D+++  +    WH  CLRC  C   ++  CF  D   LC  D+SR+  ++C+ C G +   D V       +FH  CF+C+ C + L +GD+ Y    G+  VCQ D+ +                                     K +T  S +R  S+      D+  +   + DE    D +  C           +RR PRTTIKA QL++LK  F+ TPKP+R +RE+LA  TGL+MRVIQVWFQN
Sbjct:   68 CAACAQPILDRYVFTVLGKCWHQSCLRCCDCRAPMSMTCFSRDGLILCKTDFSRRYSQRCAGCDGKLEKEDLVRRARD-KVFHIRCFQCSVCQRLLDTGDQLYIME-GNRFVCQSDFQTAT-----------------------------------KTSTPTSIHRPVSNGSECNSDVEEDNVDACDEVGLDDGEGDCGKDNSDDSNSAKRRGPRTTIKAKQLETLKNAFAATPKPTRHIREQLAAETGLNMRVIQVWFQN 291          
BLAST of LIM homeobox 1b vs. Ensembl Celegans
Match: mec-3 (Mechanosensory protein 3 [Source:UniProtKB/Swiss-Prot;Acc:P09088])

HSP 1 Score: 110.153 bits (274), Expect = 1.843e-26
Identity = 80/253 (31.62%), Postives = 114/253 (45.06%), Query Frame = 1
Query:  250 CYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXX-XGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            C  CN+ I D++I R+ + S+H+ C++C  C   L  KCF  +    C + Y +          K  + P+D V    +  +FH  C  C+ C + L  G++         + C   Y         DD      N    I S +D    +  N    +  I  ++ S        D      +      +C D+ +   ++RR PRTTIK +QLD L   FS TPKPS+  R KLA  TGLSMRVIQVWFQN
Sbjct:   29 CNCCNEQIYDRYIYRMDNRSYHENCVKCTICESPLAEKCFWKNGRIYCSQHYYKDHSIHRCAGCKKGVSPTDMVYKLKAGLVFHVECHCCSLCGRHLSPGEQILVDDTMMTVSCMSHYPPQM-----DD------NAPGAIGSAVDIPSCSTENPIAPYP-IDESFSSAFQVKKEVDAYGYNFEHYSFSDFCDDDSRM--LKRRGPRTTIKQNQLDVLNEMFSNTPKPSKHARAKLALETGLSMRVIQVWFQN 267          
BLAST of LIM homeobox 1b vs. Ensembl Celegans
Match: mec-3 (Mechanosensory protein 3 [Source:UniProtKB/Swiss-Prot;Acc:P09088])

HSP 1 Score: 97.0561 bits (240), Expect = 2.868e-22
Identity = 73/234 (31.20%), Postives = 102/234 (43.59%), Query Frame = 1
Query:  307 SWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXX-XGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            S+H+ C++C  C   L  KCF  +    C + Y +          K  + P+D V    +  +FH  C  C+ C + L  G++         + C   Y         DD      N    I S +D    +  N    +  I  ++ S        D      +      +C D+ +   ++RR PRTTIK +QLD L   FS TPKPS+  R KLA  TGLSMRVIQVWFQN
Sbjct:    5 SYHENCVKCTICESPLAEKCFWKNGRIYCSQHYYKDHSIHRCAGCKKGVSPTDMVYKLKAGLVFHVECHCCSLCGRHLSPGEQILVDDTMMTVSCMSHYPPQM-----DD------NAPGAIGSAVDIPSCSTENPIAPYP-IDESFSSAFQVKKEVDAYGYNFEHYSFSDFCDDDSRM--LKRRGPRTTIKQNQLDVLNEMFSNTPKPSKHARAKLALETGLSMRVIQVWFQN 224          
BLAST of LIM homeobox 1b vs. Ensembl Celegans
Match: mec-3 (Mechanosensory protein 3 [Source:UniProtKB/Swiss-Prot;Acc:P09088])

HSP 1 Score: 97.0561 bits (240), Expect = 3.718e-22
Identity = 73/239 (30.54%), Postives = 105/239 (43.93%), Query Frame = 1
Query:  292 RIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXX-XGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            ++ + S+H+ C++C  C   L  KCF  +    C + Y +          K  + P+D V    +  +FH  C  C+ C + L  G++         + C   Y         DD      N    I S +D    +  N    +  I  ++ S        D      +      +C D+ +   ++RR PRTTIK +QLD L   FS TPKPS+  R KLA  TGLSMRVIQVWFQN
Sbjct:   26 QMDNRSYHENCVKCTICESPLAEKCFWKNGRIYCSQHYYKDHSIHRCAGCKKGVSPTDMVYKLKAGLVFHVECHCCSLCGRHLSPGEQILVDDTMMTVSCMSHYPPQM-----DD------NAPGAIGSAVDIPSCSTENPIAPYP-IDESFSSAFQVKKEVDAYGYNFEHYSFSDFCDDDSRM--LKRRGPRTTIKQNQLDVLNEMFSNTPKPSKHARAKLALETGLSMRVIQVWFQN 250          
BLAST of LIM homeobox 1b vs. Ensembl Celegans
Match: lim-6 (LIM domain family [Source:UniProtKB/TrEMBL;Acc:G4RV72])

HSP 1 Score: 95.5153 bits (236), Expect = 1.720e-21
Identity = 75/258 (29.07%), Postives = 112/258 (43.41%), Query Frame = 1
Query:  247 ICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTS--KCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTP---RTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            +C  C   I D++I R+ + S+H+ CLRC+ C   L+S  KCF       C  D+     K+C +C   + P+D +++      +H  CF C  C +    GD Y+ +     + C+ DY S                                          I N+++           +S  DP ++E   S      EI R+TP   RT + A Q    K  F  + KPSR++RE+LA  TGLS+RV+QVWFQN
Sbjct:   41 LCSGCGCLIKDRYIYRVMEDSYHESCLRCSCCQLSLSSFKKCFSRHGNIYCEHDHQMLYGKRCRRCMTLLLPTD-IVHRVHFMYYHAQCFSCCSCQRPFNLGDEYHVFD--GEVFCRNDYQS------------------------------------------ICNFQT-----------ISNPDPLMEEVVRS------EIHRKTPKRPRTILNAQQRRQFKTAFERSSKPSRKVREQLANETGLSVRVVQVWFQN 236          
BLAST of LIM homeobox 1b vs. Ensembl Fly
Match: Lim1 (gene:FBgn0026411 transcript:FBtr0071279)

HSP 1 Score: 140.969 bits (354), Expect = 4.533e-36
Identity = 101/276 (36.59%), Postives = 134/276 (48.55%), Query Frame = 1
Query:  250 CYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDY----------NSLKHELFGDDSNC------EQINKTELIFSDI-----DSQENNKGNV---FHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            C  CNKPI DKF+  + + +WH  C+RC +C   LT KCF  +++  C  D+ R+   KCS C   I PSD V       +FH NCF C  C ++L +G++ Y     +  +C+ DY          NSL   L G  S          +  T L    +     DS     G         +T   N    S  G+L  D     D   +     D + S   +RR PRTTIKA QL+ LK  F+ TPKP+R +RE+LA+ TGL MRVIQVWFQN
Sbjct:   27 CAGCNKPILDKFLLNVLERAWHASCVRCCECLQPLTDKCFSRESKLYCRNDFFRRYGTKCSGCGQGIAPSDLVRKPRD-KVFHLNCFTCCICRKQLSTGEQLYVLD-DNKFICKDDYLLGKAPSCGHNSLSDSLMGSASEDDDDDDPPHLRATALGLGVLGPNGPDSAGGPLGTSDISVQSMSTDSKNTHDDSDQGSLDGDPDGRGDSQAENKSPDDANGS---KRRGPRTTIKAKQLEVLKTAFNQTPKPTRHIREQLAKETGLPMRVIQVWFQN 297          
BLAST of LIM homeobox 1b vs. Ensembl Fly
Match: CG4328 (gene:FBgn0036274 transcript:FBtr0301071)

HSP 1 Score: 103.99 bits (258), Expect = 2.308e-23
Identity = 71/276 (25.72%), Postives = 114/276 (41.30%), Query Frame = 1
Query:  178 ALFIKLEIASTNPEVVLLKMTVPICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
             + ++L +A  +P++         C  C +PI D++I R+ ++S+H+ CL+C  CS  L   C+  + +  C  DY R   +      G    +D+++     ++FH  CF C  C   L  G++Y        + C+FDY      L G D         EL    +D +   K                                                 R RT    +   Q  + KA+F ++PKP R++RE LA+ TGLS+R++QVWFQN
Sbjct:  182 GMGMELGLAMASPQLSQ-------CAHCCQPICDRYIMRVVENSFHEGCLKCTACSLHLVHSCYAREGKLYCRVDYERLYIRNHCLGCGLKIAADELVMRCHENVFHLKCFACVVCGALLKKGEQYVVKQ--GQLFCRFDYEKEVEMLQGYD-----FYGDELFPPKLDGRRGPK-------------------------------------------------RPRT---ILNTQQRRAFKASFEVSPKPCRKVRENLAKDTGLSLRIVQVWFQN 391          
BLAST of LIM homeobox 1b vs. Ensembl Fly
Match: Awh (gene:FBgn0013751 transcript:FBtr0073155)

HSP 1 Score: 89.3521 bits (220), Expect = 4.378e-20
Identity = 75/261 (28.74%), Postives = 101/261 (38.70%), Query Frame = 1
Query:  229 LKMTVPICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSK--CFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            +K  +  C  C +PI+D+F   +   SWH  CLRC  C C L  +  CF  + +  C  DYS+    KCSKC   I  SD V     L +FH  CF C+ C ++L +G+++                     L  D   C+      +      S E   G+ +HK  T                                          +  RTT    QL  L+A F I   P  Q  E++A  TGLS RV QVWFQN
Sbjct:    1 MKTELRSCAACGEPISDRFFLEVGGCSWHAHCLRCCMCMCPLDRQQSCFIRERQVYCKADYSKNFGAKCSKCCRGISASDWVRRAREL-VFHLACFACDQCGRQLSTGEQF--------------------ALMDDRVLCKAHYLETVEGGTTSSDEGCDGDGYHKSKT------------------------------------------KRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGLSKRVTQVWFQN 198          
BLAST of LIM homeobox 1b vs. Ensembl Fly
Match: Awh (gene:FBgn0013751 transcript:FBtr0330071)

HSP 1 Score: 90.1225 bits (222), Expect = 7.718e-20
Identity = 75/261 (28.74%), Postives = 101/261 (38.70%), Query Frame = 1
Query:  229 LKMTVPICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSK--CFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            +K  +  C  C +PI+D+F   +   SWH  CLRC  C C L  +  CF  + +  C  DYS+    KCSKC   I  SD V     L +FH  CF C+ C ++L +G+++                     L  D   C+      +      S E   G+ +HK  T                                          +  RTT    QL  L+A F I   P  Q  E++A  TGLS RV QVWFQN
Sbjct:    1 MKTELRSCAACGEPISDRFFLEVGGCSWHAHCLRCCMCMCPLDRQQSCFIRERQVYCKADYSKNFGAKCSKCCRGISASDWVRRAREL-VFHLACFACDQCGRQLSTGEQF--------------------ALMDDRVLCKAHYLETVEGGTTSSDEGCDGDGYHKSKT------------------------------------------KRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGLSKRVTQVWFQN 198          
BLAST of LIM homeobox 1b vs. Ensembl Fly
Match: Awh (gene:FBgn0013751 transcript:FBtr0073156)

HSP 1 Score: 90.1225 bits (222), Expect = 8.036e-20
Identity = 75/261 (28.74%), Postives = 101/261 (38.70%), Query Frame = 1
Query:  229 LKMTVPICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSK--CFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            +K  +  C  C +PI+D+F   +   SWH  CLRC  C C L  +  CF  + +  C  DYS+    KCSKC   I  SD V     L +FH  CF C+ C ++L +G+++                     L  D   C+      +      S E   G+ +HK  T                                          +  RTT    QL  L+A F I   P  Q  E++A  TGLS RV QVWFQN
Sbjct:    1 MKTELRSCAACGEPISDRFFLEVGGCSWHAHCLRCCMCMCPLDRQQSCFIRERQVYCKADYSKNFGAKCSKCCRGISASDWVRRAREL-VFHLACFACDQCGRQLSTGEQF--------------------ALMDDRVLCKAHYLETVEGGTTSSDEGCDGDGYHKSKT------------------------------------------KRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGLSKRVTQVWFQN 198          
BLAST of LIM homeobox 1b vs. Ensembl Zebrafish
Match: lhx1a (LIM homeobox 1a [Source:NCBI gene;Acc:30463])

HSP 1 Score: 148.288 bits (373), Expect = 3.741e-39
Identity = 93/252 (36.90%), Postives = 137/252 (54.37%), Query Frame = 1
Query:  250 CYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            C  C +PI D+F+  + D +WH +C++C +C C LT KCF  + +  C  D+ R+   KC+ C   I P+D V    S  +FH NCF C  C+++L +G+  Y     +  VC+ DY S  +   G DSN   +          DSQ+  + +V       I+N   + +  N                   ++D++   +RR PRTTIKA QL++LKA F+ TPKP+R +RE+LA+ TGL+MRVIQVWFQN
Sbjct:    4 CAGCERPILDRFLLNVLDRAWHIKCVQCCECKCNLTEKCFSREGKLYCKNDFFRRFGTKCAGCAQGISPNDLVRRARS-KVFHLNCFTCMMCNKQLSTGEELYIIDE-NKFVCKDDYLSNTN---GKDSNLLSVTACSDPSLSPDSQDQLQDDVK---DAEIANLSDKETGNN------------------ENDDQNLGGKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQN 229          
BLAST of LIM homeobox 1b vs. Ensembl Zebrafish
Match: lhx5 (LIM homeobox 5 [Source:NCBI gene;Acc:30465])

HSP 1 Score: 144.436 bits (363), Expect = 6.989e-38
Identity = 97/261 (37.16%), Postives = 136/261 (52.11%), Query Frame = 1
Query:  250 CYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDND---------KSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            C  C +PI D+F+  + D +WH +C++C +C+C LT KCF  D +  C  D+ R+   KC+ C   I PSD V    S  +FH NCF C  C+++L +G+  Y     +  VC+ DY S         S  +++N                          +S+   RS S +L D +  +     D +  SD D          SC  +RR PRTTIKA QL++LKA F  TPKP+R +RE+LA+ TGL+MRVIQVWFQN
Sbjct:    5 CAGCERPILDRFLLNVLDRAWHAKCVQCCECNCNLTEKCFSRDGKLYCKIDFFRRFGTKCAGCLQGISPSDLVRRARS-KVFHLNCFTCMVCNKQLSTGEELYVIDE-NKFVCKEDYLSA--------SAIKEVNLNS-----------------------VSSCTDRSLSPDLPDQIQDDTK-ETDNSTSSDKDTNNNENEEQNSC-TKRRGPRTTIKAKQLETLKAAFVATPKPTRHIREQLAQETGLNMRVIQVWFQN 230          
BLAST of LIM homeobox 1b vs. Ensembl Zebrafish
Match: lhx1b (LIM homeobox 1b [Source:ZFIN;Acc:ZDB-GENE-980526-116])

HSP 1 Score: 143.665 bits (361), Expect = 1.615e-37
Identity = 94/255 (36.86%), Postives = 134/255 (52.55%), Query Frame = 1
Query:  250 CYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLV-SEIDPSVDETYCSD--NDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            C  C +PI D+F+  + D +WH +C++C  C C LT +CF  +    C  D+ R+   KC  C   I PSD V    S  +FH NCF C  C+++L +G+  Y        VC+ DY +  +   G D+N   I                         T  S+      S +  DD   SE  P  D+  C++  ++++   +RR PRTTIKA QL++LKA F+ TPKP+R +RE+LA+ TGL+MRVIQVWFQN
Sbjct:    4 CAGCERPILDRFLLSVLDRAWHAKCVQCCDCKCSLTDRCFSREGRLYCKNDFFRRYGTKCGGCAQGISPSDLVRKARS-KVFHLNCFTCIMCNKQLSTGEELYILDE-YKFVCKEDYLNNSN---GKDTNLLSI-------------------------TTCSDPSLSPESQDPQDDYKDSESGPMSDKETCNNENDEQNLGGKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQN 228          
BLAST of LIM homeobox 1b vs. Ensembl Zebrafish
Match: lhx1b (LIM homeobox 1b [Source:ZFIN;Acc:ZDB-GENE-980526-116])

HSP 1 Score: 143.665 bits (361), Expect = 1.615e-37
Identity = 94/255 (36.86%), Postives = 134/255 (52.55%), Query Frame = 1
Query:  250 CYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLV-SEIDPSVDETYCSD--NDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            C  C +PI D+F+  + D +WH +C++C  C C LT +CF  +    C  D+ R+   KC  C   I PSD V    S  +FH NCF C  C+++L +G+  Y        VC+ DY +  +   G D+N   I                         T  S+      S +  DD   SE  P  D+  C++  ++++   +RR PRTTIKA QL++LKA F+ TPKP+R +RE+LA+ TGL+MRVIQVWFQN
Sbjct:    4 CAGCERPILDRFLLSVLDRAWHAKCVQCCDCKCSLTDRCFSREGRLYCKNDFFRRYGTKCGGCAQGISPSDLVRKARS-KVFHLNCFTCIMCNKQLSTGEELYILDE-YKFVCKEDYLNNSN---GKDTNLLSI-------------------------TTCSDPSLSPESQDPQDDYKDSESGPMSDKETCNNENDEQNLGGKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQN 228          
BLAST of LIM homeobox 1b vs. Ensembl Zebrafish
Match: lmx1ba (LIM homeobox transcription factor 1, beta a [Source:NCBI gene;Acc:554361])

HSP 1 Score: 119.398 bits (298), Expect = 4.316e-29
Identity = 79/253 (31.23%), Postives = 124/253 (49.01%), Query Frame = 1
Query:  247 ICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            +C  C++PI+D+F+ R+ D SWH++CL+C+ C   LT  C+  D++  C  DY +    KCS C   I P++ V+     S++H +CF C  C+++L  GD +        ++C+ DY   K     D S+ ++    +L   D+  ++   G                   G   DD     DP                R + PRT +   Q  + KA+F ++ KP R++RE LA  TGLS+RV+QVWFQN
Sbjct:   32 VCEGCHRPISDRFLLRMNDSSWHEECLQCSVCQQLLTMSCYSRDHKLYCKHDYQQLFATKCSGCLEKISPTELVMRALE-SVYHLSCFCCCVCERRLCKGDEFVLKE--GQLLCKTDYEREKDLASPDLSDSDKSEDEDL---DVKPEKGAGGQ------------------GKGSDD---SKDPR---------------RPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQN 242          
BLAST of LIM homeobox 1b vs. Ensembl Xenopus
Match: gfm2 (G elongation factor, mitochondrial 2 [Source:Xenbase;Acc:XB-GENE-1002407])

HSP 1 Score: 145.591 bits (366), Expect = 4.233e-38
Identity = 88/254 (34.65%), Postives = 136/254 (53.54%), Query Frame = 1
Query:  250 CYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFG--DDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            C  C +PI D+F+  + D +WH +C++C +C C LT KCF  + +  C  D+ R+   KC+ C   I PSD V    S  +FH NCF C  C+++L +G+  Y       + C+  +      L    D S+     +++    D D++++   N                         +S+ +  V+E    ++D++   +RR PRTTIKA QL++LKA F+ TPKP+R +RE+LA+ TGL+MRVIQVWFQN
Sbjct:    4 CAGCERPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRRFGTKCAGCAQGISPSDLVRRARS-KVFHLNCFTCMMCNKQLSTGEELYIIDENKFVYCKLFWAGPSSPLVSVIDCSDPSLSPESQDPLQD-DAKDSESAN-------------------------ISDKEAGVNE----NDDQNLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQN 226          
BLAST of LIM homeobox 1b vs. Ensembl Xenopus
Match: gfm2 (G elongation factor, mitochondrial 2 [Source:Xenbase;Acc:XB-GENE-1002407])

HSP 1 Score: 145.591 bits (366), Expect = 5.228e-38
Identity = 94/259 (36.29%), Postives = 139/259 (53.67%), Query Frame = 1
Query:  250 CYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDL-------VSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            C  C +PI D+F+  + D +WH +C++C +C C LT KCF  + +  C  D+ R+   KC+ C   I PSD V    S  +FH NCF C  C+++L +G+  Y     +  VC+ DY                      + ++ ++    K N F   T    +  S  S   L DD        +S+ +  V+E    ++D++   +RR PRTTIKA QL++LKA F+ TPKP+R +RE+LA+ TGL+MRVIQVWFQN
Sbjct:    4 CAGCERPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRRFGTKCAGCAQGISPSDLVRRARS-KVFHLNCFTCMMCNKQLSTGEELYIID-ENKFVCKEDY----------------------LNNNNNNNNAAKENSFISVTGSDPSL-SPESQDPLQDDAKDSESANISDKEAGVNE----NDDQNLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQN 233          
BLAST of LIM homeobox 1b vs. Ensembl Xenopus
Match: klf2 (Kruppel-like factor 2 [Source:Xenbase;Acc:XB-GENE-485035])

HSP 1 Score: 144.821 bits (364), Expect = 7.960e-38
Identity = 97/259 (37.45%), Postives = 140/259 (54.05%), Query Frame = 1
Query:  250 CYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYD---DLVSEIDPSVD---ETYCSDN-DKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            C  C +PI D+F+  + D +WH +C++C +C C LT KCF  + +  C  D+ R+   KC+ C   I PSD V    +  +FH NCF C  C+++L +G+  Y     +  VC+ DY S                 + L  S ++S               +S+   RS S +L D   D   E D S     ET  ++N +++   +RR PRTTIKA QL++LKA F+ TPKP+R +RE+LA+ TGL+MRVIQVWFQN
Sbjct:    5 CAGCERPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKTDFFRRFGTKCAGCSLGISPSDLVRKARN-KVFHLNCFTCMVCNKQLSTGEELYIIDE-NKFVCKEDYAS----------------ASSLKESSLNS---------------VSSCTDRSLSPDLQDPIQDESKETDHSTSSDKETANNENEEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQN 230          
BLAST of LIM homeobox 1b vs. Ensembl Xenopus
Match: LMX1B (LIM homeobox transcription factor 1, beta, gene 1 [Source:NCBI gene;Acc:100495130])

HSP 1 Score: 111.309 bits (277), Expect = 5.269e-26
Identity = 76/253 (30.04%), Postives = 125/253 (49.41%), Query Frame = 1
Query:  247 ICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            +C  C +PI+D+F+ R+ + SWH++CL+C  C   LT+ C+  D +  C +DY +    KCS C   I P++ V+      ++H +CF C  C+++L  GD +        ++C+ DY   K          + ++      SD    ++ +G+V                 G  +          V++   SD+ K    R + PRT +   Q  + KA+F ++ KP R++RE LA  TGLS+RV+QVWFQN
Sbjct:   55 VCEGCQRPISDRFLMRVNEASWHEECLQCTVCQQPLTTSCYFRDRKLFCKQDYQQLFAAKCSGCMEKIAPTEFVMRALE-CVYHLSCFCCCVCERQLRKGDEFVLKE--GQLLCKSDYEKEK----------DLLSSGSPDDSDSVKSDDEEGDV---------------KPGKCH----------VNQGKGSDDGKD-PRRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQN 268          
BLAST of LIM homeobox 1b vs. Ensembl Xenopus
Match: dcp1b (decapping mRNA 1B [Source:Xenbase;Acc:XB-GENE-877165])

HSP 1 Score: 108.997 bits (271), Expect = 2.373e-25
Identity = 72/253 (28.46%), Postives = 118/253 (46.64%), Query Frame = 1
Query:  247 ICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            +C  C   I+D+F+ R+ D SWH+ C++C  C   L+  C+  + +  C EDY +    KC+ C   + PS+ ++   S +++H  CF C  C+++L  GD +        ++C+ DY   K          E ++   L  S     E+  G          ++ + +S  G          DP                R + PRT +   Q  + KA+F ++ KP R++RE LA  TGL++RV+QVWFQN
Sbjct:   26 VCAGCGNTISDRFLLRVNDRSWHECCVKCAACLQILSGTCYYRNRQLYCKEDYDKLFATKCNSCLKTVLPSELIMRVLS-NVYHVACFFCCECERRLERGDEFVLKE--GQLLCRSDYEREK----------EMLSALSLTPSGSVKSEDEDG----------ASLQGKSDEGK---------DPK---------------RSKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLTVRVVQVWFQN 231          
BLAST of LIM homeobox 1b vs. Ensembl Mouse
Match: Lhx1 (LIM homeobox protein 1 [Source:MGI Symbol;Acc:MGI:99783])

HSP 1 Score: 147.902 bits (372), Expect = 5.563e-39
Identity = 93/255 (36.47%), Postives = 129/255 (50.59%), Query Frame = 1
Query:  250 CYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDN---DKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            C  C +PI D+F+  + D +WH +C++C +C C LT KCF  + +  C  D+ R    KC+ C   I PSD V    S  +FH NCF C  C+++L +G+  Y     +  VC+ DY                          + +    K N  H  TT      S  S     DD       +V +     N   D++   +RR PRTTIKA QL++LKA F+ TPKP+R +RE+LA+ TGL+MRVIQVWFQN
Sbjct:    4 CAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCAQGISPSDLVRRARS-KVFHLNCFTCMMCNKQLSTGEELYIID-ENKFVCKEDY--------------------------LSNSSVAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKEGGSNENDDQNLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQN 230          
BLAST of LIM homeobox 1b vs. Ensembl Mouse
Match: Lhx5 (LIM homeobox protein 5 [Source:MGI Symbol;Acc:MGI:107792])

HSP 1 Score: 140.969 bits (354), Expect = 1.553e-36
Identity = 94/259 (36.29%), Postives = 139/259 (53.67%), Query Frame = 1
Query:  250 CYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDL---VSEIDPSVD---ETYCSDN-DKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            C  C +PI D+F+  + D +WH +C++C +C   L+ KCF  + +  C  D+ R+   KC+ C   I PSD V    S  +FH NCF C  C+++L +G+  Y     +  VC+ DY                ++ + L    ++S               +S+   RS S +L D L     E D S     ET  ++N +++   +RR PRTTIKA QL++LKA F+ TPKP+R +RE+LA+ TGL+MRVIQVWFQN
Sbjct:    5 CAGCERPILDRFLLNVLDRAWHIKCVQCCECKTNLSEKCFSREGKLYCKNDFFRRFGTKCAGCAQGISPSDLVRKARS-KVFHLNCFTCMVCNKQLSTGEELYVID-ENKFVCKDDY----------------LSSSSLKEGSLNS---------------VSSCTDRSLSPDLQDPLQDDPKETDNSTSSDKETANNENEEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQN 230          
BLAST of LIM homeobox 1b vs. Ensembl Mouse
Match: Lmx1b (LIM homeobox transcription factor 1 beta [Source:MGI Symbol;Acc:MGI:1100513])

HSP 1 Score: 117.472 bits (293), Expect = 1.779e-28
Identity = 81/280 (28.93%), Postives = 132/280 (47.14%), Query Frame = 1
Query:  187 IKLEIASTNPEV----VLLKMTVP---ICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            IK+E  +  P      VLL    P   +C  C +PI+D+F+ R+ + SWH++CL+C  C   LT+ C+  D +  C +DY +    KCS C   I P++ V+      ++H  CF C  C+++L  GD +        ++C+ DY                  K + + S +   E++             + +S    G++             ++  S +D     R + PRT +   Q  + KA+F ++ KP R++RE LA  TGLS+RV+QVWFQN
Sbjct:    5 IKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCYFRDRKLYCKQDYQQLFAAKCSGCMEKIAPTEFVMRALEC-VYHLGCFCCCVCERQLRKGDEFVLKE--GQLLCKGDY-----------------EKEKDLLSSVSPDESD-------------SVKSEDEDGDM-----KPAKGQGSQSKGSGDDGKDPRRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQN 246          
BLAST of LIM homeobox 1b vs. Ensembl Mouse
Match: Lmx1b (LIM homeobox transcription factor 1 beta [Source:MGI Symbol;Acc:MGI:1100513])

HSP 1 Score: 116.316 bits (290), Expect = 4.645e-28
Identity = 77/264 (29.17%), Postives = 126/264 (47.73%), Query Frame = 1
Query:  223 VLLKMTVP---ICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            VLL    P   +C  C +PI+D+F+ R+ + SWH++CL+C  C   LT+ C+  D +  C +DY +    KCS C   I P++ V+      ++H  CF C  C+++L  GD +        ++C+ DY                  K + + S +   E++             + +S    G++             ++  S +D     R + PRT +   Q  + KA+F ++ KP R++RE LA  TGLS+RV+QVWFQN
Sbjct:   11 VLLGSDCPHPAVCEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCYFRDRKLYCKQDYQQLFAAKCSGCMEKIAPTEFVMRALEC-VYHLGCFCCCVCERQLRKGDEFVLKE--GQLLCKGDY-----------------EKEKDLLSSVSPDESD-------------SVKSEDEDGDM-----KPAKGQGSQSKGSGDDGKDPRRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQN 236          
BLAST of LIM homeobox 1b vs. Ensembl Mouse
Match: Lmx1a (LIM homeobox transcription factor 1 alpha [Source:MGI Symbol;Acc:MGI:1888519])

HSP 1 Score: 105.916 bits (263), Expect = 2.078e-24
Identity = 73/253 (28.85%), Postives = 115/253 (45.45%), Query Frame = 1
Query:  247 ICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            +C  C + I+D+F+ R+ D  WH+QC++C  C   L + CF  D +  C   Y +    KC  C   I P++ V+     S++H +CF C  C+++L  GD +        ++C+ DY                  + EL+                   +++S   S S      DD  S    +      +  D     R + PRT +   Q  + KA+F ++ KP R++RE LA  TGLS+RV+QVWFQN
Sbjct:   34 VCEGCQRVISDRFLLRLNDSFWHEQCVQCASCKEPLETTCFYRDKKLYCKYHYEKLFAVKCGGCFEAIAPNEFVMRAQK-SVYHLSCFCCCVCERQLQKGDEFVLKE--GQLLCKGDYE----------------KERELL-------------------SLVSPAASDSGKS---DDEESLCKSAHGAGKGASEDGKDHKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQN 245          
BLAST of LIM homeobox 1b vs. UniProt/SwissProt
Match: sp|P53411|LHX1_CHICK (LIM/homeobox protein Lhx1 OS=Gallus gallus OX=9031 GN=LHX1 PE=2 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 9.235e-39
Identity = 93/255 (36.47%), Postives = 130/255 (50.98%), Query Frame = 1
Query:  250 CYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDN---DKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            C  C +PI D+F+  + D +WH +C++C +C C LT KCF  + +  C  D+ R    KC+ C   I PSD V    S  +FH NCF C  C+++L +G+  Y     +  VC+ DY                          +++    K N  H  TT      S  S     DD       +V +     N   D++   +RR PRTTIKA QL++LKA F+ TPKP+R +RE+LA+ TGL+MRVIQVWFQN
Sbjct:    4 CAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCAQGISPSDLVRRARS-KVFHLNCFTCMMCNKQLSTGEELYIID-ENKFVCKEDY--------------------------LNNSNTAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKETGSNENDDQNLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQN 230          
BLAST of LIM homeobox 1b vs. UniProt/SwissProt
Match: sp|P29674|LHX1_XENLA (LIM/homeobox protein Lhx1 OS=Xenopus laevis OX=8355 GN=lhx1 PE=1 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 1.357e-38
Identity = 94/260 (36.15%), Postives = 138/260 (53.08%), Query Frame = 1
Query:  250 CYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDY----NSLKHELF----GDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            C  C +PI D+F+  + D +WH +C++C +C C LT KCF  + +  C  D+ R+   KC+ C   I PSD V    S  +FH NCF C  C+++L +G+  Y     +  VC+ DY    N+ K   F    G D +    ++  L     DS+  N                            VS+ +  ++E    ++D++   +RR PRTTIKA QL++LKA F+ TPKP+R +RE+LA+ TGL+MRVIQVWFQN
Sbjct:    4 CAGCERPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRRFGTKCAGCAQGISPSDLVRRARS-KVFHLNCFTCMMCNKQLSTGEELYIID-ENKFVCKEDYLNNNNAAKENSFISVTGSDPSLSPESQDPLQDDAKDSESAN----------------------------VSDKEAGINE----NDDQNLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQN 229          
BLAST of LIM homeobox 1b vs. UniProt/SwissProt
Match: sp|P48742|LHX1_HUMAN (LIM/homeobox protein Lhx1 OS=Homo sapiens OX=9606 GN=LHX1 PE=1 SV=2)

HSP 1 Score: 148.288 bits (373), Expect = 2.551e-38
Identity = 93/255 (36.47%), Postives = 129/255 (50.59%), Query Frame = 1
Query:  250 CYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDN---DKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            C  C +PI D+F+  + D +WH +C++C +C C LT KCF  + +  C  D+ R    KC+ C   I PSD V    S  +FH NCF C  C+++L +G+  Y     +  VC+ DY                          + +    K N  H  TT      S  S     DD       +V +     N   D++   +RR PRTTIKA QL++LKA F+ TPKP+R +RE+LA+ TGL+MRVIQVWFQN
Sbjct:    4 CAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCAQGISPSDLVRRARS-KVFHLNCFTCMMCNKQLSTGEELYIID-ENKFVCKEDY--------------------------LSNSSVAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKEAGSNENDDQNLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQN 230          
BLAST of LIM homeobox 1b vs. UniProt/SwissProt
Match: sp|Q90476|LHX1_DANRE (LIM/homeobox protein Lhx1 OS=Danio rerio OX=7955 GN=lhx1a PE=2 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 2.824e-38
Identity = 93/252 (36.90%), Postives = 137/252 (54.37%), Query Frame = 1
Query:  250 CYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            C  C +PI D+F+  + D +WH +C++C +C C LT KCF  + +  C  D+ R+   KC+ C   I P+D V    S  +FH NCF C  C+++L +G+  Y     +  VC+ DY S  +   G DSN   +          DSQ+  + +V       I+N   + +  N                   ++D++   +RR PRTTIKA QL++LKA F+ TPKP+R +RE+LA+ TGL+MRVIQVWFQN
Sbjct:    4 CAGCERPILDRFLLNVLDRAWHIKCVQCCECKCNLTEKCFSREGKLYCKNDFFRRFGTKCAGCAQGISPNDLVRRARS-KVFHLNCFTCMMCNKQLSTGEELYIIDE-NKFVCKDDYLSNTN---GKDSNLLSVTACSDPSLSPDSQDQLQDDVK---DAEIANLSDKETGNN------------------ENDDQNLGGKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQN 229          
BLAST of LIM homeobox 1b vs. UniProt/SwissProt
Match: sp|P63007|LHX1_RAT (LIM/homeobox protein Lhx1 OS=Rattus norvegicus OX=10116 GN=Lhx1 PE=1 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 3.892e-38
Identity = 93/255 (36.47%), Postives = 129/255 (50.59%), Query Frame = 1
Query:  250 CYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDN---DKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            C  C +PI D+F+  + D +WH +C++C +C C LT KCF  + +  C  D+ R    KC+ C   I PSD V    S  +FH NCF C  C+++L +G+  Y     +  VC+ DY                          + +    K N  H  TT      S  S     DD       +V +     N   D++   +RR PRTTIKA QL++LKA F+ TPKP+R +RE+LA+ TGL+MRVIQVWFQN
Sbjct:    4 CAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCAQGISPSDLVRRARS-KVFHLNCFTCMMCNKQLSTGEELYIID-ENKFVCKEDY--------------------------LSNSSVAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKEGGSNENDDQNLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQN 230          
BLAST of LIM homeobox 1b vs. TrEMBL
Match: A7S9E9 (Predicted protein (Fragment) OS=Nematostella vectensis OX=45351 GN=v1g109857 PE=4 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 1.408e-38
Identity = 96/257 (37.35%), Postives = 128/257 (49.81%), Query Frame = 1
Query:  241 VPICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEI--RRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            V  C  C  PI DKF+ ++ D  WH QC++C+ C C LT +CF  + +  C  D+ R+   KCS C   I P+D V     L +FH +CF C+YC +++ +GD  Y    GS I C+ DY                                     +H   T                +L   ID   D +Y  D D    +  +RR PRTTIKA QL++LK+TF+ TPKPSR +REKLA+ TGL+MRVIQVWFQN
Sbjct:    2 VQQCAGCQLPIADKFLLKVLDGVWHAQCVQCSDCKCPLTERCFSREGKLFCKTDFYRRYGTKCSGCDQGISPNDMVRRAKHL-VFHVDCFVCSYCKRQITTGDELYYIGDGSFI-CRDDY-------------------------------------YHSHPT----------------NLDDAIDEPKDLSYGLDEDLDAALASKRRGPRTTIKAKQLEALKSTFAATPKPSRNIREKLAQETGLNMRVIQVWFQN 203          
BLAST of LIM homeobox 1b vs. TrEMBL
Match: A0A3Q2Q986 (LIM homeobox 1b OS=Fundulus heteroclitus OX=8078 PE=4 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 1.667e-38
Identity = 97/254 (38.19%), Postives = 129/254 (50.79%), Query Frame = 1
Query:  250 CYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCS-DNDKSCEI-RRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            C  C KPI D+F+ ++ D  WH +C++C +C C LT KCF  D    C  D+ R+   KC  C   I PSD V    S  +FH NCF C  C+++L +G+  Y        VC+ DY +                             N K  +    TT      S  S     D   SE  P+ D+  C  DND+   + +RR PRTTIKA QL++LKA F+ TPKP+R +RE+L+  TGL+MRVIQVWFQN
Sbjct:    4 CADCEKPILDRFLLKVLDRPWHIKCVQCCECKCSLTEKCFSRDGRLYCKNDFFRRFGTKCGGCSQGILPSDLVRRAKS-KVFHLNCFTCMMCNKQLSTGEELYILDE-FKFVCKEDYQN----------------------------NNGKDTILLSVTTCSDPSLSPDSQDPQDDGKDSEGGPASDKEACGNDNDEQSAVGKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLSRETGLNMRVIQVWFQN 227          
BLAST of LIM homeobox 1b vs. TrEMBL
Match: A0A146WV33 (LIM homeobox 1b OS=Fundulus heteroclitus OX=8078 PE=4 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 1.748e-38
Identity = 97/254 (38.19%), Postives = 129/254 (50.79%), Query Frame = 1
Query:  250 CYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCS-DNDKSCEI-RRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            C  C KPI D+F+ ++ D  WH +C++C +C C LT KCF  D    C  D+ R+   KC  C   I PSD V    S  +FH NCF C  C+++L +G+  Y        VC+ DY +                             N K  +    TT      S  S     D   SE  P+ D+  C  DND+   + +RR PRTTIKA QL++LKA F+ TPKP+R +RE+L+  TGL+MRVIQVWFQN
Sbjct:    4 CADCEKPILDRFLLKVLDRPWHIKCVQCCECKCSLTEKCFSRDGRLYCKNDFFRRFGTKCGGCSQGILPSDLVRRAKS-KVFHLNCFTCMMCNKQLSTGEELYILDE-FKFVCKEDYQN----------------------------NNGKDTILLSVTTCSDPSLSPDSQDPQDDGKDSEGGPASDKEACGNDNDEQSAVGKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLSRETGLNMRVIQVWFQN 227          
BLAST of LIM homeobox 1b vs. TrEMBL
Match: C4B860 (LIM homeobox protein 1 OS=Nematostella vectensis OX=45351 GN=lhx1 PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 5.578e-38
Identity = 96/257 (37.35%), Postives = 128/257 (49.81%), Query Frame = 1
Query:  241 VPICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEI--RRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            V  C  C  PI DKF+ ++ D  WH QC++C+ C C LT +CF  + +  C  D+ R+   KCS C   I P+D V     L +FH +CF C+YC +++ +GD  Y    GS I C+ DY                                     +H   T                +L   ID   D +Y  D D    +  +RR PRTTIKA QL++LK+TF+ TPKPSR +REKLA+ TGL+MRVIQVWFQN
Sbjct:    2 VQQCAGCQLPIADKFLLKVLDGVWHAQCVQCSDCKCPLTERCFSREGKLFCKTDFYRRYGTKCSGCDQGISPNDMVRRAKHL-VFHVDCFVCSYCKRQITTGDELYYIGDGSFI-CRDDY-------------------------------------YHSHPT----------------NLDDAIDEPKDLSYGLDEDLDAALASKRRGPRTTIKAKQLEALKSTFAATPKPSRNIREKLAQETGLNMRVIQVWFQN 203          
BLAST of LIM homeobox 1b vs. TrEMBL
Match: Q58F18 (LHX1 protein (Fragment) OS=Homo sapiens OX=9606 GN=LHX1 PE=2 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 6.011e-38
Identity = 93/255 (36.47%), Postives = 128/255 (50.20%), Query Frame = 1
Query:  250 CYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDN---DKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            C  C +PI D+F+  + D +WH +C++C +C C LT KCF  + +  C  D+ R    KC+ C   I PSD V    S  +FH NCF C  C+++L +G+  Y        VC+ DY                          + +    K N  H  TT      S  S     DD       +V +     N   D++   +RR PRTTIKA QL++LKA F+ TPKP+R +RE+LA+ TGL+MRVIQVWFQN
Sbjct:    4 CAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCAQGISPSDLVRRARS-KVFHLNCFTCMMCNKQLSTGEELYIIDENK-FVCKEDY--------------------------LSNSSVAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKEAGSNENDDQNLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQN 230          
BLAST of LIM homeobox 1b vs. Ensembl Cavefish
Match: lhx1a (LIM/homeobox protein Lhx1 [Source:NCBI gene;Acc:103025442])

HSP 1 Score: 147.132 bits (370), Expect = 7.832e-39
Identity = 91/252 (36.11%), Postives = 136/252 (53.97%), Query Frame = 1
Query:  250 CYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            C  C +PI D+F+  + D +WH +C++C +C C LT KCF  + +  C  D+ R+   KC+ C   I P+D V    S  +FH NCF C  C+++L +G+  Y     +  VC+ DY S  +   G D+N   +          DSQ+  + +V       +S+  + S+                       +D++   +RR PRTTIKA QL++LKA F+ TPKP+R +RE+LA+ TGL+MRVIQVWFQN
Sbjct:    4 CAGCERPILDRFLLNVLDRAWHIKCVQCCECKCNLTEKCFSREGKLYCKNDFFRRFGTKCAGCAQGISPNDLVRRARS-KVFHLNCFTCMMCNKQLSTGEELYIID-ENKFVCKDDYLSNSN---GKDTNLLSVTACSDPSLSPDSQDPLQDDVKDSEIAALSDKEAPSNEA---------------------DDQNLGGKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQN 229          
BLAST of LIM homeobox 1b vs. Ensembl Cavefish
Match: lhx1b (LIM/homeobox protein Lhx1-like [Source:NCBI gene;Acc:103026395])

HSP 1 Score: 144.436 bits (363), Expect = 7.264e-38
Identity = 94/256 (36.72%), Postives = 135/256 (52.73%), Query Frame = 1
Query:  250 CYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQI---NKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDND-KSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            C  C +PI D+F+  + D +WH +C++C  C C LT KCF  +    C  D+ R+   KC+ C   I P+D V    +  +FH NCF C  C+++L +G+  Y     S  +C+ DY S    L  D +    +   ++  L     D  E+ K                 S +G L D           ET  ++ND ++   +RR PRTTIKA QL++LKA F+ TPKP+R +RE+LA+ TGL+MRVIQVWFQN
Sbjct:    4 CAGCERPILDRFLLNVLDRAWHTKCVQCCDCKCNLTEKCFSREGRLYCRTDFFRRFGTKCAGCSQVISPTDLVRRARN-KVFHLNCFTCIMCNKQLSTGEELYILEE-SKFLCKEDYFSNNSPL-KDSTQLSAVTACSEPSLSPDPQDVHEDGK----------------DSEAGQLSD----------KETGSTENDEQTSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQN 230          
BLAST of LIM homeobox 1b vs. Ensembl Cavefish
Match: lhx5 (LIM/homeobox protein Lhx5 [Source:NCBI gene;Acc:103047421])

HSP 1 Score: 138.658 bits (348), Expect = 6.422e-36
Identity = 91/261 (34.87%), Postives = 134/261 (51.34%), Query Frame = 1
Query:  250 CYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDND---------KSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            C  C +PI D+F+  + D +WH +C++C +C   LT +CF  + +  C ED+ R+   KC+ C   I P D V       +FH NCF C  C+++L +G+  Y     +  VC+ DY                   T +   +++S               +S+   RS S +L +    +     D + CSD D          +C+ +RR PRTTIKA QL++LKA F  TPKP+R +RE+LA+ TGL+MRVIQVWFQN
Sbjct:    4 CAGCARPILDRFLLNVLDRAWHAECVQCCECGRALTERCFSREGKLYCREDFIRRFGTKCAGCLQGISPGDLVRRARG-KVFHLNCFTCAACNKQLSTGEELYVIDE-NKFVCKEDYTG-----------------TSIREVNLNS---------------VSSCTDRSLSPDLPEPGPDDTK-ETDNSTCSDKDTNNNENEEQGACQ-KRRGPRTTIKAKQLETLKAAFVATPKPTRHIREQLAQETGLNMRVIQVWFQN 228          
BLAST of LIM homeobox 1b vs. Ensembl Cavefish
Match: lmx1ba (LIM homeobox transcription factor 1, beta a [Source:NCBI gene;Acc:554361])

HSP 1 Score: 115.931 bits (289), Expect = 2.006e-28
Identity = 79/253 (31.23%), Postives = 121/253 (47.83%), Query Frame = 1
Query:  247 ICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            +C  C +PI D+F+ R+ + SWH++CL+C  C   LT  C+  D +  C  DY R    KCS C   I P++ V+     S++H  CF C  C+++L  GD +      S ++C+ DY   K          + +N      SD  S++ +             + +    SG               +   SD+ K    R + PRT +   Q  + KA+F ++ KP R++RE LA  TGLS+RV+QVWFQN
Sbjct:   30 VCAGCQRPIADRFLLRVNESSWHEECLQCAVCQQPLTMSCYCRDRKVYCKHDYQRLFATKCSGCLEKIAPTEFVMRALK-SVYHLGCFCCCVCERQLCKGDEFVLKD--SQLLCKKDYEREK----------DLLNAISPEMSDSKSEDED------------VDVKPEKGSGG--------------QNKGSDDSKDSR-RPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQN 242          
BLAST of LIM homeobox 1b vs. Ensembl Cavefish
Match: lmx1a (LIM homeobox transcription factor 1-alpha-like [Source:NCBI gene;Acc:103031184])

HSP 1 Score: 113.235 bits (282), Expect = 3.549e-27
Identity = 80/254 (31.50%), Postives = 119/254 (46.85%), Query Frame = 1
Query:  247 ICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDY-NSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            +C  C++PI ++F+ R+    WH++C RC +C   L   C+  DN+  C  DY R    +C  C   I P++ V++  S ++FH  CF C+ C  +L  GDR      G  ++C  DY +SL      D              S+ +  E+ +GN+  K T            GN   D                     E R + PRT +   Q  + KA+F ++ KP R++RE LA  TGLS+RV+QVWFQN
Sbjct:   22 VCAGCSRPIRERFLLRVHCGVWHERCARCCECGELLKKSCYSRDNKLYCRTDYQRLFLVRCRACTEVISPAELVMHAGS-AVFHLRCFCCSVCSCRLQKGDRCVLV--GDRLLCTRDYQHSLSSPTTSDSGR-----------SEDEDDEDEEGNL--KMT----------GDGNTAGDG--------------------EKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQN 229          
BLAST of LIM homeobox 1b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009847.1 (pep scaffold:Pmarinus_7.0:GL481168:3356:14379:1 gene:ENSPMAG00000008904.1 transcript:ENSPMAT00000009847.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.0409 bits (214), Expect = 1.858e-19
Identity = 37/52 (71.15%), Postives = 46/52 (88.46%), Query Frame = 1
Query:  850 RRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            +RR PRTTIKA QL++L+A F+ TPKPSR +RE+LA+ TGL+MRVIQVWFQN
Sbjct:   26 KRRGPRTTIKAKQLETLRAAFAATPKPSRHVREQLAQETGLNMRVIQVWFQN 77          
BLAST of LIM homeobox 1b vs. Ensembl Sea Lamprey
Match: lmo4b (LIM domain only 4b [Source:ZFIN;Acc:ZDB-GENE-030131-3570])

HSP 1 Score: 62.7734 bits (151), Expect = 7.379e-12
Identity = 36/120 (30.00%), Postives = 57/120 (47.50%), Query Frame = 1
Query:  250 CYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQ---LTSKCFELDNEFLCPEDYSRX-XXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFD 597
            C  C   I D+F+    D  WH +CL+C+ C  Q   L + C+      LC +DY R           G   P+ +++     +++H  CF C  C  +L+ GDR++ Y  GS + C+ D
Sbjct:   18 CAGCGGKIADRFLLYSMDCYWHSRCLKCSCCQAQLGDLGTSCYTRQGMILCRDDYIRMFGSSGACNACGQSIPASELVMKTQGNVYHLKCFACATCRTRLVPGDRFH-YVNGS-LFCEHD 135          
BLAST of LIM homeobox 1b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011272.1 (pep scaffold:Pmarinus_7.0:GL495005:1654:1833:1 gene:ENSPMAG00000010245.1 transcript:ENSPMAT00000011272.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 1.050e-11
Identity = 24/57 (42.11%), Postives = 35/57 (61.40%), Query Frame = 1
Query:  241 VPICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSR 411
            +P C  CN+ I D+FI ++ D +WH +CL+C  C  Q++ KCF  D    C ED+ R
Sbjct:    4 IPQCAGCNQHILDRFILKVLDRAWHSKCLKCCDCQAQMSDKCFYRDGSVYCKEDFFR 60          
BLAST of LIM homeobox 1b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002189.1 (pep scaffold:Pmarinus_7.0:GL483992:1961:4872:1 gene:ENSPMAG00000001979.1 transcript:ENSPMAT00000002189.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 6.691e-11
Identity = 43/172 (25.00%), Postives = 69/172 (40.12%), Query Frame = 1
Query:  490 IFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            I+H  CFRC  C ++L+ GD +     G  ++C+ D +                                 G    +  + + + RS   SG +                 S  +K+  +R     T +   QL +L+  ++  P+P   M+E+L E TGLS RVI+VWFQN
Sbjct:   27 IYHMECFRCETCSRQLLPGDEFALRD-GGGLLCRADQH---------HGGGGGGGAGGAGGGAGGGGGGLLGTALTRPGSPVHSSRSLHLSGGIP----------------SGPEKATRVR-----TVLNEKQLQTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQN 167          
BLAST of LIM homeobox 1b vs. Ensembl Sea Lamprey
Match: lmo2 (LIM domain only 2 (rhombotin-like 1) [Source:NCBI gene;Acc:30332])

HSP 1 Score: 56.225 bits (134), Expect = 8.977e-10
Identity = 35/131 (26.72%), Postives = 61/131 (46.56%), Query Frame = 1
Query:  217 EVVLLKMTVPICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEF---LCPEDYSRXXXX-XXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFD 597
            EV+ +   + +C  C +PI+D+++ +  +  WH+ CL C+ C C+L      L  +    LC  DY R   +       G    + ++       ++H  CF+C  C +    GDRY   +  S I+C+ D
Sbjct:   19 EVLRMPPMMLMCGGCRQPISDRYLLKAIEQFWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGHCASCGKRIRAFEMTMRVRDKVYHLECFKCAACQKHFCVGDRYLLVN--SDIICEQD 147          
BLAST of LIM homeobox 1b vs. Ensembl Yeast
Match: PHO2 (Homeobox transcription factor; regulatory targets include genes involved in phosphate metabolism; binds cooperatively with Pho4p to the PHO5 promoter; phosphorylation of Pho2p facilitates interaction with Pho4p; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000002264])

HSP 1 Score: 47.7506 bits (112), Expect = 2.806e-6
Identity = 20/51 (39.22%), Postives = 30/51 (58.82%), Query Frame = 1
Query:  853 RRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            +R  RT  K   LD LK  F I P PS   R+K+++  G+  + +++WFQN
Sbjct:   77 QRPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQN 127          
BLAST of LIM homeobox 1b vs. Ensembl Nematostella
Match: LHX1 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9E9])

HSP 1 Score: 150.214 bits (378), Expect = 1.947e-42
Identity = 96/257 (37.35%), Postives = 128/257 (49.81%), Query Frame = 1
Query:  241 VPICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEI--RRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            V  C  C  PI DKF+ ++ D  WH QC++C+ C C LT +CF  + +  C  D+ R+   KCS C   I P+D V     L +FH +CF C+YC +++ +GD  Y    GS I C+ DY                                     +H   T                +L   ID   D +Y  D D    +  +RR PRTTIKA QL++LK+TF+ TPKPSR +REKLA+ TGL+MRVIQVWFQN
Sbjct:    2 VQQCAGCQLPIADKFLLKVLDGVWHAQCVQCSDCKCPLTERCFSREGKLFCKTDFYRRYGTKCSGCDQGISPNDMVRRAKHL-VFHVDCFVCSYCKRQITTGDELYYIGDGSFI-CRDDY-------------------------------------YHSHPT----------------NLDDAIDEPKDLSYGLDEDLDAALASKRRGPRTTIKAKQLEALKSTFAATPKPSRNIREKLAQETGLNMRVIQVWFQN 203          
BLAST of LIM homeobox 1b vs. Ensembl Nematostella
Match: EDO46073 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR95])

HSP 1 Score: 93.9745 bits (232), Expect = 4.054e-21
Identity = 78/261 (29.89%), Postives = 113/261 (43.30%), Query Frame = 1
Query:  232 KMTVPICYKCNKPINDKFITRIR-DHSWHDQCLRCNQCSCQLTSKC--FELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            K  V +C  C   I+D++I R+  D  WH  CL+C  C   L  KC  F  + +  C  DY R    KC+KC      +D V+   +  I+H +CFRC  C ++L+ GD +     G  + C+ D     HE+    +   Q                N G             RS  S G        +  PS  +T     D+   +     RT +   QL +L+  ++  P+P   M+E+L E TGLS RVI+VWFQN
Sbjct:   11 KRRVSMCVGCGSQIHDQYILRVAPDLEWHASCLKCADCHMYLDEKCTCFVREGKTYCKRDYVRLFGTKCAKCSLNFSKNDFVMRARN-KIYHIDCFRCVACSRQLVPGDEFALREDG--LFCKAD-----HEIVEKATATAQATHVR-----------NNGQ------------RSSQSGGQTNGQTTPDSTPSKRKT-----DRPTRV-----RTVLNEKQLHTLRTCYNANPRPDAMMKEQLVEMTGLSPRVIRVWFQN 230          
BLAST of LIM homeobox 1b vs. Ensembl Nematostella
Match: EDO43354 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYP5])

HSP 1 Score: 92.0485 bits (227), Expect = 4.373e-21
Identity = 71/256 (27.73%), Postives = 111/256 (43.36%), Query Frame = 1
Query:  244 PICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSK--CFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
             +C  C   I ++F     D  WH  CL+C+ C  +L ++  CF  D   LC EDY R+   K          S +++      ++H NCF C+ C + L +G+  Y    G  I C+ DY  L  E   +  N  +IN              +KG    +   I +   S ++ G    D   E+    D             R +  RT+ K  QL ++K  F++   P  +  ++L++ TGL+ RV+QVWFQN
Sbjct:    7 AVCAGCGSRILERFYLMAVDQEWHADCLKCSDCELRLDNELTCFSKDGVILCREDYYRRFSVKKCSSCSQAISSKELVMRARDQVYHVNCFACDRCKRMLATGE--YFGMRGIRIYCKEDYEELLRE---ESRNPTKINSL------------SKGRPRKR--RIATAIESITNLGYDLSDRPGELTTGADG------------RPKRVRTSFKHHQLRAMKTYFAMNHNPDAKDLKQLSQKTGLTKRVLQVWFQN 231          
BLAST of LIM homeobox 1b vs. Ensembl Nematostella
Match: EDO34370 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPK5])

HSP 1 Score: 85.5001 bits (210), Expect = 1.937e-18
Identity = 70/254 (27.56%), Postives = 108/254 (42.52%), Query Frame = 1
Query:  250 CYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLT--SKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            C  C   I D+++ ++   +WH +CL+C  CS +L   + C+  D +  C  DY+R+   KC++C   I  +D V    +  ++H  CF C+ C ++L +G+  +    G V+ C+  Y                     L   D    E +   VF                            P VD     ++ KS   + +  RTT    QL  L+A F+I   P  Q  E++A+ TGLS RV QVWFQN
Sbjct:   28 CVGCEAKIVDRYLVKVSGRAWHTKCLKCCLCSDELGREATCYTKDGKIYCKADYARQFGTKCARCGRSIHANDWVRRAKNC-VYHLACFACDNCKRQLSTGEE-FALKDGHVL-CKLHY---------------------LEALDTSPAERDYQEVF---------------------------SPDVDGDDSPNSLKSGRHKAKRVRTTFTEDQLQILQANFNIDSNPDGQDLERIAQLTGLSKRVTQVWFQN 230          
BLAST of LIM homeobox 1b vs. Ensembl Nematostella
Match: EDO37316 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG43])

HSP 1 Score: 62.7734 bits (151), Expect = 8.710e-12
Identity = 35/132 (26.52%), Postives = 61/132 (46.21%), Query Frame = 1
Query:  238 TVPICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQL---TSKCFELDNEFLCPEDYSRXXX-XXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHEL 621
            ++ +C  C + I D+F+    D  WH  CL+C+ C  +L    + C+      LC  DY R             + P+ +++      ++H +CF C  C  +L+ GDR++  + G +     D N LK +L
Sbjct:   15 SMRVCAGCGEKIIDRFLLLALDQYWHVNCLKCSCCEARLGEIGTSCYSKGGMILCKTDYVRLYGNSGACAVCAKLIPATELVMKVLGKVYHLHCFTCTTCHNQLVPGDRFHVVN-GRLFCENDDPNLLKQQL 145          
BLAST of LIM homeobox 1b vs. Ensembl Medaka
Match: lhx1b (LIM/homeobox protein Lhx1 [Source:NCBI gene;Acc:101155626])

HSP 1 Score: 149.828 bits (377), Expect = 8.197e-40
Identity = 96/254 (37.80%), Postives = 127/254 (50.00%), Query Frame = 1
Query:  250 CYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCS-DNDKSCEI-RRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            C  C KPI D+F+ ++ D  WH +C++C +C C LT KCF  D    C  D+ R+   KC  C   I PSD V    S  +FH NCF C  C+++L +G+  Y        VC+ DY +                             N K  +    TT      S  S     D   SE     D+  C  DND+   + +RR PRTTIKA QL++LKA F+ TPKP+R +RE+L+  TGL+MRVIQVWFQN
Sbjct:    4 CTSCEKPILDRFLLKVLDRPWHVKCVQCCECKCSLTEKCFSRDGRLYCKNDFFRRFGTKCGGCSQGILPSDLVRRAKS-KVFHLNCFTCVMCNKQLSTGEELYILDE-FKFVCKEDYQN----------------------------SNGKDTILLSVTTCSEPSLSPDSQDPQDDGKDSESGHLSDKDACGNDNDEQSAVGKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLSRETGLNMRVIQVWFQN 227          
BLAST of LIM homeobox 1b vs. Ensembl Medaka
Match: lhx1a (LIM homeobox 1 [Source:NCBI gene;Acc:100049230])

HSP 1 Score: 145.591 bits (366), Expect = 2.298e-38
Identity = 97/256 (37.89%), Postives = 139/256 (54.30%), Query Frame = 1
Query:  250 CYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDY---NSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDN-DKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            C  C +PI D+F+  + D +WH +C++C +C C LT KCF  +    C  D+ R+   KC  C   I P+D V    S  +FH NCF C  C+++L +G+  Y     +  VC+ DY   +S+K      D+N   +          DSQ+  + +V  K T I +          L D           ET  ++N D++   +RR PRTTIKA QL++LKA F+ TPKP+R +RE+LA+ TGL+MRVIQVWFQN
Sbjct:    4 CAGCERPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGRLYCKNDFFRRFGTKCGGCSQGISPNDLVRRARS-KVFHLNCFTCMMCNKQLSTGEELYIID-ENKFVCKEDYLSNSSVK------DTNLLSVTACSDPSLSPDSQDPLQDDVVLKDTEIAA----------LSD----------KETVNNENDDQNLGGKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQN 231          
BLAST of LIM homeobox 1b vs. Ensembl Medaka
Match: lhx5 (LIM homeobox 5 [Source:NCBI gene;Acc:101166400])

HSP 1 Score: 144.821 bits (364), Expect = 3.954e-38
Identity = 94/260 (36.15%), Postives = 136/260 (52.31%), Query Frame = 1
Query:  247 ICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYD---DLVSEIDPSVDETYCSDN----DKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            +C  C +PI D+F+  + D +WH +C++C  C+C LT KCF  D +  C  D+ R+   KC+ C   I P+D V    S  +FH NCF C  C+++L +G+  Y     +  VC+ DY S                                G++       +S+   RS S +L D   D + E D S      ++N    +++   +RR PRTTIKA QL++LKA F  TPKP+R +RE+LA+ TGL+MRVIQVWFQN
Sbjct:    4 LCAGCERPILDRFLLNVLDRAWHAKCVQCCDCNCNLTEKCFSRDGKLYCKMDFFRRFGTKCAGCLQGISPNDLVRKARS-KVFHLNCFTCMVCNKQLSTGEELYVIDE-NKFVCKEDYLS-------------------------------PGSIKEVSLNSVSSCTDRSLSPDLPDPTQDDIKETDNSTSSDKETNNIENEEQNSGAKRRGPRTTIKAKQLETLKAAFVATPKPTRHIREQLAQETGLNMRVIQVWFQN 230          
BLAST of LIM homeobox 1b vs. Ensembl Medaka
Match: lmx1a (LIM homeobox transcription factor 1-alpha-like [Source:NCBI gene;Acc:101175472])

HSP 1 Score: 114.39 bits (285), Expect = 1.462e-27
Identity = 79/253 (31.23%), Postives = 116/253 (45.85%), Query Frame = 1
Query:  247 ICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            +C  C + I D+F+ R+ D  WH++C+RC  C   L + CF L+ +  C  DYS      C  C   I PS+ V+   + ++FH +CF C+ C   L +GDR      G ++  + DY+ L+      D     I K     S  D +E     V  K              G  +D                +N      R + PRT +   Q  + KA+F ++ KP R++RE LA  TGLS+RV+QVWFQN
Sbjct:   15 VCVGCQRRITDRFLLRVADGLWHERCVRCAACGDALRNSCFLLERKLYCKRDYSSLFAVHCGGCAEAISPSELVMRAGA-AVFHLSCFTCSVCFHHLKTGDRCILQD-GRLLCAREDYHQLQASPPSSD-----IGK-----SGDDEEEEPSAKVMDK-------------PGRSHD---------------QENK-----RPKRPRTILTTQQRRTFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQN 222          
BLAST of LIM homeobox 1b vs. Ensembl Medaka
Match: lmx1bb (LIM homeobox transcription factor 1 beta [Source:NCBI gene;Acc:101159592])

HSP 1 Score: 114.005 bits (284), Expect = 8.661e-27
Identity = 76/253 (30.04%), Postives = 118/253 (46.64%), Query Frame = 1
Query:  247 ICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            +C  C +PI+D+F+ R+ D SWH++CL+C  C   LT+ C+  + +  C  DY +    KCS C   I P++ V+      ++H NCF C  CD++L  GD +        ++C+ DY   K  L     +     K++    DI  ++                 + +   G          DP                R + PRT +   Q  + KA+F ++ KP R++RE LA  TGLS+RV+QVWFQN
Sbjct:  119 VCEGCQRPISDRFLMRVNDSSWHEECLQCAVCQQPLTTSCYLRERKLYCKHDYQQLFATKCSGCMEKIAPTEFVMRALE-CVYHLNCFCCCVCDRQLRKGDEFVLKE--GQLLCKVDYEREKDLLSSVSPDDSDSEKSDDEELDIKPEKG-------------IGSQGKGDDGK---------DPR---------------RPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQN 331          
BLAST of LIM homeobox 1b vs. Planmine SMEST
Match: SMESG000022856.1 (SMESG000022856.1)

HSP 1 Score: 656.751 bits (1693), Expect = 0.000e+0
Identity = 348/348 (100.00%), Postives = 348/348 (100.00%), Query Frame = 1
Query:  235 MTVPICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQNXXXXXXXXXXXXXXXXXXYRFSIQNDITRSENLSNVPVNSKFVQRNLDHQDVHIHLNAVSRNYEVISNSQTEQMNDGRYASNWFMNRSVDV 1278
            MTVPICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRKKFKKCSKCKGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQNRRSKERRSKLSSQRKLEKYRFSIQNDITRSENLSNVPVNSKFVQRNLDHQDVHIHLNAVSRNYEVISNSQTEQMNDGRYASNWFMNRSVDV
Sbjct:    1 MTVPICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNEFLCPEDYSRKKFKKCSKCKGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQNRRSKERRSKLSSQRKLEKYRFSIQNDITRSENLSNVPVNSKFVQRNLDHQDVHIHLNAVSRNYEVISNSQTEQMNDGRYASNWFMNRSVDV 348          
BLAST of LIM homeobox 1b vs. Planmine SMEST
Match: SMESG000039808.1 (SMESG000039808.1)

HSP 1 Score: 118.242 bits (295), Expect = 8.474e-29
Identity = 89/269 (33.09%), Postives = 127/269 (47.21%), Query Frame = 1
Query:  241 VPICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFEL--DNEFL-CPEDY-SRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKF-----TTIISNYRSRS-----SSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            +P C  C  PI DK +  I D  WH+ C+ CN C   L   C+E   D +++ C  D+  +K+  KC  C+  I PSD V+      IFH +CF+C+ C  KL SGDRY       ++   F Y++               N   L++ + + + N  GN+ +         I  NY  +S     S  N + D  +    S++   C           + PRT +  SQ    KA F   PKPSR++RE LA  TGLS+RV+QVWFQN
Sbjct:    1 MPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIKKKQSSKCQSCQMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGSSSI------NSTNSNVLLYIEQNHKINRAGNIDNSINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGG------LKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQN 257          
BLAST of LIM homeobox 1b vs. Planmine SMEST
Match: SMESG000005304.1 (SMESG000005304.1)

HSP 1 Score: 100.138 bits (248), Expect = 1.881e-22
Identity = 75/259 (28.96%), Postives = 112/259 (43.24%), Query Frame = 1
Query:  232 KMTVPICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFEL-DNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            K+  P C  CN  INDK++  + D  WH  C  C+ C   L   CF L DN+  C   Y +  F            + +V       ++H  CF C+ C Q L  GD +  + P S++VC+ DY S  +     ++    +N  +  FS  DS E +      K   I   Y    +  +      S  D S  + Y   +  + ++  + PRTT+   Q   L   F     P+ + RE LAE   L ++V+QVWFQN
Sbjct:   28 KVDNPSCTGCNGVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNT----LNDCDQSFSHKDSNETSM-----KELQISYQYHEDGTGKH------SSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQN 271          
BLAST of LIM homeobox 1b vs. Planmine SMEST
Match: SMESG000001774.1 (SMESG000001774.1)

HSP 1 Score: 97.0561 bits (240), Expect = 3.998e-22
Identity = 75/262 (28.63%), Postives = 119/262 (45.42%), Query Frame = 1
Query:  247 ICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQL--TSKCFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTEL--IFSDIDSQ-----ENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            +C  C   I DK+  R  +H WH  CL+C+ C   L  T+ C++ +  F C  DY R   ++            +++     S+FH +CF C  C ++L SG+  Y    G+++ CQ                 ++I K+ +  IFS I S      +NN+      F +I S  + R   G L D++   I P   +       K     ++  RT+ K  Q+  ++  FS+   P  +  + L+E TGLS RV+QVWFQN
Sbjct:   11 LCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGE--YFLLNGNILFCQ-----------------DEIRKSSISTIFSGIQSDFRLGLQNNQS----LFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISK-----QKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQN 244          
BLAST of LIM homeobox 1b vs. Planmine SMEST
Match: SMESG000010916.1 (SMESG000010916.1)

HSP 1 Score: 92.4337 bits (228), Expect = 6.691e-20
Identity = 80/273 (29.30%), Postives = 121/273 (44.32%), Query Frame = 1
Query:  250 CYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSK--CFELDNEFLCPEDYSRXXXXXXXXXXGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDI-DSQENNKGNV-----FHKFTTIISNYRSRSSSGNLYDDLV-----------SEIDP--SVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQN 1005
            C  C   I D+F  +  D  WH  CLRC  C  +L S+  CF  D    C EDYSR   +KC    G     D+++      +FH  CF C  C + L  G+  Y    G +  CQ            DD     IN +E    ++ +   N++ +V     FH  + + + Y S  +  + +  ++           SE+D      E +C  N      R++  RT+ K  QL ++K+ F++   P  +  + L+E TGLS RV+QVWFQN
Sbjct:   31 CAGCKSKITDRFFLKAADKMWHVNCLRCWICHVELHSEMSCFTRDGVVYCKEDYSRLFGRKCCIRCGVKITYDELVMRVKNLVFHVTCFCCVQCGRMLNPGE--YFGLKGLLPFCQ------------DDLIKNPINMSEDFIHNLQNGLTNSQASVPHLFLFHPLSRLNNFYHSPLNDSHNFHSIIPKVRGKKKRKGSELDNLYETSEDFCIGNAS----RQKRMRTSFKHHQLRAMKSYFALNHNPDAKDLKSLSEKTGLSKRVLQVWFQN 285          
The following BLAST results are available for this feature:
BLAST of LIM homeobox 1b vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LHX15.313e-3936.47LIM homeobox 1 [Source:HGNC Symbol;Acc:HGNC:6593][more]
LHX15.313e-3936.47LIM homeobox 1 [Source:HGNC Symbol;Acc:HGNC:6593][more]
LHX51.473e-3636.29LIM homeobox 5 [Source:HGNC Symbol;Acc:HGNC:14216][more]
LMX1B4.766e-2828.93LIM homeobox transcription factor 1 beta [Source:H... [more]
LMX1B5.164e-2828.93LIM homeobox transcription factor 1 beta [Source:H... [more]
back to top
BLAST of LIM homeobox 1b vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin-115.456e-3432.95pep chromosome:WBcel235:I:10248256:10255327:1 gene... [more]
mec-31.843e-2631.62Mechanosensory protein 3 [Source:UniProtKB/Swiss-... [more]
mec-32.868e-2231.20Mechanosensory protein 3 [Source:UniProtKB/Swiss-... [more]
mec-33.718e-2230.54Mechanosensory protein 3 [Source:UniProtKB/Swiss-... [more]
lim-61.720e-2129.07LIM domain family [Source:UniProtKB/TrEMBL;Acc:G4... [more]
back to top
BLAST of LIM homeobox 1b vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lim14.533e-3636.59gene:FBgn0026411 transcript:FBtr0071279[more]
CG43282.308e-2325.72gene:FBgn0036274 transcript:FBtr0301071[more]
Awh4.378e-2028.74gene:FBgn0013751 transcript:FBtr0073155[more]
Awh7.718e-2028.74gene:FBgn0013751 transcript:FBtr0330071[more]
Awh8.036e-2028.74gene:FBgn0013751 transcript:FBtr0073156[more]
back to top
BLAST of LIM homeobox 1b vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lhx1a3.741e-3936.90LIM homeobox 1a [Source:NCBI gene;Acc:30463][more]
lhx56.989e-3837.16LIM homeobox 5 [Source:NCBI gene;Acc:30465][more]
lhx1b1.615e-3736.86LIM homeobox 1b [Source:ZFIN;Acc:ZDB-GENE-980526-1... [more]
lhx1b1.615e-3736.86LIM homeobox 1b [Source:ZFIN;Acc:ZDB-GENE-980526-1... [more]
lmx1ba4.316e-2931.23LIM homeobox transcription factor 1, beta a [Sourc... [more]
back to top
BLAST of LIM homeobox 1b vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gfm24.233e-3834.65G elongation factor, mitochondrial 2 [Source:Xenba... [more]
gfm25.228e-3836.29G elongation factor, mitochondrial 2 [Source:Xenba... [more]
klf27.960e-3837.45Kruppel-like factor 2 [Source:Xenbase;Acc:XB-GENE-... [more]
LMX1B5.269e-2630.04LIM homeobox transcription factor 1, beta, gene 1 ... [more]
dcp1b2.373e-2528.46decapping mRNA 1B [Source:Xenbase;Acc:XB-GENE-8771... [more]
back to top
BLAST of LIM homeobox 1b vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lhx15.563e-3936.47LIM homeobox protein 1 [Source:MGI Symbol;Acc:MGI:... [more]
Lhx51.553e-3636.29LIM homeobox protein 5 [Source:MGI Symbol;Acc:MGI:... [more]
Lmx1b1.779e-2828.93LIM homeobox transcription factor 1 beta [Source:M... [more]
Lmx1b4.645e-2829.17LIM homeobox transcription factor 1 beta [Source:M... [more]
Lmx1a2.078e-2428.85LIM homeobox transcription factor 1 alpha [Source:... [more]
back to top
BLAST of LIM homeobox 1b vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P53411|LHX1_CHICK9.235e-3936.47LIM/homeobox protein Lhx1 OS=Gallus gallus OX=9031... [more]
sp|P29674|LHX1_XENLA1.357e-3836.15LIM/homeobox protein Lhx1 OS=Xenopus laevis OX=835... [more]
sp|P48742|LHX1_HUMAN2.551e-3836.47LIM/homeobox protein Lhx1 OS=Homo sapiens OX=9606 ... [more]
sp|Q90476|LHX1_DANRE2.824e-3836.90LIM/homeobox protein Lhx1 OS=Danio rerio OX=7955 G... [more]
sp|P63007|LHX1_RAT3.892e-3836.47LIM/homeobox protein Lhx1 OS=Rattus norvegicus OX=... [more]
back to top
BLAST of LIM homeobox 1b vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A7S9E91.408e-3837.35Predicted protein (Fragment) OS=Nematostella vecte... [more]
A0A3Q2Q9861.667e-3838.19LIM homeobox 1b OS=Fundulus heteroclitus OX=8078 P... [more]
A0A146WV331.748e-3838.19LIM homeobox 1b OS=Fundulus heteroclitus OX=8078 P... [more]
C4B8605.578e-3837.35LIM homeobox protein 1 OS=Nematostella vectensis O... [more]
Q58F186.011e-3836.47LHX1 protein (Fragment) OS=Homo sapiens OX=9606 GN... [more]
back to top
BLAST of LIM homeobox 1b vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lhx1a7.832e-3936.11LIM/homeobox protein Lhx1 [Source:NCBI gene;Acc:10... [more]
lhx1b7.264e-3836.72LIM/homeobox protein Lhx1-like [Source:NCBI gene;A... [more]
lhx56.422e-3634.87LIM/homeobox protein Lhx5 [Source:NCBI gene;Acc:10... [more]
lmx1ba2.006e-2831.23LIM homeobox transcription factor 1, beta a [Sourc... [more]
lmx1a3.549e-2731.50LIM homeobox transcription factor 1-alpha-like [So... [more]
back to top
BLAST of LIM homeobox 1b vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009847.11.858e-1971.15pep scaffold:Pmarinus_7.0:GL481168:3356:14379:1 ge... [more]
lmo4b7.379e-1230.00LIM domain only 4b [Source:ZFIN;Acc:ZDB-GENE-03013... [more]
ENSPMAT00000011272.11.050e-1142.11pep scaffold:Pmarinus_7.0:GL495005:1654:1833:1 gen... [more]
ENSPMAT00000002189.16.691e-1125.00pep scaffold:Pmarinus_7.0:GL483992:1961:4872:1 gen... [more]
lmo28.977e-1026.72LIM domain only 2 (rhombotin-like 1) [Source:NCBI ... [more]
back to top
BLAST of LIM homeobox 1b vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PHO22.806e-639.22Homeobox transcription factor; regulatory targets ... [more]
back to top
BLAST of LIM homeobox 1b vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
LHX11.947e-4237.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460734.054e-2129.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433544.373e-2127.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343701.937e-1827.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373168.710e-1226.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of LIM homeobox 1b vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lhx1b8.197e-4037.80LIM/homeobox protein Lhx1 [Source:NCBI gene;Acc:10... [more]
lhx1a2.298e-3837.89LIM homeobox 1 [Source:NCBI gene;Acc:100049230][more]
lhx53.954e-3836.15LIM homeobox 5 [Source:NCBI gene;Acc:101166400][more]
lmx1a1.462e-2731.23LIM homeobox transcription factor 1-alpha-like [So... [more]
lmx1bb8.661e-2730.04LIM homeobox transcription factor 1 beta [Source:N... [more]
back to top
BLAST of LIM homeobox 1b vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022856.10.000e+0100.00SMESG000022856.1[more]
SMESG000039808.18.474e-2933.09SMESG000039808.1[more]
SMESG000005304.11.881e-2228.96SMESG000005304.1[more]
SMESG000001774.13.998e-2228.63SMESG000001774.1[more]
SMESG000010916.16.691e-2029.30SMESG000010916.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014138 ID=SMED30014138|Name=LIM homeobox 1b|organism=Schmidtea mediterranea sexual|type=transcript|length=1560bp
ATTCGATAAAGATTTGAGTAATAAAGCTCAAGTACAATTAATCATTAAAA
CCACCATAATCATCGAACCATACATTTTTGGCTTCACAATTAAGAAATGT
CTATTGCGTATATTATCGATTAATGATTGGCTGAATTCCTACAATTCCAA
TAATAATTCCTCAATTCTGATTGGAAAGCTTTATTTATTAAATTAGAAAT
TGCATCAACAAATCCAGAAGTTGTTTTGTTGAAAATGACAGTGCCAATTT
GCTACAAATGTAACAAACCGATAAACGATAAATTCATTACAAGGATCCGT
GATCATTCTTGGCATGATCAATGTCTTCGTTGTAATCAATGTAGTTGTCA
GTTGACCTCAAAATGCTTTGAACTTGACAACGAATTTTTATGTCCTGAAG
ACTATTCTAGAAAGAAATTCAAAAAATGTTCTAAGTGTAAGGGACCTATT
TTTCCATCGGATAAAGTTCTATATACAGATTCTTTGTCGATTTTTCATCA
GAATTGTTTTCGGTGTAATTATTGTGATCAGAAATTGATATCCGGTGACA
GATATTACACGTATTCCCCAGGTTCTGTGATTGTCTGCCAATTCGACTAC
AACAGCTTGAAACATGAATTATTCGGTGATGATTCCAACTGTGAACAAAT
CAATAAAACTGAACTTATTTTTTCCGATATCGATTCCCAAGAAAATAACA
AAGGAAATGTCTTCCACAAATTCACGACAATTATATCAAATTATAGATCA
AGATCATCCTCTGGAAATCTATATGATGACTTAGTCAGCGAAATTGATCC
CAGCGTCGATGAAACTTATTGCTCAGATAATGATAAAAGCTGTGAAATTC
GAAGACGAACTCCAAGAACAACAATAAAAGCATCCCAACTTGATTCACTG
AAAGCAACTTTTTCTATCACACCCAAACCAAGCAGACAAATGAGAGAAAA
ACTTGCGGAATGTACTGGTCTTAGTATGAGAGTAATTCAAGTTTGGTTTC
AAAATCGAAGAAGTAAGGAAAGACGATCTAAATTAAGTTCACAAAGAAAG
CTAGAAAAATACCGATTTTCAATTCAGAATGACATAACTCGAAGTGAAAA
CTTATCAAATGTGCCAGTGAATTCGAAATTTGTACAAAGAAATCTGGACC
ACCAAGATGTCCATATCCATTTGAATGCAGTCTCGCGAAATTATGAAGTG
ATTTCGAATTCTCAAACGGAGCAAATGAATGATGGCAGATACGCATCAAA
CTGGTTCATGAACAGATCTGTGGATGTATGAGAATTAATGCATTCATTTA
TTCATTCTTTTTATTCAATTTTGGTAAAAAATATGGAGGAATTATTCGTA
TGGTTTACCAAAGCGGTTGTTAATAAATTATTTATACAGATATTTGTACA
TTGATATTGTTTGTTGAGAAGGACAAATTTTATTTTTTTGGAGATTCTTC
CGGTTACCAGACCAATAAGTTTTTTGAATTTGATCTGTACCATGGTAGGA
TTGTGTTTTTTGGGGGCCCTTCACAAATTTTTTTCTGGAACCGATTAAGT
ATGAATTAAG
back to top

protein sequence of SMED30014138-orf-1

>SMED30014138-orf-1 ID=SMED30014138-orf-1|Name=SMED30014138-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=349bp
MTVPICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFELDNE
FLCPEDYSRKKFKKCSKCKGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQK
LISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDID
SQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDND
KSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRV
IQVWFQNRRSKERRSKLSSQRKLEKYRFSIQNDITRSENLSNVPVNSKFV
QRNLDHQDVHIHLNAVSRNYEVISNSQTEQMNDGRYASNWFMNRSVDV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR001781Znf_LIM
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
IPR001356Homeobox_dom
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0008270zinc ion binding
GO:0043565sequence-specific DNA binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001781Zinc finger, LIM-typeSMARTSM00132lim_4coord: 64..121
e-value: 1.6E-5
score: 34.3
coord: 5..56
e-value: 3.1E-13
score: 60.0
IPR001781Zinc finger, LIM-typePFAMPF00412LIMcoord: 65..124
e-value: 9.2E-8
score: 32.2
coord: 6..60
e-value: 7.3E-13
score: 48.5
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 6..40
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 65..101
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 4..63
score: 12.672
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 64..128
score: 8.89
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 207..269
e-value: 1.6E-22
score: 90.8
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 208..264
e-value: 4.0E-19
score: 68.2
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 205..265
score: 18.188
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 208..266
e-value: 9.13085E-19
score: 76.8984
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 60..174
e-value: 1.8E-13
score: 52.8
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 1..59
e-value: 3.2E-17
score: 64.1
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 202..269
e-value: 1.1E-21
score: 78.3
NoneNo IPR availablePANTHERPTHR24208FAMILY NOT NAMEDcoord: 4..296
NoneNo IPR availablePANTHERPTHR24208:SF105DLIM1coord: 4..296
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 32..98
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 3..30
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 240..263
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 190..266