Centrosome-associated protein 350

Overview
NameCentrosome-associated protein 350
Smed IDSMED30014136
Length (bp)4055
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Centrosome-associated protein 350 (SMED30014136) t-SNE clustered cells

Violin plots show distribution of expression levels for Centrosome-associated protein 350 (SMED30014136) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Centrosome-associated protein 350 (SMED30014136) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Centrosome-associated protein 350 (SMED30014136) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014136

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30014136h1SMcG0016061 SmedASXL_018726SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30014136h1SMcG0016061 SmedASXL_011079SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30014136h1SMcG0016061 SmedASXL_011079SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30014136h1SMcG0016061 dd_Smed_v4_20651_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014136h1SMcG0016061 dd_Smed_v4_20651_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30014136h1SMcG0016061 dd_Smed_v6_20651_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30014136h1SMcG0016061 dd_Smed_v4_20651_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Centrosome-associated protein 350 vs. Ensembl Human
Match: DCTN1 (dynactin subunit 1 [Source:HGNC Symbol;Acc:HGNC:2711])

HSP 1 Score: 101.679 bits (252), Expect = 6.441e-21
Identity = 118/562 (21.00%), Postives = 250/562 (44.48%), Query Frame = 1
Query: 1186 LQILKKKEYKRCGDLEKLNNELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSMLK------NSDGTSDAKIFIDQTSTINKYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKK-----AKAKD--RELS----------------SLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQQRDNSEKTP-------ENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLENN 2742
            +Q  K K  ++  DL++   E ++E  +A E +ER       Y + M    + IEM T+DKEMAEE+ E + Q+   LK+  +++  +  +LK       SDG + +           + K+AL+ +    +  K+E+  L       N EL+++++       + E+L+ ++ + E  + E+K+ VD+    E +++ LT +N                           +E K +++RE   + + +N + +E+Q    + ++E  E L   +    R+      ++  +  +    + +KK     A  +D  REL+                +  F  +  E     + IE +L+ +E++  +  + LL  ++P SF  PGG+HD +  + ++ +LI K  L+ +   +K   ++  +N  + P       E +     L + L +    L + +  +   S +   ++ S + ++   E+++D LI+L+ K  LD + N   + ++I ++Q+ Y+     Q  DC +++ + I       +C+  ++  +   L+  
Sbjct:  238 VQEWKSKMQEQQADLQRRLKEARKEAKEALEAKER-------YMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQ-------QRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLN-------------------------LEEKVRELRETVGDLEAMNEMNDELQENARETELELREQL---DMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELIRKQAQEK---FELSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDCTMQLADHIKFTQSALDCMSVEVGRLRAFLQGG 754          

HSP 2 Score: 67.781 bits (164), Expect = 1.751e-10
Identity = 40/112 (35.71%), Postives = 60/112 (53.57%), Query Frame = 1
Query:  145 GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQ-STEVTSSE--NEVHDKLLNSCGETRDLTAQTSDKIASHIKTNNIVTSVPSIINS 471
            GTV ++G+T  A G + G+ L  A G+ DGT+ G  YF C E HGIF R+SQ+   +   + TS E  +    K+L    E  D TA+TS K+ +   +  +  +  S+  S
Sbjct:   42 GTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKR--EGTDTTAKTS-KLPTRPASTGVAGASSSLGPS 150          
BLAST of Centrosome-associated protein 350 vs. Ensembl Human
Match: DCTN1 (dynactin subunit 1 [Source:HGNC Symbol;Acc:HGNC:2711])

HSP 1 Score: 101.679 bits (252), Expect = 7.006e-21
Identity = 118/562 (21.00%), Postives = 250/562 (44.48%), Query Frame = 1
Query: 1186 LQILKKKEYKRCGDLEKLNNELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSMLK------NSDGTSDAKIFIDQTSTINKYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKK-----AKAKD--RELS----------------SLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQQRDNSEKTP-------ENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLENN 2742
            +Q  K K  ++  DL++   E ++E  +A E +ER       Y + M    + IEM T+DKEMAEE+ E + Q+   LK+  +++  +  +LK       SDG + +           + K+AL+ +    +  K+E+  L       N EL+++++       + E+L+ ++ + E  + E+K+ VD+    E +++ LT +N                           +E K +++RE   + + +N + +E+Q    + ++E  E L   +    R+      ++  +  +    + +KK     A  +D  REL+                +  F  +  E     + IE +L+ +E++  +  + LL  ++P SF  PGG+HD +  + ++ +LI K  L+ +   +K   ++  +N  + P       E +     L + L +    L + +  +   S +   ++ S + ++   E+++D LI+L+ K  LD + N   + ++I ++Q+ Y+     Q  DC +++ + I       +C+  ++  +   L+  
Sbjct:  251 VQEWKSKMQEQQADLQRRLKEARKEAKEALEAKER-------YMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQ-------QRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLN-------------------------LEEKVRELRETVGDLEAMNEMNDELQENARETELELREQL---DMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELIRKQAQEK---FELSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDCTMQLADHIKFTQSALDCMSVEVGRLRAFLQGG 767          

HSP 2 Score: 67.781 bits (164), Expect = 1.460e-10
Identity = 42/113 (37.17%), Postives = 59/113 (52.21%), Query Frame = 1
Query:  145 GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQ-STEVTSSE--NEVHDKLLNSCGETRDLTAQTSDKIASHIKTNNIVTSVPSIINST 474
            GTV ++G+T  A G + G+ L  A G+ DGT+ G  YF C E HGIF R+SQ+   +   + TS E  +    K+L    E  D TA+TS K+A   +        P+   ST
Sbjct:   42 GTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKR--EGTDTTAKTS-KLAPTARKTTTRRPKPTRPAST 151          
BLAST of Centrosome-associated protein 350 vs. Ensembl Human
Match: DCTN1 (dynactin subunit 1 [Source:HGNC Symbol;Acc:HGNC:2711])

HSP 1 Score: 101.679 bits (252), Expect = 7.086e-21
Identity = 118/562 (21.00%), Postives = 250/562 (44.48%), Query Frame = 1
Query: 1186 LQILKKKEYKRCGDLEKLNNELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSMLK------NSDGTSDAKIFIDQTSTINKYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKK-----AKAKD--RELS----------------SLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQQRDNSEKTP-------ENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLENN 2742
            +Q  K K  ++  DL++   E ++E  +A E +ER       Y + M    + IEM T+DKEMAEE+ E + Q+   LK+  +++  +  +LK       SDG + +           + K+AL+ +    +  K+E+  L       N EL+++++       + E+L+ ++ + E  + E+K+ VD+    E +++ LT +N                           +E K +++RE   + + +N + +E+Q    + ++E  E L   +    R+      ++  +  +    + +KK     A  +D  REL+                +  F  +  E     + IE +L+ +E++  +  + LL  ++P SF  PGG+HD +  + ++ +LI K  L+ +   +K   ++  +N  + P       E +     L + L +    L + +  +   S +   ++ S + ++   E+++D LI+L+ K  LD + N   + ++I ++Q+ Y+     Q  DC +++ + I       +C+  ++  +   L+  
Sbjct:  258 VQEWKSKMQEQQADLQRRLKEARKEAKEALEAKER-------YMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQ-------QRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLN-------------------------LEEKVRELRETVGDLEAMNEMNDELQENARETELELREQL---DMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELIRKQAQEK---FELSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDCTMQLADHIKFTQSALDCMSVEVGRLRAFLQGG 774          

HSP 2 Score: 65.855 bits (159), Expect = 5.803e-10
Identity = 37/90 (41.11%), Postives = 51/90 (56.67%), Query Frame = 1
Query:  145 GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQ-STEVTSSE--NEVHDKLLNSCGETRDLTAQTS 405
            GTV ++G+T  A G + G+ L  A G+ DGT+ G  YF C E HGIF R+SQ+   +   + TS E  +    K+L    E  D TA+TS
Sbjct:   42 GTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKR--EGTDTTAKTS 129          
BLAST of Centrosome-associated protein 350 vs. Ensembl Human
Match: DCTN1 (dynactin subunit 1 [Source:HGNC Symbol;Acc:HGNC:2711])

HSP 1 Score: 101.679 bits (252), Expect = 7.575e-21
Identity = 118/562 (21.00%), Postives = 250/562 (44.48%), Query Frame = 1
Query: 1186 LQILKKKEYKRCGDLEKLNNELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSMLK------NSDGTSDAKIFIDQTSTINKYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKK-----AKAKD--RELS----------------SLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQQRDNSEKTP-------ENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLENN 2742
            +Q  K K  ++  DL++   E ++E  +A E +ER       Y + M    + IEM T+DKEMAEE+ E + Q+   LK+  +++  +  +LK       SDG + +           + K+AL+ +    +  K+E+  L       N EL+++++       + E+L+ ++ + E  + E+K+ VD+    E +++ LT +N                           +E K +++RE   + + +N + +E+Q    + ++E  E L   +    R+      ++  +  +    + +KK     A  +D  REL+                +  F  +  E     + IE +L+ +E++  +  + LL  ++P SF  PGG+HD +  + ++ +LI K  L+ +   +K   ++  +N  + P       E +     L + L +    L + +  +   S +   ++ S + ++   E+++D LI+L+ K  LD + N   + ++I ++Q+ Y+     Q  DC +++ + I       +C+  ++  +   L+  
Sbjct:  221 VQEWKSKMQEQQADLQRRLKEARKEAKEALEAKER-------YMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQ-------QRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLN-------------------------LEEKVRELRETVGDLEAMNEMNDELQENARETELELREQL---DMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELIRKQAQEK---FELSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDCTMQLADHIKFTQSALDCMSVEVGRLRAFLQGG 737          

HSP 2 Score: 67.781 bits (164), Expect = 1.603e-10
Identity = 40/112 (35.71%), Postives = 60/112 (53.57%), Query Frame = 1
Query:  145 GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQ-STEVTSSE--NEVHDKLLNSCGETRDLTAQTSDKIASHIKTNNIVTSVPSIINS 471
            GTV ++G+T  A G + G+ L  A G+ DGT+ G  YF C E HGIF R+SQ+   +   + TS E  +    K+L    E  D TA+TS K+ +   +  +  +  S+  S
Sbjct:   25 GTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKR--EGTDTTAKTS-KLPTRPASTGVAGASSSLGPS 133          
BLAST of Centrosome-associated protein 350 vs. Ensembl Human
Match: DCTN1 (dynactin subunit 1 [Source:HGNC Symbol;Acc:HGNC:2711])

HSP 1 Score: 100.908 bits (250), Expect = 8.225e-21
Identity = 115/562 (20.46%), Postives = 253/562 (45.02%), Query Frame = 1
Query: 1186 LQILKKKEYKRCGDLEKLNNELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSMLK------NSDGTSDAKIFIDQTSTINKYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKK-----AKAKD--RELS----------------SLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQQRDNSEKTP-------ENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLENN 2742
            +Q+ + +E+K    +++   +LQR L +A++  +   +  + Y + M    + IEM T+DKEMAEE+ E + Q+   LK+  +++  +  +LK       SDG + +           + K+AL+ +    +  K+E+  L       N EL+++++       + E+L+ ++ + E  + E+K+ VD+    E +++ LT +N                           +E K +++RE   + + +N + +E+Q    + ++E  E L   +    R+      ++  +  +    + +KK     A  +D  REL+                +  F  +  E     + IE +L+ +E++  +  + LL  ++P SF  PGG+HD +  + ++ +LI K  L+ +   +K   ++  +N  + P       E +     L + L +    L + +  +   S +   ++ S + ++   E+++D LI+L+ K  LD + N   + ++I ++Q+ Y+     Q  DC +++ + I       +C+  ++  +   L+  
Sbjct:  216 IQLEQVQEWK--SKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQ-------QRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLN-------------------------LEEKVRELRETVGDLEAMNEMNDELQENARETELELREQL---DMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELIRKQAQEK---FELSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDCTMQLADHIKFTQSALDCMSVEVGRLRAFLQGG 737          

HSP 2 Score: 67.3958 bits (163), Expect = 1.615e-10
Identity = 40/112 (35.71%), Postives = 60/112 (53.57%), Query Frame = 1
Query:  145 GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQ-STEVTSSE--NEVHDKLLNSCGETRDLTAQTSDKIASHIKTNNIVTSVPSIINS 471
            GTV ++G+T  A G + G+ L  A G+ DGT+ G  YF C E HGIF R+SQ+   +   + TS E  +    K+L    E  D TA+TS K+ +   +  +  +  S+  S
Sbjct:   25 GTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKR--EGTDTTAKTS-KLPTRPASTGVAGASSSLGPS 133          
BLAST of Centrosome-associated protein 350 vs. Ensembl Celegans
Match: dnc-1 (DyNactin Complex component [Source:UniProtKB/TrEMBL;Acc:E2JKZ0])

HSP 1 Score: 69.3218 bits (168), Expect = 1.926e-11
Identity = 102/483 (21.12%), Postives = 235/483 (48.65%), Query Frame = 1
Query: 1246 ELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSMLKN--SDGTSDAKIF----IDQTSTIN-KYKNALLELSQSINCYKEENRNLNSE--LDILKEL----QIFQENE-----SEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKKAKAKDRELSSLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQ--------KRRLYQQRDNSEKTPENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYA 2616
            EL++++ D +  +E+++   D  + ++   ++ +EM TI+KE+AEE+ + +  D   L +  E +  E  +LK   ++G   A++     + Q    N K K+AL++L           R+LN++  LD  K +    ++  EN      +E LK + E  E  +   ++ +D+    E ++ +LT KN  +E+ + +L++ + ++++  D   ++ E + +++++  +E + L + ++E+   +  ++    +L +T  +  ER+  L +++++++ ++    E +    + D + +S+    Q         D+E ++  IE+     Q   L  +LP +FS  GGE+D I  V ++ +L  K  L      Q         RR +  + +  +   ++    ++ +L       L +L+  I  ++ E L +L   + ++   E+ +D  ++L+KK   D + +    ++ + +FQN ++
Sbjct:  320 ELEKQIGDERIAKEQLQAWQDENKVLLSDHQDTMEMATIEKELAEERADSLQNDVLTLTEKLESMETELEILKEEMANGGGAAQVGNSVQMKQIEIQNDKLKDALIKL-----------RDLNAQATLDRQKAVDEAERLKTENSELIRVAENLKRQTEIAESKIAGFQEQIDAAMGAEAMVTQLTDKNFNMEERIMQLEETIEDMEEARDLDEQLAEVQKQQVKDLMKEIEQLKIHIHELNGRIRDEQKHAVDLSQTILKFRERMANLNSQIQDQKDQVLSLEEQLHGHISVDNDRASMVNQLQISANRNFAEDVERQVNAIEVEFARRQAGYLKAFLPDNFSRVGGENDSILLVVMLPRLAAKTKLFASLAAQCFPQVPGGMRREHVTKSHKGEQWAHVA---RVNYLANSINAALGKLESAIGETTVEVLIKLTETYGEMSTHEKTVDQYLELLKKSRFDENTSLDSFVRPLVYFQNMFS 788          

HSP 2 Score: 55.8398 bits (133), Expect = 2.349e-7
Identity = 26/67 (38.81%), Postives = 39/67 (58.21%), Query Frame = 1
Query:  103 FQIGDSVLYNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQL 303
            F+IG  V  +S   G V F G T  A+G + G+ L TA G+ +GT+  + YFEC+   G+F + S +
Sbjct:    3 FEIGTRVKTSSG-NGRVVFCGQTQFAEGDWVGVILDTATGKNNGTVQNVQYFECEPNFGVFVKSSAV 68          
BLAST of Centrosome-associated protein 350 vs. Ensembl Celegans
Match: dnc-1 (DyNactin Complex component [Source:UniProtKB/TrEMBL;Acc:E2JKZ0])

HSP 1 Score: 69.3218 bits (168), Expect = 1.938e-11
Identity = 102/483 (21.12%), Postives = 235/483 (48.65%), Query Frame = 1
Query: 1246 ELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSMLKN--SDGTSDAKIF----IDQTSTIN-KYKNALLELSQSINCYKEENRNLNSE--LDILKEL----QIFQENE-----SEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKKAKAKDRELSSLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQ--------KRRLYQQRDNSEKTPENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYA 2616
            EL++++ D +  +E+++   D  + ++   ++ +EM TI+KE+AEE+ + +  D   L +  E +  E  +LK   ++G   A++     + Q    N K K+AL++L           R+LN++  LD  K +    ++  EN      +E LK + E  E  +   ++ +D+    E ++ +LT KN  +E+ + +L++ + ++++  D   ++ E + +++++  +E + L + ++E+   +  ++    +L +T  +  ER+  L +++++++ ++    E +    + D + +S+    Q         D+E ++  IE+     Q   L  +LP +FS  GGE+D I  V ++ +L  K  L      Q         RR +  + +  +   ++    ++ +L       L +L+  I  ++ E L +L   + ++   E+ +D  ++L+KK   D + +    ++ + +FQN ++
Sbjct:  348 ELEKQIGDERIAKEQLQAWQDENKVLLSDHQDTMEMATIEKELAEERADSLQNDVLTLTEKLESMETELEILKEEMANGGGAAQVGNSVQMKQIEIQNDKLKDALIKL-----------RDLNAQATLDRQKAVDEAERLKTENSELIRVAENLKRQTEIAESKIAGFQEQIDAAMGAEAMVTQLTDKNFNMEERIMQLEETIEDMEEARDLDEQLAEVQKQQVKDLMKEIEQLKIHIHELNGRIRDEQKHAVDLSQTILKFRERMANLNSQIQDQKDQVLSLEEQLHGHISVDNDRASMVNQLQISANRNFAEDVERQVNAIEVEFARRQAGYLKAFLPDNFSRVGGENDSILLVVMLPRLAAKTKLFASLAAQCFPQVPGGMRREHVTKSHKGEQWAHVA---RVNYLANSINAALGKLESAIGETTVEVLIKLTETYGEMSTHEKTVDQYLELLKKSRFDENTSLDSFVRPLVYFQNMFS 816          

HSP 2 Score: 55.8398 bits (133), Expect = 2.340e-7
Identity = 26/67 (38.81%), Postives = 39/67 (58.21%), Query Frame = 1
Query:  103 FQIGDSVLYNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQL 303
            F+IG  V  +S   G V F G T  A+G + G+ L TA G+ +GT+  + YFEC+   G+F + S +
Sbjct:    3 FEIGTRVKTSSG-NGRVVFCGQTQFAEGDWVGVILDTATGKNNGTVQNVQYFECEPNFGVFVKSSAV 68          
BLAST of Centrosome-associated protein 350 vs. Ensembl Celegans
Match: dnc-1 (DyNactin Complex component [Source:UniProtKB/TrEMBL;Acc:E2JKZ0])

HSP 1 Score: 68.9366 bits (167), Expect = 2.735e-11
Identity = 102/483 (21.12%), Postives = 235/483 (48.65%), Query Frame = 1
Query: 1246 ELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSMLKN--SDGTSDAKIF----IDQTSTIN-KYKNALLELSQSINCYKEENRNLNSE--LDILKEL----QIFQENE-----SEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKKAKAKDRELSSLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQ--------KRRLYQQRDNSEKTPENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYA 2616
            EL++++ D +  +E+++   D  + ++   ++ +EM TI+KE+AEE+ + +  D   L +  E +  E  +LK   ++G   A++     + Q    N K K+AL++L           R+LN++  LD  K +    ++  EN      +E LK + E  E  +   ++ +D+    E ++ +LT KN  +E+ + +L++ + ++++  D   ++ E + +++++  +E + L + ++E+   +  ++    +L +T  +  ER+  L +++++++ ++    E +    + D + +S+    Q         D+E ++  IE+     Q   L  +LP +FS  GGE+D I  V ++ +L  K  L      Q         RR +  + +  +   ++    ++ +L       L +L+  I  ++ E L +L   + ++   E+ +D  ++L+KK   D + +    ++ + +FQN ++
Sbjct:  110 ELEKQIGDERIAKEQLQAWQDENKVLLSDHQDTMEMATIEKELAEERADSLQNDVLTLTEKLESMETELEILKEEMANGGGAAQVGNSVQMKQIEIQNDKLKDALIKL-----------RDLNAQATLDRQKAVDEAERLKTENSELIRVAENLKRQTEIAESKIAGFQEQIDAAMGAEAMVTQLTDKNFNMEERIMQLEETIEDMEEARDLDEQLAEVQKQQVKDLMKEIEQLKIHIHELNGRIRDEQKHAVDLSQTILKFRERMANLNSQIQDQKDQVLSLEEQLHGHISVDNDRASMVNQLQISANRNFAEDVERQVNAIEVEFARRQAGYLKAFLPDNFSRVGGENDSILLVVMLPRLAAKTKLFASLAAQCFPQVPGGMRREHVTKSHKGEQWAHVA---RVNYLANSINAALGKLESAIGETTVEVLIKLTETYGEMSTHEKTVDQYLELLKKSRFDENTSLDSFVRPLVYFQNMFS 578          
BLAST of Centrosome-associated protein 350 vs. Ensembl Celegans
Match: dnc-1 (DyNactin Complex component [Source:UniProtKB/TrEMBL;Acc:E2JKZ0])

HSP 1 Score: 68.5514 bits (166), Expect = 3.207e-11
Identity = 102/483 (21.12%), Postives = 235/483 (48.65%), Query Frame = 1
Query: 1246 ELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSMLKN--SDGTSDAKIF----IDQTSTIN-KYKNALLELSQSINCYKEENRNLNSE--LDILKEL----QIFQENE-----SEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKKAKAKDRELSSLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQ--------KRRLYQQRDNSEKTPENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYA 2616
            EL++++ D +  +E+++   D  + ++   ++ +EM TI+KE+AEE+ + +  D   L +  E +  E  +LK   ++G   A++     + Q    N K K+AL++L           R+LN++  LD  K +    ++  EN      +E LK + E  E  +   ++ +D+    E ++ +LT KN  +E+ + +L++ + ++++  D   ++ E + +++++  +E + L + ++E+   +  ++    +L +T  +  ER+  L +++++++ ++    E +    + D + +S+    Q         D+E ++  IE+     Q   L  +LP +FS  GGE+D I  V ++ +L  K  L      Q         RR +  + +  +   ++    ++ +L       L +L+  I  ++ E L +L   + ++   E+ +D  ++L+KK   D + +    ++ + +FQN ++
Sbjct:  373 ELEKQIGDERIAKEQLQAWQDENKVLLSDHQDTMEMATIEKELAEERADSLQNDVLTLTEKLESMETELEILKEEMANGGGAAQVGNSVQMKQIEIQNDKLKDALIKL-----------RDLNAQATLDRQKAVDEAERLKTENSELIRVAENLKRQTEIAESKIAGFQEQIDAAMGAEAMVTQLTDKNFNMEERIMQLEETIEDMEEARDLDEQLAEVQKQQVKDLMKEIEQLKIHIHELNGRIRDEQKHAVDLSQTILKFRERMANLNSQIQDQKDQVLSLEEQLHGHISVDNDRASMVNQLQISANRNFAEDVERQVNAIEVEFARRQAGYLKAFLPDNFSRVGGENDSILLVVMLPRLAAKTKLFASLAAQCFPQVPGGMRREHVTKSHKGEQWAHVA---RVNYLANSINAALGKLESAIGETTVEVLIKLTETYGEMSTHEKTVDQYLELLKKSRFDENTSLDSFVRPLVYFQNMFS 841          

HSP 2 Score: 55.8398 bits (133), Expect = 2.329e-7
Identity = 26/67 (38.81%), Postives = 39/67 (58.21%), Query Frame = 1
Query:  103 FQIGDSVLYNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQL 303
            F+IG  V  +S   G V F G T  A+G + G+ L TA G+ +GT+  + YFEC+   G+F + S +
Sbjct:    3 FEIGTRVKTSSG-NGRVVFCGQTQFAEGDWVGVILDTATGKNNGTVQNVQYFECEPNFGVFVKSSAV 68          
BLAST of Centrosome-associated protein 350 vs. Ensembl Celegans
Match: dnc-1 (DyNactin Complex component [Source:UniProtKB/TrEMBL;Acc:E2JKZ0])

HSP 1 Score: 68.5514 bits (166), Expect = 3.327e-11
Identity = 102/483 (21.12%), Postives = 235/483 (48.65%), Query Frame = 1
Query: 1246 ELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSMLKN--SDGTSDAKIF----IDQTSTIN-KYKNALLELSQSINCYKEENRNLNSE--LDILKEL----QIFQENE-----SEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKKAKAKDRELSSLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQ--------KRRLYQQRDNSEKTPENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYA 2616
            EL++++ D +  +E+++   D  + ++   ++ +EM TI+KE+AEE+ + +  D   L +  E +  E  +LK   ++G   A++     + Q    N K K+AL++L           R+LN++  LD  K +    ++  EN      +E LK + E  E  +   ++ +D+    E ++ +LT KN  +E+ + +L++ + ++++  D   ++ E + +++++  +E + L + ++E+   +  ++    +L +T  +  ER+  L +++++++ ++    E +    + D + +S+    Q         D+E ++  IE+     Q   L  +LP +FS  GGE+D I  V ++ +L  K  L      Q         RR +  + +  +   ++    ++ +L       L +L+  I  ++ E L +L   + ++   E+ +D  ++L+KK   D + +    ++ + +FQN ++
Sbjct:  345 ELEKQIGDERIAKEQLQAWQDENKVLLSDHQDTMEMATIEKELAEERADSLQNDVLTLTEKLESMETELEILKEEMANGGGAAQVGNSVQMKQIEIQNDKLKDALIKL-----------RDLNAQATLDRQKAVDEAERLKTENSELIRVAENLKRQTEIAESKIAGFQEQIDAAMGAEAMVTQLTDKNFNMEERIMQLEETIEDMEEARDLDEQLAEVQKQQVKDLMKEIEQLKIHIHELNGRIRDEQKHAVDLSQTILKFRERMANLNSQIQDQKDQVLSLEEQLHGHISVDNDRASMVNQLQISANRNFAEDVERQVNAIEVEFARRQAGYLKAFLPDNFSRVGGENDSILLVVMLPRLAAKTKLFASLAAQCFPQVPGGMRREHVTKSHKGEQWAHVA---RVNYLANSINAALGKLESAIGETTVEVLIKLTETYGEMSTHEKTVDQYLELLKKSRFDENTSLDSFVRPLVYFQNMFS 813          

HSP 2 Score: 55.8398 bits (133), Expect = 2.261e-7
Identity = 26/67 (38.81%), Postives = 39/67 (58.21%), Query Frame = 1
Query:  103 FQIGDSVLYNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQL 303
            F+IG  V  +S   G V F G T  A+G + G+ L TA G+ +GT+  + YFEC+   G+F + S +
Sbjct:    3 FEIGTRVKTSSG-NGRVVFCGQTQFAEGDWVGVILDTATGKNNGTVQNVQYFECEPNFGVFVKSSAV 68          
BLAST of Centrosome-associated protein 350 vs. Ensembl Fly
Match: Khc-73 (gene:FBgn0019968 transcript:FBtr0087357)

HSP 1 Score: 72.4034 bits (176), Expect = 3.408e-12
Identity = 30/68 (44.12%), Postives = 45/68 (66.18%), Query Frame = 1
Query:  109 IGDSVL---YNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQL 303
            +G+SVL   YN+   G +RF+G+T    G + G+EL T  G+ DG++ G+ YF+CK KHG+F R  +L
Sbjct: 1807 VGESVLIRPYNTS--GVIRFVGTTEFQPGAWIGVELDTPTGKNDGSVKGVQYFQCKPKHGMFVRSDKL 1872          
BLAST of Centrosome-associated protein 350 vs. Ensembl Fly
Match: Khc-73 (gene:FBgn0019968 transcript:FBtr0346265)

HSP 1 Score: 72.4034 bits (176), Expect = 3.612e-12
Identity = 30/68 (44.12%), Postives = 45/68 (66.18%), Query Frame = 1
Query:  109 IGDSVL---YNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQL 303
            +G+SVL   YN+   G +RF+G+T    G + G+EL T  G+ DG++ G+ YF+CK KHG+F R  +L
Sbjct: 1799 VGESVLIRPYNTS--GVIRFVGTTEFQPGAWIGVELDTPTGKNDGSVKGVQYFQCKPKHGMFVRSDKL 1864          
BLAST of Centrosome-associated protein 350 vs. Ensembl Fly
Match: Khc-73 (gene:FBgn0019968 transcript:FBtr0329956)

HSP 1 Score: 72.0182 bits (175), Expect = 3.641e-12
Identity = 30/68 (44.12%), Postives = 45/68 (66.18%), Query Frame = 1
Query:  109 IGDSVL---YNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQL 303
            +G+SVL   YN+   G +RF+G+T    G + G+EL T  G+ DG++ G+ YF+CK KHG+F R  +L
Sbjct: 1794 VGESVLIRPYNTS--GVIRFVGTTEFQPGAWIGVELDTPTGKNDGSVKGVQYFQCKPKHGMFVRSDKL 1859          
BLAST of Centrosome-associated protein 350 vs. Ensembl Fly
Match: Khc-73 (gene:FBgn0019968 transcript:FBtr0329955)

HSP 1 Score: 72.0182 bits (175), Expect = 3.731e-12
Identity = 30/68 (44.12%), Postives = 45/68 (66.18%), Query Frame = 1
Query:  109 IGDSVL---YNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQL 303
            +G+SVL   YN+   G +RF+G+T    G + G+EL T  G+ DG++ G+ YF+CK KHG+F R  +L
Sbjct: 1785 VGESVLIRPYNTS--GVIRFVGTTEFQPGAWIGVELDTPTGKNDGSVKGVQYFQCKPKHGMFVRSDKL 1850          
BLAST of Centrosome-associated protein 350 vs. Ensembl Fly
Match: Khc-73 (gene:FBgn0019968 transcript:FBtr0329957)

HSP 1 Score: 72.0182 bits (175), Expect = 3.914e-12
Identity = 30/68 (44.12%), Postives = 45/68 (66.18%), Query Frame = 1
Query:  109 IGDSVL---YNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQL 303
            +G+SVL   YN+   G +RF+G+T    G + G+EL T  G+ DG++ G+ YF+CK KHG+F R  +L
Sbjct: 1785 VGESVLIRPYNTS--GVIRFVGTTEFQPGAWIGVELDTPTGKNDGSVKGVQYFQCKPKHGMFVRSDKL 1850          
BLAST of Centrosome-associated protein 350 vs. Ensembl Zebrafish
Match: dctn1a (dynactin 1a [Source:ZFIN;Acc:ZDB-GENE-070117-2205])

HSP 1 Score: 114.775 bits (286), Expect = 4.358e-25
Identity = 160/738 (21.68%), Postives = 347/738 (47.02%), Query Frame = 1
Query: 1228 LEKLNNELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSML------KNSDGTSDAKIFIDQTSTIN-KYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKKAKAKDRELSSLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRL----YQQRDNSEKTPENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLE-NNVGEQTLKLMDNLN-----------KISTNVQST-MKNTQMYLRHNQRITFDSSVS-KSIDGIIFSLMDIVLSISDFALQLTDERIFS-----DEAMCRLTEIFANNRNPLNPTSDNEILF-SLNSIDKQVENIVSNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTA 3327
            +++  N+LQ++L +AK+      +  D Y + M    + IEM T+DKEMAEE+ E + Q+  +LK+  E++  +  +L      K SDG + +   + Q    N + K AL+ +    +  K+E+  L       NSEL+ L+       ++ E+L+ +++  E  + E+K+ VD+    E +++ LT +N  LE+++++L++ + +L+ + +   E+ E+  +   E  E+ D     V E Q  ++  +   ++  +T N+  E    L    +E   +     E +++  A   EL    F  +  E     + IE +L+ +E+S  + QV LL  ++P SF   GG+HD I  + ++ +LI K  L+ +   +K  L     ++        E +     L + L +    L + ++ +     +   ++   + ++   E+++D LIDL+ K  LD +     + ++I ++Q+ Y+   C Q  DC +++ + I       +C+ +++  +   L+    G +   L+ +L+           KI   +  T        LR +++++   + S K +  ++  L ++  + +     L ++   S     D A   + +++      LNP    E L  S +++   +  + +  + G YD+++  +     ++T A   R ++   + L  +++ ++ ++  + + LK K  +LSE  ++++  ++KL T+
Sbjct:  246 MQEQQNDLQKQLKEAKKEAREALEAKDRYMEEMADTADAIEMATLDKEMAEERAESLQQETESLKEKLEELTMDMEILKHEIEEKGSDGAASS-YHVKQLEEQNARLKEALVRMRDLSSSEKQEHVKLQKQMEKKNSELETLR-------SQKEKLQEEMKLAEDTIDELKEQVDAALGAEEMVETLTERNLDLEEKVRELRETVSDLESINEMNDELQENARETELELREQLDLAGARVREAQKRVEAAQETLADYQQTINKYRELTTHLQEVNRELTNQQSSSAEQLQQPAA---EL--FDFKIKFAETKAYAKAIEMELRKMEVSQANRQVSLLTSFMPESFLRHGGDHDCILVLLLIPRLICKAELISKQAQEKFDLTGGSLERAGLRGAAGEQLSFASGLVYSLTLLQATLHKYELALSVCGVDVYKRMGMLYSEMCVHERSLDFLIDLLHKDQLDETVQVEPLTKAIKYYQHLYSVHLCDQPEDCTVQLADHIKFTQSALDCMGSEVGRLRAFLQAGQEGAELCVLLKDLDTSCGDIRQFCKKIRRRMPGTDAPGIPAALRFSEQVSEALADSRKQLARVVAVLQEVSAAGAQMMAPLQEQEGLSAVKIEDVAFKAVEQVYGTQG--LNP---YECLRQSCSAVIATMNKMATAMQEGEYDSERPQRP-PPPVETRAAAVRAEMTDAEGLGNKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDTS 964          

HSP 2 Score: 66.6254 bits (161), Expect = 1.946e-10
Identity = 29/70 (41.43%), Postives = 42/70 (60.00%), Query Frame = 1
Query:  145 GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQSTEVTSSENEVHD 354
            GTV +IG+T  A G + G+ L  A G+ DGT+ G  YF C+E HGIF R+SQ+  +     +++  E  D
Sbjct:   25 GTVAYIGATLFASGKWVGVILDEAKGKNDGTVQGKRYFTCEENHGIFVRQSQIQLMDDGGSSATSPETPD 94          
BLAST of Centrosome-associated protein 350 vs. Ensembl Zebrafish
Match: dctn1a (dynactin 1a [Source:ZFIN;Acc:ZDB-GENE-070117-2205])

HSP 1 Score: 114.775 bits (286), Expect = 4.621e-25
Identity = 160/738 (21.68%), Postives = 347/738 (47.02%), Query Frame = 1
Query: 1228 LEKLNNELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSML------KNSDGTSDAKIFIDQTSTIN-KYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKKAKAKDRELSSLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRL----YQQRDNSEKTPENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLE-NNVGEQTLKLMDNLN-----------KISTNVQST-MKNTQMYLRHNQRITFDSSVS-KSIDGIIFSLMDIVLSISDFALQLTDERIFS-----DEAMCRLTEIFANNRNPLNPTSDNEILF-SLNSIDKQVENIVSNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTA 3327
            +++  N+LQ++L +AK+      +  D Y + M    + IEM T+DKEMAEE+ E + Q+  +LK+  E++  +  +L      K SDG + +   + Q    N + K AL+ +    +  K+E+  L       NSEL+ L+       ++ E+L+ +++  E  + E+K+ VD+    E +++ LT +N  LE+++++L++ + +L+ + +   E+ E+  +   E  E+ D     V E Q  ++  +   ++  +T N+  E    L    +E   +     E +++  A   EL    F  +  E     + IE +L+ +E+S  + QV LL  ++P SF   GG+HD I  + ++ +LI K  L+ +   +K  L     ++        E +     L + L +    L + ++ +     +   ++   + ++   E+++D LIDL+ K  LD +     + ++I ++Q+ Y+   C Q  DC +++ + I       +C+ +++  +   L+    G +   L+ +L+           KI   +  T        LR +++++   + S K +  ++  L ++  + +     L ++   S     D A   + +++      LNP    E L  S +++   +  + +  + G YD+++  +     ++T A   R ++   + L  +++ ++ ++  + + LK K  +LSE  ++++  ++KL T+
Sbjct:  214 MQEQQNDLQKQLKEAKKEAREALEAKDRYMEEMADTADAIEMATLDKEMAEERAESLQQETESLKEKLEELTMDMEILKHEIEEKGSDGAASS-YHVKQLEEQNARLKEALVRMRDLSSSEKQEHVKLQKQMEKKNSELETLR-------SQKEKLQEEMKLAEDTIDELKEQVDAALGAEEMVETLTERNLDLEEKVRELRETVSDLESINEMNDELQENARETELELREQLDLAGARVREAQKRVEAAQETLADYQQTINKYRELTTHLQEVNRELTNQQSSSAEQLQQPAA---EL--FDFKIKFAETKAYAKAIEMELRKMEVSQANRQVSLLTSFMPESFLRHGGDHDCILVLLLIPRLICKAELISKQAQEKFDLTGGSLERAGLRGAAGEQLSFASGLVYSLTLLQATLHKYELALSVCGVDVYKRMGMLYSEMCVHERSLDFLIDLLHKDQLDETVQVEPLTKAIKYYQHLYSVHLCDQPEDCTVQLADHIKFTQSALDCMGSEVGRLRAFLQAGQEGAELCVLLKDLDTSCGDIRQFCKKIRRRMPGTDAPGIPAALRFSEQVSEALADSRKQLARVVAVLQEVSAAGAQMMAPLQEQEGLSAVKIEDVAFKAVEQVYGTQG--LNP---YECLRQSCSAVIATMNKMATAMQEGEYDSERPQRP-PPPVETRAAAVRAEMTDAEGLGNKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDTS 932          

HSP 2 Score: 67.0106 bits (162), Expect = 1.899e-10
Identity = 29/70 (41.43%), Postives = 42/70 (60.00%), Query Frame = 1
Query:  145 GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQSTEVTSSENEVHD 354
            GTV +IG+T  A G + G+ L  A G+ DGT+ G  YF C+E HGIF R+SQ+  +     +++  E  D
Sbjct:   25 GTVAYIGATLFASGKWVGVILDEAKGKNDGTVQGKRYFTCEENHGIFVRQSQIQLMDDGGSSATSPETPD 94          
BLAST of Centrosome-associated protein 350 vs. Ensembl Zebrafish
Match: dctn1a (dynactin 1a [Source:ZFIN;Acc:ZDB-GENE-070117-2205])

HSP 1 Score: 114.775 bits (286), Expect = 4.621e-25
Identity = 160/738 (21.68%), Postives = 347/738 (47.02%), Query Frame = 1
Query: 1228 LEKLNNELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSML------KNSDGTSDAKIFIDQTSTIN-KYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKKAKAKDRELSSLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRL----YQQRDNSEKTPENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLE-NNVGEQTLKLMDNLN-----------KISTNVQST-MKNTQMYLRHNQRITFDSSVS-KSIDGIIFSLMDIVLSISDFALQLTDERIFS-----DEAMCRLTEIFANNRNPLNPTSDNEILF-SLNSIDKQVENIVSNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTA 3327
            +++  N+LQ++L +AK+      +  D Y + M    + IEM T+DKEMAEE+ E + Q+  +LK+  E++  +  +L      K SDG + +   + Q    N + K AL+ +    +  K+E+  L       NSEL+ L+       ++ E+L+ +++  E  + E+K+ VD+    E +++ LT +N  LE+++++L++ + +L+ + +   E+ E+  +   E  E+ D     V E Q  ++  +   ++  +T N+  E    L    +E   +     E +++  A   EL    F  +  E     + IE +L+ +E+S  + QV LL  ++P SF   GG+HD I  + ++ +LI K  L+ +   +K  L     ++        E +     L + L +    L + ++ +     +   ++   + ++   E+++D LIDL+ K  LD +     + ++I ++Q+ Y+   C Q  DC +++ + I       +C+ +++  +   L+    G +   L+ +L+           KI   +  T        LR +++++   + S K +  ++  L ++  + +     L ++   S     D A   + +++      LNP    E L  S +++   +  + +  + G YD+++  +     ++T A   R ++   + L  +++ ++ ++  + + LK K  +LSE  ++++  ++KL T+
Sbjct:  214 MQEQQNDLQKQLKEAKKEAREALEAKDRYMEEMADTADAIEMATLDKEMAEERAESLQQETESLKEKLEELTMDMEILKHEIEEKGSDGAASS-YHVKQLEEQNARLKEALVRMRDLSSSEKQEHVKLQKQMEKKNSELETLR-------SQKEKLQEEMKLAEDTIDELKEQVDAALGAEEMVETLTERNLDLEEKVRELRETVSDLESINEMNDELQENARETELELREQLDLAGARVREAQKRVEAAQETLADYQQTINKYRELTTHLQEVNRELTNQQSSSAEQLQQPAA---EL--FDFKIKFAETKAYAKAIEMELRKMEVSQANRQVSLLTSFMPESFLRHGGDHDCILVLLLIPRLICKAELISKQAQEKFDLTGGSLERAGLRGAAGEQLSFASGLVYSLTLLQATLHKYELALSVCGVDVYKRMGMLYSEMCVHERSLDFLIDLLHKDQLDETVQVEPLTKAIKYYQHLYSVHLCDQPEDCTVQLADHIKFTQSALDCMGSEVGRLRAFLQAGQEGAELCVLLKDLDTSCGDIRQFCKKIRRRMPGTDAPGIPAALRFSEQVSEALADSRKQLARVVAVLQEVSAAGAQMMAPLQEQEGLSAVKIEDVAFKAVEQVYGTQG--LNP---YECLRQSCSAVIATMNKMATAMQEGEYDSERPQRP-PPPVETRAAAVRAEMTDAEGLGNKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDTS 932          

HSP 2 Score: 67.0106 bits (162), Expect = 1.899e-10
Identity = 29/70 (41.43%), Postives = 42/70 (60.00%), Query Frame = 1
Query:  145 GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQSTEVTSSENEVHD 354
            GTV +IG+T  A G + G+ L  A G+ DGT+ G  YF C+E HGIF R+SQ+  +     +++  E  D
Sbjct:   25 GTVAYIGATLFASGKWVGVILDEAKGKNDGTVQGKRYFTCEENHGIFVRQSQIQLMDDGGSSATSPETPD 94          
BLAST of Centrosome-associated protein 350 vs. Ensembl Zebrafish
Match: dctn1a (dynactin 1a [Source:ZFIN;Acc:ZDB-GENE-070117-2205])

HSP 1 Score: 100.138 bits (248), Expect = 1.428e-20
Identity = 160/777 (20.59%), Postives = 347/777 (44.66%), Query Frame = 1
Query: 1228 LEKLNNELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSMLK---------------------------------------------NSDGTSDAKIFIDQTSTIN-KYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKKAKAKDRELSSLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRL----YQQRDNSEKTPENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLE-NNVGEQTLKLMDNLN-----------KISTNVQST-MKNTQMYLRHNQRITFDSSVS-KSIDGIIFSLMDIVLSISDFALQLTDERIFS-----DEAMCRLTEIFANNRNPLNPTSDNEILF-SLNSIDKQVENIVSNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTA 3327
            +++  N+LQ++L +AK+      +  D Y + M    + IEM T+DKEMAEE+ E + Q+  +LK+  E++  +  +LK                                              SDG + +   + Q    N + K AL+ +    +  K+E+  L       NSEL+ L+       ++ E+L+ +++  E  + E+K+ VD+    E +++ LT +N  LE+++++L++ + +L+ + +   E+ E+  +   E  E+ D     V E Q  ++  +   ++  +T N+  E    L    +E   +     E +++  A   EL    F  +  E     + IE +L+ +E+S  + QV LL  ++P SF   GG+HD I  + ++ +LI K  L+ +   +K  L     ++        E +     L + L +    L + ++ +     +   ++   + ++   E+++D LIDL+ K  LD +     + ++I ++Q+ Y+   C Q  DC +++ + I       +C+ +++  +   L+    G +   L+ +L+           KI   +  T        LR +++++   + S K +  ++  L ++  + +     L ++   S     D A   + +++      LNP    E L  S +++   +  + +  + G YD+++  +     ++T A   R ++   + L  +++ ++ ++  + + LK K  +LSE  ++++  ++KL T+
Sbjct:  214 MQEQQNDLQKQLKEAKKEAREALEAKDRYMEEMADTADAIEMATLDKEMAEERAESLQQETESLKEKLEELTMDMEILKHEIEEKGENMHTNIHRLITTDPSCWSFRCLTSMCVCSFVCVCVFSGSDGAASS-YHVKQLEEQNARLKEALVRMRDLSSSEKQEHVKLQKQMEKKNSELETLR-------SQKEKLQEEMKLAEDTIDELKEQVDAALGAEEMVETLTERNLDLEEKVRELRETVSDLESINEMNDELQENARETELELREQLDLAGARVREAQKRVEAAQETLADYQQTINKYRELTTHLQEVNRELTNQQSSSAEQLQQPAA---EL--FDFKIKFAETKAYAKAIEMELRKMEVSQANRQVSLLTSFMPESFLRHGGDHDCILVLLLIPRLICKAELISKQAQEKFDLTGGSLERAGLRGAAGEQLSFASGLVYSLTLLQATLHKYELALSVCGVDVYKRMGMLYSEMCVHERSLDFLIDLLHKDQLDETVQVEPLTKAIKYYQHLYSVHLCDQPEDCTVQLADHIKFTQSALDCMGSEVGRLRAFLQAGQEGAELCVLLKDLDTSCGDIRQFCKKIRRRMPGTDAPGIPAALRFSEQVSEALADSRKQLARVVAVLQEVSAAGAQMMAPLQEQEGLSAVKIEDVAFKAVEQVYGTQG--LNP---YECLRQSCSAVIATMNKMATAMQEGEYDSERPQRP-PPPVETRAAAVRAEMTDAEGLGNKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDTS 971          

HSP 2 Score: 66.6254 bits (161), Expect = 1.999e-10
Identity = 29/70 (41.43%), Postives = 42/70 (60.00%), Query Frame = 1
Query:  145 GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQSTEVTSSENEVHD 354
            GTV +IG+T  A G + G+ L  A G+ DGT+ G  YF C+E HGIF R+SQ+  +     +++  E  D
Sbjct:   25 GTVAYIGATLFASGKWVGVILDEAKGKNDGTVQGKRYFTCEENHGIFVRQSQIQLMDDGGSSATSPETPD 94          
BLAST of Centrosome-associated protein 350 vs. Ensembl Zebrafish
Match: dctn1b (dynactin 1b [Source:ZFIN;Acc:ZDB-GENE-050419-28])

HSP 1 Score: 97.8265 bits (242), Expect = 6.854e-20
Identity = 167/786 (21.25%), Postives = 336/786 (42.75%), Query Frame = 1
Query: 1186 LQILKKKEYKRCGDLEKLNNELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSML------KNSDGTSDAKIFIDQTSTIN-KYKNALLELSQSINCYKEEN-------RNLNSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELL----KTTNQMNERICXXXXXXXXXXXXXXXXXXXVKKAKAKDRELSS---------------LTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQQRDNSEKTPENICIQYKLEFLL-LIWCGLLKQLQINIH-------HSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLENNVGEQTL-KLMDNLNKISTNVQSTMKNTQMYLRHNQRITFDSSVSKSIDGIIFSLMDIVLSISDFALQ-LTDERIFSDEAMCRLTEIFANNRNPLNPTSDNEILFSLNSID---KQVENI--------------------------VSNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTA 3327
            +Q+ + +E+K    +++  NELQ++L +AK   +   +  + Y + M    + IEM T+DKEMAEE+ E +  +   LK+  +++  +  +L      K SDG + +   + Q    N + K AL+ +       K+E+          N ELD L+          E+L+ +++  EK + E+K+ VD++   E +++ LT +N                           +E K +++RE   + + +N + +E+Q    + ++E  E L        +  +R+      + + +  IQK  E+    +  +REL S                 F  +  E     + IE +L+ +E+   + QV LLI ++P SF    G+HD I  + ++ +LI K  L+ +   +K  L +    S+K      +  +L F   LI+   L  LQ  +H         S +   ++ S + ++   E+++D LIDL+ K  LD + N   + ++I ++Q+ Y+     Q  DC +++ + I       +C+  ++  +   ++    E+    L+ +L+   ++++                 F   + + + G     +   LS      + L D R         L E+ A     + P S++E L ++   D   K  E I                           +  + G YD+D+  +T  S ++  A   R ++   + L  +++ ++ ++  + + LK K  +LSE  ++++  ++KL +A
Sbjct:  216 IQLEQLQEWK--SKMQEQQNELQKQLKEAKREAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQLEADALKERVDELTMDLEILKHEIEEKGSDGAASS-YHVKQLEEQNARLKEALVRMRDLSASEKQEHGKQQKLMEKKNFELDALR-------CHKEKLQEEMKMAEKTIDELKEQVDASLGAEEMVEMLTERNLD-------------------------LEEKVRELRETVADLEAINEMNDELQENARETELELREQLDLGAAGVREAEKRVEAAQETVADYQQTIQKYRELTANLQEVNRELMSQQEANSEQQQQPAEIFDFKIKFAETKAYAKAIEMELRKMEVIQANRQVSLLISFMPDSFLKHRGDHDCILALLLIPRLICKSELISKQAQEKFELTE--SCSQKPGMRGAVGERLSFAAGLIYS--LTLLQAALHKYEHALSQCSVDVYKRVGSLYSELSVHERSLDFLIDLLYKDLLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDCTMQLADHIRFTQSALDCMAVEVGRLRAFIQTGQDEEAFCVLLKDLDTSCSDIRQ----------------FCKKIRRRMPGTDAPGIPAALSFGPQVCEALADSRRQLAWVNAVLQEVAAAAAQLIAPLSEHEGLPAVKLEDMAFKAAEQIYGSQGINAQECLRQSCSVVIATMNKMATAMQEGEYDSDR-PQTGISPVEVRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSA 945          

HSP 2 Score: 64.3142 bits (155), Expect = 1.181e-9
Identity = 28/64 (43.75%), Postives = 40/64 (62.50%), Query Frame = 1
Query:  145 GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQSTEVTSS 336
            GTV +IG+T  A G + G+ L    G+ DGT+ G  YF C+E HGIF R+SQ+  ++    T+S
Sbjct:   25 GTVAYIGNTLFASGKWVGVILDEPKGKNDGTVQGKRYFLCQENHGIFVRQSQIQLVEDGADTTS 88          
BLAST of Centrosome-associated protein 350 vs. Ensembl Xenopus
Match: ENSXETT00000000206.1 (dynactin subunit 1 [Source:NCBI gene;Acc:447948])

HSP 1 Score: 98.9821 bits (245), Expect = 4.061e-20
Identity = 150/746 (20.11%), Postives = 305/746 (40.88%), Query Frame = 1
Query: 1312 YRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLK----------KLYEQVLEENSMLKNSDGTSDAKIFIDQTSTINKYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKKAK-------AKDREL---SSLTFSKQNIEKNEM-------------KRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLY----QQRDNSEKTPENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLENNVGEQTLKLMDNLNKISTNVQSTMKNTQMYLRHNQRITFDSSVSKSIDGIIFSLMDIVLSISDFALQ-LTDERIFSDEAMCRLTEIFANNRNPLNPTSDNEILFSLNSID---KQVENI--------------------------VSNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTA 3327
            Y + M    + IEM T+DKEMAEE+ E + Q+   LK          ++++  +EE    K SDG + +           + K AL+ +       K+E+  +       N+ELD L++       + E+L+ +    EK + E+K+ VD+    E +++ LT +N                           +E K +++RE   + + +N + +E+Q    + ++E  E L   +    R+      ++  +  +    + +KK +         +REL      +  K+     EM              + IE +L+ +E+S  +  V LL  ++P SF   GG+HD I  + ++ +LI K  L+ +   +K  L     Q+        E +     L + L +    L + +  +   S E   ++   + ++   E+++D LI+L+ K  LD + N   + ++I ++Q+ Y+     Q  +C +++ + I       +C+  ++S +   L  +VG+++      L  + T+     +             F   + + + G   + +   LS +    + L D R +    +    E+ A     + P  +NE L +L   D   K  E I                           +  + G YDA+K        ++  A   R ++   + L  +++ ++ ++  + + LK K  +LSE  ++++  ++KL +A
Sbjct:  282 YMEEMADTADAIEMATLDKEMAEERAESLQQEVDTLKDKVEELKIDLEIFKHEIEE----KGSDGAASSYQVKQLEEQNARLKEALVRMRDLSASEKQEHVKVQKQMEKKNTELDTLRQ-------QKEKLQEEASLMEKTIDELKEQVDAALGAEEMVETLTERNLD-------------------------LEEKVRELRETVSDLEAINEMNDELQENARETELELREQL---DMAGARVREAEKRVEAAQETVADYQQTIKKYRDLTAHLQEVNRELRNQQEASVEKEQQPSPEMFDFKIKFAETKAHAKAIEMELRKMEVSQANRHVSLLTSFMPDSFLRHGGDHDCILVLLLIPRLICKAELISKQAQEKFELSEASEQKSGMRGAVGEQMSFAAGLVYSLTLLQATLHKYEQALDKCSVEVYKKVGMLYPEMSVHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLADQSEECTMQLSDHIKFTQSALDCMGVEVSRLRAFL--HVGQESSDFAILLKDLETSCSDIRQ-------------FCKKIRRRMPGTEAAGIPAALSFAQPVCETLLDCRKYLKCVVAVFQEVAAAGAQMIAPMGENEGLQALKLEDVAFKATEQIYGSKGSNPYECLRQSCSVVIATMNKMATAMQEGEYDAEKPQSKSPPPVEQRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSA 973          

HSP 2 Score: 66.2402 bits (160), Expect = 4.108e-10
Identity = 30/79 (37.97%), Postives = 46/79 (58.23%), Query Frame = 1
Query:  103 FQIGDSV-LYNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQSTEVTSS 336
             ++G  V +      GTV ++G+T  A G + G+ L  + G+ DGT+ G  YF C+E HGIF R+SQ+  I+    T+S
Sbjct:   28 LKVGSRVEVIGKGYRGTVAYVGATLFATGKWVGVILDDSKGKNDGTVQGRRYFTCEENHGIFVRQSQIQVIEDGADTTS 106          
BLAST of Centrosome-associated protein 350 vs. Ensembl Xenopus
Match: ENSXETT00000028179.1 (dynactin subunit 1 [Source:NCBI gene;Acc:447948])

HSP 1 Score: 98.5969 bits (244), Expect = 4.879e-20
Identity = 150/746 (20.11%), Postives = 305/746 (40.88%), Query Frame = 1
Query: 1312 YRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLK----------KLYEQVLEENSMLKNSDGTSDAKIFIDQTSTINKYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKKAK-------AKDREL---SSLTFSKQNIEKNEM-------------KRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLY----QQRDNSEKTPENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLENNVGEQTLKLMDNLNKISTNVQSTMKNTQMYLRHNQRITFDSSVSKSIDGIIFSLMDIVLSISDFALQ-LTDERIFSDEAMCRLTEIFANNRNPLNPTSDNEILFSLNSID---KQVENI--------------------------VSNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTA 3327
            Y + M    + IEM T+DKEMAEE+ E + Q+   LK          ++++  +EE    K SDG + +           + K AL+ +       K+E+  +       N+ELD L++       + E+L+ +    EK + E+K+ VD+    E +++ LT +N                           +E K +++RE   + + +N + +E+Q    + ++E  E L   +    R+      ++  +  +    + +KK +         +REL      +  K+     EM              + IE +L+ +E+S  +  V LL  ++P SF   GG+HD I  + ++ +LI K  L+ +   +K  L     Q+        E +     L + L +    L + +  +   S E   ++   + ++   E+++D LI+L+ K  LD + N   + ++I ++Q+ Y+     Q  +C +++ + I       +C+  ++S +   L  +VG+++      L  + T+     +             F   + + + G   + +   LS +    + L D R +    +    E+ A     + P  +NE L +L   D   K  E I                           +  + G YDA+K        ++  A   R ++   + L  +++ ++ ++  + + LK K  +LSE  ++++  ++KL +A
Sbjct:  275 YMEEMADTADAIEMATLDKEMAEERAESLQQEVDTLKDKVEELKIDLEIFKHEIEE----KGSDGAASSYQVKQLEEQNARLKEALVRMRDLSASEKQEHVKVQKQMEKKNTELDTLRQ-------QKEKLQEEASLMEKTIDELKEQVDAALGAEEMVETLTERNLD-------------------------LEEKVRELRETVSDLEAINEMNDELQENARETELELREQL---DMAGARVREAEKRVEAAQETVADYQQTIKKYRDLTAHLQEVNRELRNQQEASVEKEQQPSPEMFDFKIKFAETKAHAKAIEMELRKMEVSQANRHVSLLTSFMPDSFLRHGGDHDCILVLLLIPRLICKAELISKQAQEKFELSEASEQKSGMRGAVGEQMSFAAGLVYSLTLLQATLHKYEQALDKCSVEVYKKVGMLYPEMSVHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLADQSEECTMQLSDHIKFTQSALDCMGVEVSRLRAFL--HVGQESSDFAILLKDLETSCSDIRQ-------------FCKKIRRRMPGTEAAGIPAALSFAQPVCETLLDCRKYLKCVVAVFQEVAAAGAQMIAPMGENEGLQALKLEDVAFKATEQIYGSKGSNPYECLRQSCSVVIATMNKMATAMQEGEYDAEKPQSKSPPPVEQRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSA 966          

HSP 2 Score: 66.2402 bits (160), Expect = 3.833e-10
Identity = 30/79 (37.97%), Postives = 46/79 (58.23%), Query Frame = 1
Query:  103 FQIGDSV-LYNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQSTEVTSS 336
             ++G  V +      GTV ++G+T  A G + G+ L  + G+ DGT+ G  YF C+E HGIF R+SQ+  I+    T+S
Sbjct:   28 LKVGSRVEVIGKGYRGTVAYVGATLFATGKWVGVILDDSKGKNDGTVQGRRYFTCEENHGIFVRQSQIQVIEDGADTTS 106          
BLAST of Centrosome-associated protein 350 vs. Ensembl Xenopus
Match: ENSXETT00000011502.1 (dynactin subunit 1 [Source:NCBI gene;Acc:447948])

HSP 1 Score: 98.5969 bits (244), Expect = 5.031e-20
Identity = 150/746 (20.11%), Postives = 305/746 (40.88%), Query Frame = 1
Query: 1312 YRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLK----------KLYEQVLEENSMLKNSDGTSDAKIFIDQTSTINKYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKKAK-------AKDREL---SSLTFSKQNIEKNEM-------------KRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLY----QQRDNSEKTPENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLENNVGEQTLKLMDNLNKISTNVQSTMKNTQMYLRHNQRITFDSSVSKSIDGIIFSLMDIVLSISDFALQ-LTDERIFSDEAMCRLTEIFANNRNPLNPTSDNEILFSLNSID---KQVENI--------------------------VSNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTA 3327
            Y + M    + IEM T+DKEMAEE+ E + Q+   LK          ++++  +EE    K SDG + +           + K AL+ +       K+E+  +       N+ELD L++       + E+L+ +    EK + E+K+ VD+    E +++ LT +N                           +E K +++RE   + + +N + +E+Q    + ++E  E L   +    R+      ++  +  +    + +KK +         +REL      +  K+     EM              + IE +L+ +E+S  +  V LL  ++P SF   GG+HD I  + ++ +LI K  L+ +   +K  L     Q+        E +     L + L +    L + +  +   S E   ++   + ++   E+++D LI+L+ K  LD + N   + ++I ++Q+ Y+     Q  +C +++ + I       +C+  ++S +   L  +VG+++      L  + T+     +             F   + + + G   + +   LS +    + L D R +    +    E+ A     + P  +NE L +L   D   K  E I                           +  + G YDA+K        ++  A   R ++   + L  +++ ++ ++  + + LK K  +LSE  ++++  ++KL +A
Sbjct:  288 YMEEMADTADAIEMATLDKEMAEERAESLQQEVDTLKDKVEELKIDLEIFKHEIEE----KGSDGAASSYQVKQLEEQNARLKEALVRMRDLSASEKQEHVKVQKQMEKKNTELDTLRQ-------QKEKLQEEASLMEKTIDELKEQVDAALGAEEMVETLTERNLD-------------------------LEEKVRELRETVSDLEAINEMNDELQENARETELELREQL---DMAGARVREAEKRVEAAQETVADYQQTIKKYRDLTAHLQEVNRELRNQQEASVEKEQQPSPEMFDFKIKFAETKAHAKAIEMELRKMEVSQANRHVSLLTSFMPDSFLRHGGDHDCILVLLLIPRLICKAELISKQAQEKFELSEASEQKSGMRGAVGEQMSFAAGLVYSLTLLQATLHKYEQALDKCSVEVYKKVGMLYPEMSVHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLADQSEECTMQLSDHIKFTQSALDCMGVEVSRLRAFL--HVGQESSDFAILLKDLETSCSDIRQ-------------FCKKIRRRMPGTEAAGIPAALSFAQPVCETLLDCRKYLKCVVAVFQEVAAAGAQMIAPMGENEGLQALKLEDVAFKATEQIYGSKGSNPYECLRQSCSVVIATMNKMATAMQEGEYDAEKPQSKSPPPVEQRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSA 979          

HSP 2 Score: 66.2402 bits (160), Expect = 3.844e-10
Identity = 31/82 (37.80%), Postives = 47/82 (57.32%), Query Frame = 1
Query:  103 FQIGDSV-LYNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQ-STEVTSSEN 342
             ++G  V +      GTV ++G+T  A G + G+ L  + G+ DGT+ G  YF C+E HGIF R+SQ+  I+   + TS E 
Sbjct:   28 LKVGSRVEVIGKGYRGTVAYVGATLFATGKWVGVILDDSKGKNDGTVQGRRYFTCEENHGIFVRQSQIQVIEDGADTTSPET 109          
BLAST of Centrosome-associated protein 350 vs. Ensembl Xenopus
Match: ENSXETT00000028089.1 (dynactin subunit 1 [Source:NCBI gene;Acc:447948])

HSP 1 Score: 98.5969 bits (244), Expect = 5.076e-20
Identity = 150/746 (20.11%), Postives = 305/746 (40.88%), Query Frame = 1
Query: 1312 YRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLK----------KLYEQVLEENSMLKNSDGTSDAKIFIDQTSTINKYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKKAK-------AKDREL---SSLTFSKQNIEKNEM-------------KRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLY----QQRDNSEKTPENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLENNVGEQTLKLMDNLNKISTNVQSTMKNTQMYLRHNQRITFDSSVSKSIDGIIFSLMDIVLSISDFALQ-LTDERIFSDEAMCRLTEIFANNRNPLNPTSDNEILFSLNSID---KQVENI--------------------------VSNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTA 3327
            Y + M    + IEM T+DKEMAEE+ E + Q+   LK          ++++  +EE    K SDG + +           + K AL+ +       K+E+  +       N+ELD L++       + E+L+ +    EK + E+K+ VD+    E +++ LT +N                           +E K +++RE   + + +N + +E+Q    + ++E  E L   +    R+      ++  +  +    + +KK +         +REL      +  K+     EM              + IE +L+ +E+S  +  V LL  ++P SF   GG+HD I  + ++ +LI K  L+ +   +K  L     Q+        E +     L + L +    L + +  +   S E   ++   + ++   E+++D LI+L+ K  LD + N   + ++I ++Q+ Y+     Q  +C +++ + I       +C+  ++S +   L  +VG+++      L  + T+     +             F   + + + G   + +   LS +    + L D R +    +    E+ A     + P  +NE L +L   D   K  E I                           +  + G YDA+K        ++  A   R ++   + L  +++ ++ ++  + + LK K  +LSE  ++++  ++KL +A
Sbjct:  289 YMEEMADTADAIEMATLDKEMAEERAESLQQEVDTLKDKVEELKIDLEIFKHEIEE----KGSDGAASSYQVKQLEEQNARLKEALVRMRDLSASEKQEHVKVQKQMEKKNTELDTLRQ-------QKEKLQEEASLMEKTIDELKEQVDAALGAEEMVETLTERNLD-------------------------LEEKVRELRETVSDLEAINEMNDELQENARETELELREQL---DMAGARVREAEKRVEAAQETVADYQQTIKKYRDLTAHLQEVNRELRNQQEASVEKEQQPSPEMFDFKIKFAETKAHAKAIEMELRKMEVSQANRHVSLLTSFMPDSFLRHGGDHDCILVLLLIPRLICKAELISKQAQEKFELSEASEQKSGMRGAVGEQMSFAAGLVYSLTLLQATLHKYEQALDKCSVEVYKKVGMLYPEMSVHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLADQSEECTMQLSDHIKFTQSALDCMGVEVSRLRAFL--HVGQESSDFAILLKDLETSCSDIRQ-------------FCKKIRRRMPGTEAAGIPAALSFAQPVCETLLDCRKYLKCVVAVFQEVAAAGAQMIAPMGENEGLQALKLEDVAFKATEQIYGSKGSNPYECLRQSCSVVIATMNKMATAMQEGEYDAEKPQSKSPPPVEQRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSA 980          

HSP 2 Score: 66.2402 bits (160), Expect = 4.011e-10
Identity = 31/82 (37.80%), Postives = 47/82 (57.32%), Query Frame = 1
Query:  103 FQIGDSV-LYNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQ-STEVTSSEN 342
             ++G  V +      GTV ++G+T  A G + G+ L  + G+ DGT+ G  YF C+E HGIF R+SQ+  I+   + TS E 
Sbjct:   28 LKVGSRVEVIGKGYRGTVAYVGATLFATGKWVGVILDDSKGKNDGTVQGRRYFTCEENHGIFVRQSQIQVIEDGADTTSPET 109          
BLAST of Centrosome-associated protein 350 vs. Ensembl Xenopus
Match: ENSXETT00000011652.1 (dynactin subunit 1 [Source:NCBI gene;Acc:447948])

HSP 1 Score: 98.5969 bits (244), Expect = 5.354e-20
Identity = 150/746 (20.11%), Postives = 305/746 (40.88%), Query Frame = 1
Query: 1312 YRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLK----------KLYEQVLEENSMLKNSDGTSDAKIFIDQTSTINKYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKKAK-------AKDREL---SSLTFSKQNIEKNEM-------------KRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLY----QQRDNSEKTPENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLENNVGEQTLKLMDNLNKISTNVQSTMKNTQMYLRHNQRITFDSSVSKSIDGIIFSLMDIVLSISDFALQ-LTDERIFSDEAMCRLTEIFANNRNPLNPTSDNEILFSLNSID---KQVENI--------------------------VSNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTA 3327
            Y + M    + IEM T+DKEMAEE+ E + Q+   LK          ++++  +EE    K SDG + +           + K AL+ +       K+E+  +       N+ELD L++       + E+L+ +    EK + E+K+ VD+    E +++ LT +N                           +E K +++RE   + + +N + +E+Q    + ++E  E L   +    R+      ++  +  +    + +KK +         +REL      +  K+     EM              + IE +L+ +E+S  +  V LL  ++P SF   GG+HD I  + ++ +LI K  L+ +   +K  L     Q+        E +     L + L +    L + +  +   S E   ++   + ++   E+++D LI+L+ K  LD + N   + ++I ++Q+ Y+     Q  +C +++ + I       +C+  ++S +   L  +VG+++      L  + T+     +             F   + + + G   + +   LS +    + L D R +    +    E+ A     + P  +NE L +L   D   K  E I                           +  + G YDA+K        ++  A   R ++   + L  +++ ++ ++  + + LK K  +LSE  ++++  ++KL +A
Sbjct:  295 YMEEMADTADAIEMATLDKEMAEERAESLQQEVDTLKDKVEELKIDLEIFKHEIEE----KGSDGAASSYQVKQLEEQNARLKEALVRMRDLSASEKQEHVKVQKQMEKKNTELDTLRQ-------QKEKLQEEASLMEKTIDELKEQVDAALGAEEMVETLTERNLD-------------------------LEEKVRELRETVSDLEAINEMNDELQENARETELELREQL---DMAGARVREAEKRVEAAQETVADYQQTIKKYRDLTAHLQEVNRELRNQQEASVEKEQQPSPEMFDFKIKFAETKAHAKAIEMELRKMEVSQANRHVSLLTSFMPDSFLRHGGDHDCILVLLLIPRLICKAELISKQAQEKFELSEASEQKSGMRGAVGEQMSFAAGLVYSLTLLQATLHKYEQALDKCSVEVYKKVGMLYPEMSVHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLADQSEECTMQLSDHIKFTQSALDCMGVEVSRLRAFL--HVGQESSDFAILLKDLETSCSDIRQ-------------FCKKIRRRMPGTEAAGIPAALSFAQPVCETLLDCRKYLKCVVAVFQEVAAAGAQMIAPMGENEGLQALKLEDVAFKATEQIYGSKGSNPYECLRQSCSVVIATMNKMATAMQEGEYDAEKPQSKSPPPVEQRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSA 986          

HSP 2 Score: 66.2402 bits (160), Expect = 3.628e-10
Identity = 31/82 (37.80%), Postives = 47/82 (57.32%), Query Frame = 1
Query:  103 FQIGDSV-LYNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQ-STEVTSSEN 342
             ++G  V +      GTV ++G+T  A G + G+ L  + G+ DGT+ G  YF C+E HGIF R+SQ+  I+   + TS E 
Sbjct:   28 LKVGSRVEVIGKGYRGTVAYVGATLFATGKWVGVILDDSKGKNDGTVQGRRYFTCEENHGIFVRQSQIQVIEDGADTTSPET 109          
BLAST of Centrosome-associated protein 350 vs. Ensembl Mouse
Match: Dctn1 (dynactin 1 [Source:MGI Symbol;Acc:MGI:107745])

HSP 1 Score: 100.523 bits (249), Expect = 1.120e-20
Identity = 161/800 (20.12%), Postives = 343/800 (42.88%), Query Frame = 1
Query: 1186 LQILKKKEYKRCGDLEKLNNELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSMLK------NSDGTSDAKIFIDQTSTINKYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKK-----AKAKD--RELS----------------SLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQQRDNSEKTPENICIQYKLEFLLLIWCGL---LKQLQINIHHSSPEALCQ--------LRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLENNVGEQTLKLMDNLNKISTNVQSTMKNTQMYLRH---------NQRITFDSSVS-------KSIDGIIFSLMDIVLSISDFALQLTDERIFSDEAMCRLT-----EIFANNRNPLNPTSDNEILF-SLNSIDKQVENIVSNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTAVESREIIINQLNQRIYE 3378
            +Q  K K  ++  DL++   E ++E  +A E +ER       Y + M    + IEM T+DKEMAEE+ E + Q+   LK+  +++  +  +LK       SDG + +           + K+AL+ +    +  K+E+  L       N EL+++++       + E+L+ ++ + E  + E+K+ VD+    E +++ LT +N                           +E K +++RE   + + +N + +E+Q    + ++E  E L   +    R+      ++  +  +    + +KK     A  +D  REL+                +  F  +  E     + IE +L+ +E++  +  + LL  ++P SF  PGG+HD +  + ++ +LI K  L+      +++  ++ D SE   E   ++      L    GL   L  LQ  +H     AL Q        + S + ++   E+++D LI+L+ K  LD + N   + ++I ++Q+ Y+     Q  D  +++ + I       +C+  ++  +   L+   G++   +   L  + T+   T +  +   R             + F S VS       K +  ++  L ++  + +     L +       A+  L      +I+ +       +S  E L  S   +   +  + +  + G YDA++   +    ++  A   R ++   + L  +++ ++ ++  + + LK K  +LSE  ++++  ++KL +A +  +  I ++  R+ E
Sbjct:  241 VQEWKSKMQEQQADLQRRLKEARKEAKEALEAKER-------YMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQ-------QRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLN-------------------------LEEKVRELRETVGDLEAMNEMNDELQENARETELELREQL---DMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELI------RKQAQEKFDLSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYE-HALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDSTMQLADHIKFTQSALDCMGVEVGRLRAFLQG--GQEATDIALLLRDLETSCSDTRQFCKKIRRRMPGTDAPGIPAALAFGSQVSDTLLDCRKHLTWVVAVLQEVAAAAAQLIAPLAENEGLPVAALEELAFKASEQIYGSPS-----SSPYECLRQSCTILISTMNKLATAMQEGEYDAER-PPSKPPPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLDE 983          

HSP 2 Score: 65.0846 bits (157), Expect = 7.000e-10
Identity = 36/90 (40.00%), Postives = 50/90 (55.56%), Query Frame = 1
Query:  145 GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQ-STEVTSSE--NEVHDKLLNSCGETRDLTAQTS 405
            GTV ++G+T  A G + G+ L  A G+ DGT+ G  YF C E HGIF R+SQ+   +   + TS E  +    K+L   G   D  A+TS
Sbjct:   25 GTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKREGA--DAAAKTS 112          
BLAST of Centrosome-associated protein 350 vs. Ensembl Mouse
Match: Dctn1 (dynactin 1 [Source:MGI Symbol;Acc:MGI:107745])

HSP 1 Score: 100.138 bits (248), Expect = 1.282e-20
Identity = 161/800 (20.12%), Postives = 343/800 (42.88%), Query Frame = 1
Query: 1186 LQILKKKEYKRCGDLEKLNNELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSMLK------NSDGTSDAKIFIDQTSTINKYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKK-----AKAKD--RELS----------------SLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQQRDNSEKTPENICIQYKLEFLLLIWCGL---LKQLQINIHHSSPEALCQ--------LRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLENNVGEQTLKLMDNLNKISTNVQSTMKNTQMYLRH---------NQRITFDSSVS-------KSIDGIIFSLMDIVLSISDFALQLTDERIFSDEAMCRLT-----EIFANNRNPLNPTSDNEILF-SLNSIDKQVENIVSNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTAVESREIIINQLNQRIYE 3378
            +Q  K K  ++  DL++   E ++E  +A E +ER       Y + M    + IEM T+DKEMAEE+ E + Q+   LK+  +++  +  +LK       SDG + +           + K+AL+ +    +  K+E+  L       N EL+++++       + E+L+ ++ + E  + E+K+ VD+    E +++ LT +N                           +E K +++RE   + + +N + +E+Q    + ++E  E L   +    R+      ++  +  +    + +KK     A  +D  REL+                +  F  +  E     + IE +L+ +E++  +  + LL  ++P SF  PGG+HD +  + ++ +LI K  L+      +++  ++ D SE   E   ++      L    GL   L  LQ  +H     AL Q        + S + ++   E+++D LI+L+ K  LD + N   + ++I ++Q+ Y+     Q  D  +++ + I       +C+  ++  +   L+   G++   +   L  + T+   T +  +   R             + F S VS       K +  ++  L ++  + +     L +       A+  L      +I+ +       +S  E L  S   +   +  + +  + G YDA++   +    ++  A   R ++   + L  +++ ++ ++  + + LK K  +LSE  ++++  ++KL +A +  +  I ++  R+ E
Sbjct:  258 VQEWKSKMQEQQADLQRRLKEARKEAKEALEAKER-------YMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQ-------QRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLN-------------------------LEEKVRELRETVGDLEAMNEMNDELQENARETELELREQL---DMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELI------RKQAQEKFDLSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYE-HALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDSTMQLADHIKFTQSALDCMGVEVGRLRAFLQG--GQEATDIALLLRDLETSCSDTRQFCKKIRRRMPGTDAPGIPAALAFGSQVSDTLLDCRKHLTWVVAVLQEVAAAAAQLIAPLAENEGLPVAALEELAFKASEQIYGSPS-----SSPYECLRQSCTILISTMNKLATAMQEGEYDAER-PPSKPPPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLDE 1000          

HSP 2 Score: 65.4698 bits (158), Expect = 5.453e-10
Identity = 36/90 (40.00%), Postives = 50/90 (55.56%), Query Frame = 1
Query:  145 GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQ-STEVTSSE--NEVHDKLLNSCGETRDLTAQTS 405
            GTV ++G+T  A G + G+ L  A G+ DGT+ G  YF C E HGIF R+SQ+   +   + TS E  +    K+L   G   D  A+TS
Sbjct:   42 GTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKREGA--DAAAKTS 129          
BLAST of Centrosome-associated protein 350 vs. Ensembl Mouse
Match: Dctn1 (dynactin 1 [Source:MGI Symbol;Acc:MGI:107745])

HSP 1 Score: 100.138 bits (248), Expect = 1.491e-20
Identity = 161/800 (20.12%), Postives = 343/800 (42.88%), Query Frame = 1
Query: 1186 LQILKKKEYKRCGDLEKLNNELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSMLK------NSDGTSDAKIFIDQTSTINKYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKK-----AKAKD--RELS----------------SLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQQRDNSEKTPENICIQYKLEFLLLIWCGL---LKQLQINIHHSSPEALCQ--------LRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLENNVGEQTLKLMDNLNKISTNVQSTMKNTQMYLRH---------NQRITFDSSVS-------KSIDGIIFSLMDIVLSISDFALQLTDERIFSDEAMCRLT-----EIFANNRNPLNPTSDNEILF-SLNSIDKQVENIVSNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTAVESREIIINQLNQRIYE 3378
            +Q  K K  ++  DL++   E ++E  +A E +ER       Y + M    + IEM T+DKEMAEE+ E + Q+   LK+  +++  +  +LK       SDG + +           + K+AL+ +    +  K+E+  L       N EL+++++       + E+L+ ++ + E  + E+K+ VD+    E +++ LT +N                           +E K +++RE   + + +N + +E+Q    + ++E  E L   +    R+      ++  +  +    + +KK     A  +D  REL+                +  F  +  E     + IE +L+ +E++  +  + LL  ++P SF  PGG+HD +  + ++ +LI K  L+      +++  ++ D SE   E   ++      L    GL   L  LQ  +H     AL Q        + S + ++   E+++D LI+L+ K  LD + N   + ++I ++Q+ Y+     Q  D  +++ + I       +C+  ++  +   L+   G++   +   L  + T+   T +  +   R             + F S VS       K +  ++  L ++  + +     L +       A+  L      +I+ +       +S  E L  S   +   +  + +  + G YDA++   +    ++  A   R ++   + L  +++ ++ ++  + + LK K  +LSE  ++++  ++KL +A +  +  I ++  R+ E
Sbjct:  221 VQEWKSKMQEQQADLQRRLKEARKEAKEALEAKER-------YMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQ-------QRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLN-------------------------LEEKVRELRETVGDLEAMNEMNDELQENARETELELREQL---DMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELI------RKQAQEKFDLSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYE-HALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDSTMQLADHIKFTQSALDCMGVEVGRLRAFLQG--GQEATDIALLLRDLETSCSDTRQFCKKIRRRMPGTDAPGIPAALAFGSQVSDTLLDCRKHLTWVVAVLQEVAAAAAQLIAPLAENEGLPVAALEELAFKASEQIYGSPS-----SSPYECLRQSCTILISTMNKLATAMQEGEYDAER-PPSKPPPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLDE 963          

HSP 2 Score: 65.4698 bits (158), Expect = 5.049e-10
Identity = 37/103 (35.92%), Postives = 55/103 (53.40%), Query Frame = 1
Query:  145 GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQ-STEVTSSE--NEVHDKLLNSCGETRDLTAQTSDKIASHIKTNNIV 444
            GTV ++G+T  A G + G+ L  A G+ DGT+ G  YF C E HGIF R+SQ+   +   + TS E  +    K+L   G   D  A+TS K+ +   +  + 
Sbjct:   25 GTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKREGA--DAAAKTS-KLPTRPASTGVA 124          
BLAST of Centrosome-associated protein 350 vs. Ensembl Mouse
Match: Dctn1 (dynactin 1 [Source:MGI Symbol;Acc:MGI:107745])

HSP 1 Score: 99.7525 bits (247), Expect = 1.797e-20
Identity = 161/800 (20.12%), Postives = 343/800 (42.88%), Query Frame = 1
Query: 1186 LQILKKKEYKRCGDLEKLNNELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSMLK------NSDGTSDAKIFIDQTSTINKYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKK-----AKAKD--RELS----------------SLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQQRDNSEKTPENICIQYKLEFLLLIWCGL---LKQLQINIHHSSPEALCQ--------LRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLENNVGEQTLKLMDNLNKISTNVQSTMKNTQMYLRH---------NQRITFDSSVS-------KSIDGIIFSLMDIVLSISDFALQLTDERIFSDEAMCRLT-----EIFANNRNPLNPTSDNEILF-SLNSIDKQVENIVSNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTAVESREIIINQLNQRIYE 3378
            +Q  K K  ++  DL++   E ++E  +A E +ER       Y + M    + IEM T+DKEMAEE+ E + Q+   LK+  +++  +  +LK       SDG + +           + K+AL+ +    +  K+E+  L       N EL+++++       + E+L+ ++ + E  + E+K+ VD+    E +++ LT +N                           +E K +++RE   + + +N + +E+Q    + ++E  E L   +    R+      ++  +  +    + +KK     A  +D  REL+                +  F  +  E     + IE +L+ +E++  +  + LL  ++P SF  PGG+HD +  + ++ +LI K  L+      +++  ++ D SE   E   ++      L    GL   L  LQ  +H     AL Q        + S + ++   E+++D LI+L+ K  LD + N   + ++I ++Q+ Y+     Q  D  +++ + I       +C+  ++  +   L+   G++   +   L  + T+   T +  +   R             + F S VS       K +  ++  L ++  + +     L +       A+  L      +I+ +       +S  E L  S   +   +  + +  + G YDA++   +    ++  A   R ++   + L  +++ ++ ++  + + LK K  +LSE  ++++  ++KL +A +  +  I ++  R+ E
Sbjct:  258 VQEWKSKMQEQQADLQRRLKEARKEAKEALEAKER-------YMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQ-------QRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLN-------------------------LEEKVRELRETVGDLEAMNEMNDELQENARETELELREQL---DMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELI------RKQAQEKFDLSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYE-HALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDSTMQLADHIKFTQSALDCMGVEVGRLRAFLQG--GQEATDIALLLRDLETSCSDTRQFCKKIRRRMPGTDAPGIPAALAFGSQVSDTLLDCRKHLTWVVAVLQEVAAAAAQLIAPLAENEGLPVAALEELAFKASEQIYGSPS-----SSPYECLRQSCTILISTMNKLATAMQEGEYDAER-PPSKPPPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLDE 1000          

HSP 2 Score: 65.0846 bits (157), Expect = 7.710e-10
Identity = 36/90 (40.00%), Postives = 50/90 (55.56%), Query Frame = 1
Query:  145 GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQ-STEVTSSE--NEVHDKLLNSCGETRDLTAQTS 405
            GTV ++G+T  A G + G+ L  A G+ DGT+ G  YF C E HGIF R+SQ+   +   + TS E  +    K+L   G   D  A+TS
Sbjct:   42 GTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKREGA--DAAAKTS 129          
BLAST of Centrosome-associated protein 350 vs. Ensembl Mouse
Match: Dctn1 (dynactin 1 [Source:MGI Symbol;Acc:MGI:107745])

HSP 1 Score: 98.2117 bits (243), Expect = 5.213e-20
Identity = 161/800 (20.12%), Postives = 343/800 (42.88%), Query Frame = 1
Query: 1186 LQILKKKEYKRCGDLEKLNNELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSMLK------NSDGTSDAKIFIDQTSTINKYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKK-----AKAKD--RELS----------------SLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQQRDNSEKTPENICIQYKLEFLLLIWCGL---LKQLQINIHHSSPEALCQ--------LRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLENNVGEQTLKLMDNLNKISTNVQSTMKNTQMYLRH---------NQRITFDSSVS-------KSIDGIIFSLMDIVLSISDFALQLTDERIFSDEAMCRLT-----EIFANNRNPLNPTSDNEILF-SLNSIDKQVENIVSNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTAVESREIIINQLNQRIYE 3378
            +Q  K K  ++  DL++   E ++E  +A E +ER       Y + M    + IEM T+DKEMAEE+ E + Q+   LK+  +++  +  +LK       SDG + +           + K+AL+ +    +  K+E+  L       N EL+++++       + E+L+ ++ + E  + E+K+ VD+    E +++ LT +N                           +E K +++RE   + + +N + +E+Q    + ++E  E L   +    R+      ++  +  +    + +KK     A  +D  REL+                +  F  +  E     + IE +L+ +E++  +  + LL  ++P SF  PGG+HD +  + ++ +LI K  L+      +++  ++ D SE   E   ++      L    GL   L  LQ  +H     AL Q        + S + ++   E+++D LI+L+ K  LD + N   + ++I ++Q+ Y+     Q  D  +++ + I       +C+  ++  +   L+   G++   +   L  + T+   T +  +   R             + F S VS       K +  ++  L ++  + +     L +       A+  L      +I+ +       +S  E L  S   +   +  + +  + G YDA++   +    ++  A   R ++   + L  +++ ++ ++  + + LK K  +LSE  ++++  ++KL +A +  +  I ++  R+ E
Sbjct:  124 VQEWKSKMQEQQADLQRRLKEARKEAKEALEAKER-------YMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQ-------QRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLN-------------------------LEEKVRELRETVGDLEAMNEMNDELQENARETELELREQL---DMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELI------RKQAQEKFDLSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYE-HALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDSTMQLADHIKFTQSALDCMGVEVGRLRAFLQG--GQEATDIALLLRDLETSCSDTRQFCKKIRRRMPGTDAPGIPAALAFGSQVSDTLLDCRKHLTWVVAVLQEVAAAAAQLIAPLAENEGLPVAALEELAFKASEQIYGSPS-----SSPYECLRQSCTILISTMNKLATAMQEGEYDAER-PPSKPPPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLDE 866          
BLAST of Centrosome-associated protein 350 vs. UniProt/SwissProt
Match: sp|Q14203|DCTN1_HUMAN (Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN1 PE=1 SV=3)

HSP 1 Score: 101.679 bits (252), Expect = 3.403e-20
Identity = 118/562 (21.00%), Postives = 250/562 (44.48%), Query Frame = 1
Query: 1186 LQILKKKEYKRCGDLEKLNNELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSMLK------NSDGTSDAKIFIDQTSTINKYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKK-----AKAKD--RELS----------------SLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQQRDNSEKTP-------ENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLENN 2742
            +Q  K K  ++  DL++   E ++E  +A E +ER       Y + M    + IEM T+DKEMAEE+ E + Q+   LK+  +++  +  +LK       SDG + +           + K+AL+ +    +  K+E+  L       N EL+++++       + E+L+ ++ + E  + E+K+ VD+    E +++ LT +N                           +E K +++RE   + + +N + +E+Q    + ++E  E L   +    R+      ++  +  +    + +KK     A  +D  REL+                +  F  +  E     + IE +L+ +E++  +  + LL  ++P SF  PGG+HD +  + ++ +LI K  L+ +   +K   ++  +N  + P       E +     L + L +    L + +  +   S +   ++ S + ++   E+++D LI+L+ K  LD + N   + ++I ++Q+ Y+     Q  DC +++ + I       +C+  ++  +   L+  
Sbjct:  258 VQEWKSKMQEQQADLQRRLKEARKEAKEALEAKER-------YMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQ-------QRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLN-------------------------LEEKVRELRETVGDLEAMNEMNDELQENARETELELREQL---DMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELIRKQAQEK---FELSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDCTMQLADHIKFTQSALDCMSVEVGRLRAFLQGG 774          

HSP 2 Score: 65.855 bits (159), Expect = 2.787e-9
Identity = 37/90 (41.11%), Postives = 51/90 (56.67%), Query Frame = 1
Query:  145 GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQ-STEVTSSE--NEVHDKLLNSCGETRDLTAQTS 405
            GTV ++G+T  A G + G+ L  A G+ DGT+ G  YF C E HGIF R+SQ+   +   + TS E  +    K+L    E  D TA+TS
Sbjct:   42 GTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKR--EGTDTTAKTS 129          
BLAST of Centrosome-associated protein 350 vs. UniProt/SwissProt
Match: sp|O08788|DCTN1_MOUSE (Dynactin subunit 1 OS=Mus musculus OX=10090 GN=Dctn1 PE=1 SV=3)

HSP 1 Score: 99.7525 bits (247), Expect = 1.257e-19
Identity = 161/800 (20.12%), Postives = 343/800 (42.88%), Query Frame = 1
Query: 1186 LQILKKKEYKRCGDLEKLNNELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSMLK------NSDGTSDAKIFIDQTSTINKYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKK-----AKAKD--RELS----------------SLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQQRDNSEKTPENICIQYKLEFLLLIWCGL---LKQLQINIHHSSPEALCQ--------LRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLENNVGEQTLKLMDNLNKISTNVQSTMKNTQMYLRH---------NQRITFDSSVS-------KSIDGIIFSLMDIVLSISDFALQLTDERIFSDEAMCRLT-----EIFANNRNPLNPTSDNEILF-SLNSIDKQVENIVSNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTAVESREIIINQLNQRIYE 3378
            +Q  K K  ++  DL++   E ++E  +A E +ER       Y + M    + IEM T+DKEMAEE+ E + Q+   LK+  +++  +  +LK       SDG + +           + K+AL+ +    +  K+E+  L       N EL+++++       + E+L+ ++ + E  + E+K+ VD+    E +++ LT +N                           +E K +++RE   + + +N + +E+Q    + ++E  E L   +    R+      ++  +  +    + +KK     A  +D  REL+                +  F  +  E     + IE +L+ +E++  +  + LL  ++P SF  PGG+HD +  + ++ +LI K  L+      +++  ++ D SE   E   ++      L    GL   L  LQ  +H     AL Q        + S + ++   E+++D LI+L+ K  LD + N   + ++I ++Q+ Y+     Q  D  +++ + I       +C+  ++  +   L+   G++   +   L  + T+   T +  +   R             + F S VS       K +  ++  L ++  + +     L +       A+  L      +I+ +       +S  E L  S   +   +  + +  + G YDA++   +    ++  A   R ++   + L  +++ ++ ++  + + LK K  +LSE  ++++  ++KL +A +  +  I ++  R+ E
Sbjct:  258 VQEWKSKMQEQQADLQRRLKEARKEAKEALEAKER-------YMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQ-------QRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLN-------------------------LEEKVRELRETVGDLEAMNEMNDELQENARETELELREQL---DMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELI------RKQAQEKFDLSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYE-HALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDSTMQLADHIKFTQSALDCMGVEVGRLRAFLQG--GQEATDIALLLRDLETSCSDTRQFCKKIRRRMPGTDAPGIPAALAFGSQVSDTLLDCRKHLTWVVAVLQEVAAAAAQLIAPLAENEGLPVAALEELAFKASEQIYGSPS-----SSPYECLRQSCTILISTMNKLATAMQEGEYDAER-PPSKPPPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLDE 1000          

HSP 2 Score: 65.0846 bits (157), Expect = 5.393e-9
Identity = 36/90 (40.00%), Postives = 50/90 (55.56%), Query Frame = 1
Query:  145 GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQ-STEVTSSE--NEVHDKLLNSCGETRDLTAQTS 405
            GTV ++G+T  A G + G+ L  A G+ DGT+ G  YF C E HGIF R+SQ+   +   + TS E  +    K+L   G   D  A+TS
Sbjct:   42 GTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKREGA--DAAAKTS 129          
BLAST of Centrosome-associated protein 350 vs. UniProt/SwissProt
Match: sp|P28023|DCTN1_RAT (Dynactin subunit 1 OS=Rattus norvegicus OX=10116 GN=Dctn1 PE=1 SV=2)

HSP 1 Score: 99.3673 bits (246), Expect = 1.824e-19
Identity = 122/566 (21.55%), Postives = 255/566 (45.05%), Query Frame = 1
Query: 1186 LQILKKKEYKRCGDLEKLNNELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSMLK------NSDGTSDAKIFIDQTSTINKYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKK-----AKAKD--RELS----------------SLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQQRDNSEKTPENICIQYKLEFLLLIWCGL---LKQLQINIHHSSPEALCQ--------LRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLENN 2742
            +Q+ + +E+K    +++   +LQR L +AKE +E ++ + + Y + M    + IEM T+DKEMAEE+ E + Q+   LK+  +++  +  +LK       SDG + +           + K+AL+ +    +  K+E+  L       N EL+++++       + E+L+ ++ + E  + E+K+ VD+    E +++ LT +N                           +E K +++RE   + + +N + +E+Q    + ++E  E L   +    R+      ++  +  +    + +KK     A  +D  REL+                +  F  +  E     + IE +L+ +E++  +  + LL  ++P SF  PGG+HD +  + ++ +LI K  L+      +++  ++ D SE   E   ++      L    GL   L  LQ  +H     AL Q        + S + ++   E+++D LI+L+ K  LD + N   + ++I ++Q+ Y+     Q  +  +++ + I       +C+  ++  +   L+  
Sbjct:  253 IQLEQVQEWK--SKMQEQQADLQRRLKEAKEAKEALEAK-ERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQ-------QRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLN-------------------------LEEKVRELRETVGDLEAMNEMNDELQENARETELELREQL---DMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELI------RKQAQEKFDLSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYE-HALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEESTMQLADHIKFTQSALDCMSVEVGRLRAFLQGG 773          

HSP 2 Score: 65.0846 bits (157), Expect = 4.830e-9
Identity = 36/90 (40.00%), Postives = 50/90 (55.56%), Query Frame = 1
Query:  145 GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQ-STEVTSSE--NEVHDKLLNSCGETRDLTAQTS 405
            GTV ++G+T  A G + G+ L  A G+ DGT+ G  YF C E HGIF R+SQ+   +   + TS E  +    K+L   G   D  A+TS
Sbjct:   42 GTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKILKREGA--DAAAKTS 129          
BLAST of Centrosome-associated protein 350 vs. UniProt/SwissProt
Match: sp|Q6PCJ1|DCTN1_XENLA (Dynactin subunit 1 OS=Xenopus laevis OX=8355 GN=dctn1 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 7.047e-17
Identity = 146/739 (19.76%), Postives = 305/739 (41.27%), Query Frame = 1
Query: 1312 YRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYE------QVLEENSMLKNSDGTSDA---KIFIDQTSTINKYKNALLELSQS-----INCYKEENRNLNSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKKAK---AKDRELSSLTFSKQ--NIEKNEMK------------------RDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLY----QQRDNSEKTPENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLENNVGEQTLKLMDNLNKISTNVQSTMKNTQMYLRHNQRITFDSSVSKSIDGIIFSLMDIVLSISDFALQ-LTDERIFSDEAMCRLTEIFANNRNPLNPTSDNEILFSLNSID---KQVENI--------------------------VSNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQK 3315
            Y + M    + IEM T+DKEMAEE+ E + Q+   LK   E      ++L+     K SDG + +   K   +Q + + +    + +LS S     I   K+  +  N+ELD L++       + E+L+ +    EK + E+K+ VD+    E +++ L  +N                           +E K +++RE   + + +N + +E+Q    + ++E  E L   +    R+      ++  +  +    + +KK +   A  +E++S   ++Q  ++EK +                    + IE +L+ +E++  +  V LL  ++P SF   GG+HD I  + ++ +LI K  L+ +   +K  L     Q+        E +     L + L +    L + +  +   S E   ++   + ++   E+++D LI+L+ K  LD + N   + ++I ++Q+ Y+     Q  +C +++ + I       +C+  ++S +   L  + G+++      L  + T+     +             F   + + + G   + +   L       + L D R +    +    E+ A     + P  +NE L +L   D   K  E I                           +  + G YDA+K        ++  A   R ++   + L  +++ ++ ++  + + LK K  +LSE  ++++  ++K
Sbjct:  251 YMEEMADTADAIEMATLDKEMAEERAESLQQEVDTLKDKVEEHKIDLEILKHEIEEKGSDGAASSYQVKQLEEQNARLKEALVRMRDLSASEKQEHIKVQKQMEKK-NTELDTLRQ-------QKEKLQEEASHMEKTIDELKEQVDAALGAEEMVETLAERNLD-------------------------LEEKVRELRETVSDLEAINEMNDELQENARETELELREQL---DMAGARVREAEKRVEAAQETVADYQQTIKKYRDLTAHLQEVNSELRNQQEASVEKEQQPSPEMFDFKIKFAETKAHAKAIEMELRKMEVTQANRHVSLLTSFMPDSFLRHGGDHDCILVLLLIPRLICKAELISKQAQEKFELSEVGEQKSGMRGAVGEQMSFAAGLVYSLTLLQATLHKYEQALDKCSVEVYKKVGMLYPEMSVHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLADQAEECTMQLSDHIKFTQSALDCMGVEVSRLRAFL--HAGQESSDFAILLKDLETSCSDIRQ-------------FCKKIRRRMPGTEAAGIPAALGFGQQVCETLLDCRKYLKCVVAVFQEVAAAGAQMIAPMGENEGLQALKLEDVAFKATEQIYGTKGSNPYECLRQSCSVVIATMNKMATAMQEGEYDAEKPQSKSPPPVEQRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKK 938          

HSP 2 Score: 65.855 bits (159), Expect = 2.600e-9
Identity = 30/79 (37.97%), Postives = 46/79 (58.23%), Query Frame = 1
Query:  103 FQIGDSV-LYNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQSTEVTSS 336
             ++G  V +      GTV ++G+T  A G + G+ L  + G+ DGT+ G  YF C+E HGIF R+SQ+  I+    T+S
Sbjct:   10 LKVGSRVEVIGKGYRGTVAYVGATLFATGKWVGVILDDSKGKNDGTVQGRRYFTCEENHGIFVRQSQIQVIEDGADTTS 88          
BLAST of Centrosome-associated protein 350 vs. UniProt/SwissProt
Match: sp|P35458|DCTN1_CHICK (Dynactin subunit 1 OS=Gallus gallus OX=9031 GN=DCTN1 PE=1 SV=2)

HSP 1 Score: 90.1225 bits (222), Expect = 1.149e-16
Identity = 122/545 (22.39%), Postives = 241/545 (44.22%), Query Frame = 1
Query: 1186 LQILKKKEYKRCGDLEKLNNELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYE------QVLEENSMLKNSDGTSDAKIFIDQTSTINKYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKK-----AKAKD--RELSS---LTFSKQNIEKNEM-------------KRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQ----QRDNSEKTPENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECL 2700
            +Q  K K  ++  DL++   E ++E  DA E +ER       Y + M    + IEM T+DKEMAEE+ E + Q+  +LK+  E      ++L+     K SDG + +           + K AL+ +       K+E+  L       N+EL+ L++       + E+L+ ++++ EK + E+K+ VD+    E +++ LT +N                           +E K +++RE   + + +N + +E+Q    + ++E  E L   +    R+      ++  +  +    + +KK     A  +D  REL S    +  KQ     E+              + IE +L+ +E+   +  V LL  ++P SF   GG+HD I  + ++ +LI K  ++ +   +K  L +    +        E +     L + L +    L + +  ++  S E   ++   + ++   E+++D LI+L+ K  LD + N   + ++I ++Q+ Y+     Q  DC +++ + I       +C+
Sbjct:  251 VQEWKSKMQEQQADLQRRLKEAKKEAKDALEAKER-------YMEEMADTADAIEMATLDKEMAEERAESLQQEVDSLKEKVEYLTMDLEILKHEIEEKGSDGAASSYQVKQLEEQNARLKEALVRMRDLSASEKQEHVKLQKQMEKKNTELESLRQ-------QREKLQEEVKQAEKTVDELKEQVDAALGAEEMVETLTERNLD-------------------------LEEKVRELRETVGDLEAMNEMNDELQENARETELELREQL---DLAAARVREAEKRVEAAQETVADYQQTIKKYRELTAHLQDVNRELMSQQEASAEKQQQPPPEIFDFKIKFAETKAHAKAIEMELRQMEVQQANRHVSLLTSFMPDSFLRHGGDHDCILVLLLIPRLICKADVISKQAQEKFELNENCTARAGLRGAAGEQLSFAAGLVYSLSLLQATLHKYEQALNKCSVEVYKKVGMLYPEMSVHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQAEDCTMQLADHIKFTQSALDCM 753          

HSP 2 Score: 66.6254 bits (161), Expect = 1.700e-9
Identity = 26/53 (49.06%), Postives = 36/53 (67.92%), Query Frame = 1
Query:  145 GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQL 303
            GTV ++G+T  A G + G+ L  A G+ DGT+ G  YF C+E HGIF R+SQ+
Sbjct:   43 GTVAYVGATLXATGKWVGVILDEAKGKNDGTVQGRKYFTCEENHGIFVRQSQI 95          
BLAST of Centrosome-associated protein 350 vs. TrEMBL
Match: A0A0B7AZ82 (Dynactin domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF150889 PE=4 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 2.589e-25
Identity = 129/528 (24.43%), Postives = 279/528 (52.84%), Query Frame = 1
Query: 1186 LQILKKKEYKRCGDLEKLNNELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSMLKN------SDGTSDAKIFIDQTSTIN-KYKNALLELSQSINCYKEENRNLNSELDILK-ELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKKAKAKDRELSSLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQ--QRDNSEKT--PENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQML 2733
            +Q+ + +EYK    +++ + +LQR+L  +K+    +++EF+ Y++ M    E +EM T+DKEMAEEK E +  +  ++K+  E++  +  +L+N      SDG + A   + Q    N + K+AL++L   +N  K++    + +++ L+ EL + ++++ E+++  + +HEK+L ++K+ VD+    E ++++LT +N  LE E++++ +   +L+ L D   E+ E+      E  EE D  ++ + E Q  LD  +   SE  KT N+  E +  L  +L+ K+ E         + K +   +  + F  +  E     + I+ +L+ +E+   +  ++++I ++P +F   GG+HD +    ++ ++I+K  L+   +  K  +    +RD+  K+   E       L  LL +  G++KQ +  ++  S +   ++ +   ++   E+++D  IDL++K  LD + +   + +S+ FFQ  Y     ++++DC   M N + ++    + +  +++ +  +L
Sbjct:   84 IQLQQLQEYK--SKIQETHADLQRQLQASKKELSELQQEFEQYKEEMADVTETVEMATLDKEMAEEKAESLQAELDSMKEKVEELTIDLELLRNEISAKGSDGVA-ATFEMKQMEQQNERMKDALVKLRDMLNSEKQDRARSDKQVEKLEGELGLLKKDK-ERMQVLLSQHEKELIDLKEQVDAALGAEEMVEQLTERNLKLEDEMREIIEEKNDLEALNDMNEELQENAKTTEFELREELDMKSIKLLEFQRKLDGTQETFSEYDKTLNKFRELVANLQEQLRSKQQES--------ETKVETPTVELMDFKTKFAETKAYAKTIDMELRKLEVQQANAHIKMIISFMPEAFMGRGGDHDALSVSLMIPRIINKAELLASQVKDKFDITDKIERDHVLKSQKAEQCSFGNHLILLLNVLQGVMKQYESALNSCSTDLFLKIGTLVPEMTAHEKSVDYFIDLLRKDQLDETVSLDLLEKSVNFFQQLYTVHLSHERVDCTHMMTNGVRVVLTACDAISTEIARLKILL 599          
BLAST of Centrosome-associated protein 350 vs. TrEMBL
Match: A0A0B7AYS5 (Dynactin domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF150896 PE=4 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 3.023e-25
Identity = 129/528 (24.43%), Postives = 279/528 (52.84%), Query Frame = 1
Query: 1186 LQILKKKEYKRCGDLEKLNNELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSMLKN------SDGTSDAKIFIDQTSTIN-KYKNALLELSQSINCYKEENRNLNSELDILK-ELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKKAKAKDRELSSLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQ--QRDNSEKT--PENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQML 2733
            +Q+ + +EYK    +++ + +LQR+L  +K+    +++EF+ Y++ M    E +EM T+DKEMAEEK E +  +  ++K+  E++  +  +L+N      SDG + A   + Q    N + K+AL++L   +N  K++    + +++ L+ EL + ++++ E+++  + +HEK+L ++K+ VD+    E ++++LT +N  LE E++++ +   +L+ L D   E+ E+      E  EE D  ++ + E Q  LD  +   SE  KT N+  E +  L  +L+ K+ E         + K +   +  + F  +  E     + I+ +L+ +E+   +  ++++I ++P +F   GG+HD +    ++ ++I+K  L+   +  K  +    +RD+  K+   E       L  LL +  G++KQ +  ++  S +   ++ +   ++   E+++D  IDL++K  LD + +   + +S+ FFQ  Y     ++++DC   M N + ++    + +  +++ +  +L
Sbjct:   84 IQLQQLQEYK--SKIQETHADLQRQLQASKKELSELQQEFEQYKEEMADVTETVEMATLDKEMAEEKAESLQAELDSMKEKVEELTIDLELLRNEISAKGSDGVA-ATFEMKQMEQQNERMKDALVKLRDMLNSEKQDRARSDKQVEKLEGELGLLKKDK-ERMQVLLSQHEKELIDLKEQVDAALGAEEMVEQLTERNLKLEDEMREIIEEKNDLEALNDMNEELQENAKTTEFELREELDMKSIKLLEFQRKLDGTQETFSEYDKTLNKFRELVANLQEQLRSKQQES--------ETKVETPTVELMDFKTKFAETKAYAKTIDMELRKLEVQQANAHIKMIISFMPEAFMGRGGDHDALSVSLMIPRIINKAELLASQVKDKFDITDKIERDHVLKSQKAEQCSFGNHLILLLNVLQGVMKQYESALNSCSTDLFLKIGTLVPEMTAHEKSVDYFIDLLRKDQLDETVSLDLLEKSVNFFQQLYTVHLSHERVDCTHMMTNGVRVVLTACDAISTEIARLKILL 599          
BLAST of Centrosome-associated protein 350 vs. TrEMBL
Match: A0A2C9LC92 (CAP-Gly domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106072715 PE=4 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.635e-23
Identity = 132/539 (24.49%), Postives = 279/539 (51.76%), Query Frame = 1
Query: 1186 LQILKKKEYKRCGDLEKLNNELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSMLKN------SDGTSDAKIFIDQTSTIN-KYKNALLELSQSINCYKEENRN-------LNSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKKAKAKDRELSSLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQQRDNSEKTPENICIQYKLEFLLLIWC---------GLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQML 2733
            +Q+ + +EYK    +++ + +LQR+L  +K+    +++E++SY++ M    E +EM T+DKEMAEEK E +  +  ++K+  E++  +  +++N      S+G + A   + Q    N + K+AL++L   +N  K++ +        L SEL +L+        + E+L++++  +EK+L ++K+ VD+    E +++ LT +N  LE E+K++ +   +L+ L D   E+ E+      E  EE D  N+ + EIQ  LD  +   ++  +T N+  E +  L  +L+ K+ E +       K +    EL  + F  +  E     + I+ +L+ ++I   +  +++L+ ++P +F   GG+HD I  + +V ++++K  L+   +  K   Y+  D  E+  E++   +K E                G++KQ +  ++  S +   ++ +   ++   E+++D  IDL++K  LD + +   + +SI+FFQ  Y     ++++DC   M + + I+    + +  +++ +  +L
Sbjct:  283 IQLQQLQEYK--SRMQESHADLQRQLQASKKELSELQQEYESYKEEMADVTETVEMATLDKEMAEEKAESLQAELDSMKEKVEELTLDLELIRNEISSKGSEGVA-ATFELKQMEQQNERMKDALVKLRDMLNSEKQDRQRSDKMVEKLESELAVLR-------KDKERLQAQVTVYEKELIDLKEQVDAALGAEEMVETLTERNLKLEDEIKEILEEKNDLEALNDMNEELQENAKATELELREEVDMKNIKLLEIQRKLDATQETFADYDRTLNKFRELVAHLQEQLRSKQQESET------KVETPTAEL--MDFKTKFAETKAYAKTIDMELRRVDIHQANSHIKMLLSFMPDAFMGRGGDHDAICILLMVPRIMNKAELLASQVKDK---YEIADKLER--EHVLKSHKAEQFSFANHLNLLLNILYGIMKQYESALNSCSTDLFLKIGTLLPEMTAHEKSVDYFIDLLRKDQLDETVSVDLLEKSISFFQQLYTVHLSHERVDCTHMMSSDVRIVLSACDAIATEITRLKILL 798          
BLAST of Centrosome-associated protein 350 vs. TrEMBL
Match: Q07DR3 (Dynactin 1a OS=Danio rerio OX=7955 GN=dctn1a PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 3.637e-22
Identity = 160/738 (21.68%), Postives = 348/738 (47.15%), Query Frame = 1
Query: 1228 LEKLNNELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSML------KNSDGTSDAKIFIDQTSTIN-KYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKKAKAKDRELSSLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRL----YQQRDNSEKTPENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLE-NNVGEQTLKLMDNLN-----------KISTNVQST-MKNTQMYLRHNQRITFDSSVS-KSIDGIIFSLMDIVLSISDFALQLTDERIFS-----DEAMCRLTEIFANNRNPLNPTSDNEILF-SLNSIDKQVENIVSNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTA 3327
            +++  N+LQ++L +AK+      +  D Y + M    + IEM T+DKEMAEE+ E + Q+  +LK+  E++  +  +L      K SDG + +   + Q    N + K AL+ +    +  K+E+  L       NSEL+ L+       ++ E+L+ +++  E  + E+K+ VD+    E +++ LT +N  LE+++++L++ + +L+ + +   E+ E+  +   E  E+ D     V E Q  ++  +   ++  +T N+  E    L    +E   +     E +++  A   EL    F  +  E     + IE +L+ +E+S  + QV LL  ++P SF   GG+HD I  + ++ +LI K  L+ +   +K  L     ++        E +     L + L +    L + ++ +     +   ++ + + ++   E+++D LIDL+ K  LD +     + ++I ++Q+ Y+   C Q  DC +++ + I       +C+ +++  +   L+    G +   L+ +L+           KI   +  T        LR +++++   + S K +  ++  L ++  + +     L ++   S     D A   + +++      LNP    E L  S +++   +  + +  + G YD+++  +     ++T A   R ++   + L  +++ ++ ++  + + LK K  +LSE  ++++  ++KL T+
Sbjct:  214 MQEQQNDLQKQLKEAKKEAREALEAKDRYMEEMADTADAIEMATLDKEMAEERAESLQQETESLKEKLEELTMDMEILKHEIEEKGSDGAASS-YHVKQLEEQNARLKEALVRMRDLSSSEKQEHVKLQKQMEKKNSELETLR-------SQKEKLQEEMKLAEDTIDELKEQVDAALGAEEMVETLTERNLDLEEKVRELRETVSDLESINEMNDELQENARETELELREQLDLAGARVREAQKRVEAAQETLADYQQTINKYRELTTHLQEVNRELTNQQSSSAEQLQQPAA---EL--FDFKIKFAETKAYAKAIEMELRKMEVSQANRQVSLLTSFMPESFLRHGGDHDCILVLLLIPRLICKAELISKQAQEKFDLNGGSLERAGLRGAAGEQLSFASGLVYSLTLLQATLHKYELALSVCGVDVYKRMGTLYSEMCVHERSLDFLIDLLHKDQLDETVQVEPLTKAIKYYQHLYSVHLCDQPEDCTVQLADHIKFTQSALDCMGSEVGRLRAFLQAGQEGAELCVLLKDLDTSCGDIRQFCKKIRRRMPGTDAPGIPAALRFSEQVSEALADSRKQLARVVAVLQEVSAAGAQMMAPLQEQEGLSAVKIEDVAFKAVEQVYGTQG--LNP---YECLRQSCSAVIATMNKMATAMQEGEYDSERPQRP-PPPVETRAAAVRAEMTDAEGLGNKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDTS 932          

HSP 2 Score: 68.1662 bits (165), Expect = 1.823e-7
Identity = 30/70 (42.86%), Postives = 42/70 (60.00%), Query Frame = 1
Query:  145 GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQSTEVTSSENEVHD 354
            GTV +IG+T  A G + G+ L  A G+ DGT+ G  YF C+E HGIF R+SQ+  I     +++  E  D
Sbjct:   25 GTVAYIGATLFASGKWVGVILDEAKGKNDGTVQGKRYFTCEENHGIFVRQSQIQLIDDGGSSATSPETPD 94          
BLAST of Centrosome-associated protein 350 vs. TrEMBL
Match: A0A286YA27 (Dynactin 1a OS=Danio rerio OX=7955 GN=dctn1a PE=1 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 9.751e-22
Identity = 160/738 (21.68%), Postives = 347/738 (47.02%), Query Frame = 1
Query: 1228 LEKLNNELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSML------KNSDGTSDAKIFIDQTSTIN-KYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKKAKAKDRELSSLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRL----YQQRDNSEKTPENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLE-NNVGEQTLKLMDNLN-----------KISTNVQST-MKNTQMYLRHNQRITFDSSVS-KSIDGIIFSLMDIVLSISDFALQLTDERIFS-----DEAMCRLTEIFANNRNPLNPTSDNEILF-SLNSIDKQVENIVSNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTA 3327
            +++  N+LQ++L +AK+      +  D Y + M    + IEM T+DKEMAEE+ E + Q+  +LK+  E++  +  +L      K SDG + +   + Q    N + K AL+ +    +  K+E+  L       NSEL+ L+       ++ E+L+ +++  E  + E+K+ VD+    E +++ LT +N  LE+++++L++ + +L+ + +   E+ E+  +   E  E+ D     V E Q  ++  +   ++  +T N+  E    L    +E   +     E +++  A   EL    F  +  E     + IE +L+ +E+S  + QV LL  ++P SF   GG+HD I  + ++ +LI K  L+ +   +K  L     ++        E +     L + L +    L + ++ +     +   ++   + ++   E+++D LIDL+ K  LD +     + ++I ++Q+ Y+   C Q  DC +++ + I       +C+ +++  +   L+    G +   L+ +L+           KI   +  T        LR +++++   + S K +  ++  L ++  + +     L ++   S     D A   + +++      LNP    E L  S +++   +  + +  + G YD+++  +     ++T A   R ++   + L  +++ ++ ++  + + LK K  +LSE  ++++  ++KL T+
Sbjct:  246 MQEQQNDLQKQLKEAKKEAREALEAKDRYMEEMADTADAIEMATLDKEMAEERAESLQQETESLKEKLEELTMDMEILKHEIEEKGSDGAASS-YHVKQLEEQNARLKEALVRMRDLSSSEKQEHVKLQKQMEKKNSELETLR-------SQKEKLQEEMKLAEDTIDELKEQVDAALGAEEMVETLTERNLDLEEKVRELRETVSDLESINEMNDELQENARETELELREQLDLAGARVREAQKRVEAAQETLADYQQTINKYRELTTHLQEVNRELTNQQSSSAEQLQQPAA---EL--FDFKIKFAETKAYAKAIEMELRKMEVSQANRQVSLLTSFMPESFLRHGGDHDCILVLLLIPRLICKAELISKQAQEKFDLTGGSLERAGLRGAAGEQLSFASGLVYSLTLLQATLHKYELALSVCGVDVYKRMGMLYSEMCVHERSLDFLIDLLHKDQLDETVQVEPLTKAIKYYQHLYSVHLCDQPEDCTVQLADHIKFTQSALDCMGSEVGRLRAFLQAGQEGAELCVLLKDLDTSCGDIRQFCKKIRRRMPGTDAPGIPAALRFSEQVSEALADSRKQLARVVAVLQEVSAAGAQMMAPLQEQEGLSAVKIEDVAFKAVEQVYGTQG--LNP---YECLRQSCSAVIATMNKMATAMQEGEYDSERPQRP-PPPVETRAAAVRAEMTDAEGLGNKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDTS 964          

HSP 2 Score: 66.6254 bits (161), Expect = 4.354e-7
Identity = 29/70 (41.43%), Postives = 42/70 (60.00%), Query Frame = 1
Query:  145 GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQSTEVTSSENEVHD 354
            GTV +IG+T  A G + G+ L  A G+ DGT+ G  YF C+E HGIF R+SQ+  +     +++  E  D
Sbjct:   25 GTVAYIGATLFASGKWVGVILDEAKGKNDGTVQGKRYFTCEENHGIFVRQSQIQLMDDGGSSATSPETPD 94          
BLAST of Centrosome-associated protein 350 vs. Ensembl Cavefish
Match: ENSAMXT00000043575.1 (dynactin subunit 1-like [Source:NCBI gene;Acc:103029055])

HSP 1 Score: 100.138 bits (248), Expect = 1.034e-20
Identity = 153/757 (20.21%), Postives = 330/757 (43.59%), Query Frame = 1
Query: 1243 NELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSMLK------NSDGTSDAKIFIDQTSTIN-KYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTN----QMNERICXXXXXXXXXXXXXXXXXXXVKKAKAKDRELSS----------------LTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRL----YQQRDNSEKTPENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQML---ENNVGEQTLKLM-----DNLNKISTNVQSTMKNTQM-----YLRHNQRIT-FDSSVSKSIDGIIFSLMDIVLSISDFALQLTDERIFS-----DEAMCRLTEIFANNRNPLNPTSDNEILF-SLNSIDKQVENIVSNFKSGVYDADK---LNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTAV 3330
            N+LQ++L +AK+      +  D Y + M    + IEM T+DKEMAEE+ E + Q+   LK+  E++  +  +LK       +DG + +   + Q    N + K AL+ +       K+E+  L       NSEL+ L+        + E+L+ +++  E  + E+K+ VD+    E +++ LT +N                           +E K +++RE   + + +N + +E+Q    + ++E  E L        + N+R+      + + +  I K  ++    +  +REL++                  F  +  E     + IE +L+ +E++  + QV LL  ++P SF   GG+HD I  + ++ +LI K  L+ +   +K  L     ++        E +     L + L +    L +    ++  S +   ++ + F ++   E+ +D LI+L+ K  LD +     + ++I ++Q  Y+     Q  DC +++ + I       +C+  ++  +   L   +   G   L         ++ +    ++  M  T        L +  +++   +   K +  ++  L ++  + +     L ++   S     D A   + +++ ++   LNP   NE L  S +++   +  + +  + G YDA+K   +  T +  ++  A   R ++   + L  +++ ++ ++  + + LK K  +LSE  ++++  ++KL T+ 
Sbjct:   87 NDLQKQLKEAKKEAREALEAKDRYMEEMADTSDAIEMATLDKEMAEERAESLQQEVEGLKEKVEELTMDLEILKHEIEEKGTDGAASS-YHVKQLEEQNGRLKEALVRMRDLSASEKQEHVKLQKQMEKKNSELETLR-------AQKEKLQEEMKHAEATIDELKEQVDAALGAEEMVETLTGRNLD-------------------------LEEKVRELRETVSDLEAINEMNDELQENARETELELREQLDLAGARVREANKRVEAAQETVADYQQTINKYRDLTAHLQELNRELTNQQSATVEQLQQPPAELFDFKIKFAETKAYAKAIEMELRKMEVAQANRQVSLLTSFMPDSFLRHGGDHDCILVLLLIPRLICKAELISKQAQEKFDLNGNVVERTGLRGSAGEQLSFASGLVYSLTLLQATLHKYDQALNQCSVDVYKRMGTLFSEMSVHERCLDFLIELLHKDQLDETVQVEPLTKAIKYYQQLYSIHLAEQTEDCTVQLADHIKFTQSALDCMGAEVGRLRSFLQAGQEGAGLTLLLKDLDTSCGDIRQFCKKIRRRMPGTDAPGIPSALSYPPQVSELLADCRKQLARVVAVLQEMGAAGAQMIAPLAEQEGLSALKLEDVAFTAVEQVYGSHG--LNP---NECLRQSCSAVIATMNKMATAMQEGEYDAEKPQLIMHTHSPPVEARAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDTST 805          
BLAST of Centrosome-associated protein 350 vs. Ensembl Cavefish
Match: ENSAMXT00000057148.1 (dynactin subunit 1-like [Source:NCBI gene;Acc:103029055])

HSP 1 Score: 98.2117 bits (243), Expect = 4.372e-20
Identity = 152/753 (20.19%), Postives = 329/753 (43.69%), Query Frame = 1
Query: 1243 NELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSMLK------NSDGTSDAKIFIDQTSTIN-KYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTN----QMNERICXXXXXXXXXXXXXXXXXXXVKKAKAKDRELSS----------------LTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRL----YQQRDNSEKTPENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQML---ENNVGEQTLKLM-----DNLNKISTNVQSTMKNTQM-----YLRHNQRIT-FDSSVSKSIDGIIFSLMDIVLSISDFALQLTDERIFS-----DEAMCRLTEIFANNRNPLNPTSDNEILF-SLNSIDKQVENIVSNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTA 3327
            N+LQ++L +AK+      +  D Y + M    + IEM T+DKEMAEE+ E + Q+   LK+  E++  +  +LK       +DG + +   + Q    N + K AL+ +       K+E+  L       NSEL+ L+        + E+L+ +++  E  + E+K+ VD+    E +++ LT +N                           +E K +++RE   + + +N + +E+Q    + ++E  E L        + N+R+      + + +  I K  ++    +  +REL++                  F  +  E     + IE +L+ +E++  + QV LL  ++P SF   GG+HD I  + ++ +LI K  L+ +   +K  L     ++        E +     L + L +    L +    ++  S +   ++ + F ++   E+ +D LI+L+ K  LD +     + ++I ++Q  Y+     Q  DC +++ + I       +C+  ++  +   L   +   G   L         ++ +    ++  M  T        L +  +++   +   K +  ++  L ++  + +     L ++   S     D A   + +++ ++   LNP   NE L  S +++   +  + +  + G YDA+K  +  +  ++  A   R ++   + L  +++ ++ ++  + + LK K  +LSE  ++++  ++KL T+
Sbjct:  204 NDLQKQLKEAKKEAREALEAKDRYMEEMADTSDAIEMATLDKEMAEERAESLQQEVEGLKEKVEELTMDLEILKHEIEEKGTDGAASS-YHVKQLEEQNGRLKEALVRMRDLSASEKQEHVKLQKQMEKKNSELETLR-------AQKEKLQEEMKHAEATIDELKEQVDAALGAEEMVETLTGRNLD-------------------------LEEKVRELRETVSDLEAINEMNDELQENARETELELREQLDLAGARVREANKRVEAAQETVADYQQTINKYRDLTAHLQELNRELTNQQSATVEQLQQPPAELFDFKIKFAETKAYAKAIEMELRKMEVAQANRQVSLLTSFMPDSFLRHGGDHDCILVLLLIPRLICKAELISKQAQEKFDLNGNVVERTGLRGSAGEQLSFASGLVYSLTLLQATLHKYDQALNQCSVDVYKRMGTLFSEMSVHERCLDFLIELLHKDQLDETVQVEPLTKAIKYYQQLYSIHLAEQTEDCTVQLADHIKFTQSALDCMGAEVGRLRSFLQAGQEGAGLTLLLKDLDTSCGDIRQFCKKIRRRMPGTDAPGIPSALSYPPQVSELLADCRKQLARVVAVLQEMGAAGAQMIAPLAEQEGLSALKLEDVAFTAVEQVYGSHG--LNP---NECLRQSCSAVIATMNKMATAMQEGEYDAEKPQRV-SPPVEARAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDTS 917          
BLAST of Centrosome-associated protein 350 vs. Ensembl Cavefish
Match: ENSAMXT00000040825.1 (dynactin subunit 1-like [Source:NCBI gene;Acc:103029055])

HSP 1 Score: 97.8265 bits (242), Expect = 5.047e-20
Identity = 152/753 (20.19%), Postives = 329/753 (43.69%), Query Frame = 1
Query: 1243 NELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSMLK------NSDGTSDAKIFIDQTSTIN-KYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTN----QMNERICXXXXXXXXXXXXXXXXXXXVKKAKAKDRELSS----------------LTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRL----YQQRDNSEKTPENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQML---ENNVGEQTLKLM-----DNLNKISTNVQSTMKNTQM-----YLRHNQRIT-FDSSVSKSIDGIIFSLMDIVLSISDFALQLTDERIFS-----DEAMCRLTEIFANNRNPLNPTSDNEILF-SLNSIDKQVENIVSNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTA 3327
            N+LQ++L +AK+      +  D Y + M    + IEM T+DKEMAEE+ E + Q+   LK+  E++  +  +LK       +DG + +   + Q    N + K AL+ +       K+E+  L       NSEL+ L+        + E+L+ +++  E  + E+K+ VD+    E +++ LT +N                           +E K +++RE   + + +N + +E+Q    + ++E  E L        + N+R+      + + +  I K  ++    +  +REL++                  F  +  E     + IE +L+ +E++  + QV LL  ++P SF   GG+HD I  + ++ +LI K  L+ +   +K  L     ++        E +     L + L +    L +    ++  S +   ++ + F ++   E+ +D LI+L+ K  LD +     + ++I ++Q  Y+     Q  DC +++ + I       +C+  ++  +   L   +   G   L         ++ +    ++  M  T        L +  +++   +   K +  ++  L ++  + +     L ++   S     D A   + +++ ++   LNP   NE L  S +++   +  + +  + G YDA+K  +  +  ++  A   R ++   + L  +++ ++ ++  + + LK K  +LSE  ++++  ++KL T+
Sbjct:  222 NDLQKQLKEAKKEAREALEAKDRYMEEMADTSDAIEMATLDKEMAEERAESLQQEVEGLKEKVEELTMDLEILKHEIEEKGTDGAASS-YHVKQLEEQNGRLKEALVRMRDLSASEKQEHVKLQKQMEKKNSELETLR-------AQKEKLQEEMKHAEATIDELKEQVDAALGAEEMVETLTGRNLD-------------------------LEEKVRELRETVSDLEAINEMNDELQENARETELELREQLDLAGARVREANKRVEAAQETVADYQQTINKYRDLTAHLQELNRELTNQQSATVEQLQQPPAELFDFKIKFAETKAYAKAIEMELRKMEVAQANRQVSLLTSFMPDSFLRHGGDHDCILVLLLIPRLICKAELISKQAQEKFDLNGNVVERTGLRGSAGEQLSFASGLVYSLTLLQATLHKYDQALNQCSVDVYKRMGTLFSEMSVHERCLDFLIELLHKDQLDETVQVEPLTKAIKYYQQLYSIHLAEQTEDCTVQLADHIKFTQSALDCMGAEVGRLRSFLQAGQEGAGLTLLLKDLDTSCGDIRQFCKKIRRRMPGTDAPGIPSALSYPPQVSELLADCRKQLARVVAVLQEMGAAGAQMIAPLAEQEGLSALKLEDVAFTAVEQVYGSHG--LNP---NECLRQSCSAVIATMNKMATAMQEGEYDAEKPQRV-SPPVEARAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDTS 935          
BLAST of Centrosome-associated protein 350 vs. Ensembl Cavefish
Match: dctn1b (dynactin subunit 1 [Source:NCBI gene;Acc:103040401])

HSP 1 Score: 95.9005 bits (237), Expect = 2.302e-19
Identity = 163/766 (21.28%), Postives = 329/766 (42.95%), Query Frame = 1
Query: 1243 NELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSMLK------NSDGTSDAKIFIDQTSTIN-KYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELL----KTTNQMNERICXXXXXXXXXXXXXXXXXXXVKKAKAKDRELSS---------------LTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQ---QRDNSE-KTPENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLENNVGEQTLK-LMDNLNKISTNVQSTMKNTQMYLRHNQRITFDSSVSKSIDGIIFSLMDIVLSISDFALQLTDERIFSDEAMCR----LTEIFANNRNPLNPTSDNEILFSLNSID---KQVENI--------------------------VSNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTA 3327
            NELQ++L +AK+  +   +  + Y + M    + IEM T+DKEMAEE+ E +  +   LK+  +++  +  +LK       SDG + +   + Q    N + K AL+ +       K+E+  L       N ELD+L+   + +E   E++K      EK + E+K+ VD+    E +++ LT +N                           +E K +++RE   + + +N + +E+Q    + ++E  E L     +  +  +R+      + + +  IQK  E+    +  +REL S                 F  +  E     + IE +L+ +E++  + QV LL  ++P SF   GG+HD I  + ++ +LI K  L+ +   +K  L +   QR      T E +     L + L +    L + +  ++  S +   ++ S + ++   E+++D LIDL+ K  LD + N   + ++I ++Q+ Y+     Q  DC +++ + I       +C+  ++  +   L+    E  L  L+ +L+   ++++   K  +  +                 GI  +L        +F  Q+ +    S   +      L E+ A     + P  ++E L +L   D   K  E I                           +  + G YD++K  +   + ++  A+  R ++   + L  +++ ++ ++  + + LK K  +LSE  ++++  ++KL +A
Sbjct:  244 NELQKQLKEAKKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQLEADALKEKVDELTMDLELLKHEIEEKGSDGAASS-YHVKQLEEQNARLKEALVRMRDLSASEKQEHLKLQKQMEKKNFELDVLR---VQKEKGQEEMKLA----EKTIDELKEQVDAALGAEQMVETLTERNLD-------------------------LEEKVRELRETVTDLEAINEMNDELQENARETELELREQLDLSAASVREAEKRVEAAQETVADYQHTIQKYRELTAHLQEANRELMSQQEATAEPQEQPAEMFDFKIKFAETKAYAKAIEMELRKMEVAQSNRQVALLTSFMPESFLRHGGDHDGILVLLLIPRLICKAELISKQAQEKFDLTENCSQRPGMRGSTGEQLSFSAGLIYSLSLLQATLHKYEHALNQCSVDVYKRVGSLYSEMSVHERSLDFLIDLLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQSEDCTMQLADHIKFTQSALDCMAVEVGRLRAFLQAGQDETQLSVLLKDLDTSCSDIRQFCKKIRRRMPGT-----------DAPGIPAAL--------NFGPQVCETLAESRRQLAWVNAVLQEVAAAGAQLIAPLGEHEGLPTLKLEDMAFKAAEQIYGSQGINPYECLRQSCSVVIATMNKMATAMQEGEYDSEK-PQCGIAPVNVRASALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSA 956          

HSP 2 Score: 64.6994 bits (156), Expect = 6.823e-10
Identity = 28/66 (42.42%), Postives = 40/66 (60.61%), Query Frame = 1
Query:  145 GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQSTEVTSSEN 342
            GTV +IG+T  A G + G+ L    G+ DGT+ G  YF C E HGIF R+SQ+  ++    T+S +
Sbjct:   44 GTVAYIGTTLFASGKWVGVILEEPKGKNDGTVQGKRYFTCLENHGIFVRQSQIQLVEDGADTTSPD 109          
BLAST of Centrosome-associated protein 350 vs. Ensembl Cavefish
Match: dctn1b (dynactin subunit 1 [Source:NCBI gene;Acc:103040401])

HSP 1 Score: 95.1301 bits (235), Expect = 3.421e-19
Identity = 163/766 (21.28%), Postives = 329/766 (42.95%), Query Frame = 1
Query: 1243 NELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSMLK------NSDGTSDAKIFIDQTSTIN-KYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELL----KTTNQMNERICXXXXXXXXXXXXXXXXXXXVKKAKAKDRELSS---------------LTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQ---QRDNSE-KTPENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLENNVGEQTLK-LMDNLNKISTNVQSTMKNTQMYLRHNQRITFDSSVSKSIDGIIFSLMDIVLSISDFALQLTDERIFSDEAMCR----LTEIFANNRNPLNPTSDNEILFSLNSID---KQVENI--------------------------VSNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTA 3327
            NELQ++L +AK+  +   +  + Y + M    + IEM T+DKEMAEE+ E +  +   LK+  +++  +  +LK       SDG + +   + Q    N + K AL+ +       K+E+  L       N ELD+L+   + +E   E++K      EK + E+K+ VD+    E +++ LT +N                           +E K +++RE   + + +N + +E+Q    + ++E  E L     +  +  +R+      + + +  IQK  E+    +  +REL S                 F  +  E     + IE +L+ +E++  + QV LL  ++P SF   GG+HD I  + ++ +LI K  L+ +   +K  L +   QR      T E +     L + L +    L + +  ++  S +   ++ S + ++   E+++D LIDL+ K  LD + N   + ++I ++Q+ Y+     Q  DC +++ + I       +C+  ++  +   L+    E  L  L+ +L+   ++++   K  +  +                 GI  +L        +F  Q+ +    S   +      L E+ A     + P  ++E L +L   D   K  E I                           +  + G YD++K  +   + ++  A+  R ++   + L  +++ ++ ++  + + LK K  +LSE  ++++  ++KL +A
Sbjct:  225 NELQKQLKEAKKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQLEADALKEKVDELTMDLELLKHEIEEKGSDGAASS-YHVKQLEEQNARLKEALVRMRDLSASEKQEHLKLQKQMEKKNFELDVLR---VQKEKGQEEMKLA----EKTIDELKEQVDAALGAEQMVETLTERNLD-------------------------LEEKVRELRETVTDLEAINEMNDELQENARETELELREQLDLSAASVREAEKRVEAAQETVADYQHTIQKYRELTAHLQEANRELMSQQEATAEPQEQPAEMFDFKIKFAETKAYAKAIEMELRKMEVAQSNRQVALLTSFMPESFLRHGGDHDGILVLLLIPRLICKAELISKQAQEKFDLTENCSQRPGMRGSTGEQLSFSAGLIYSLSLLQATLHKYEHALNQCSVDVYKRVGSLYSEMSVHERSLDFLIDLLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQSEDCTMQLADHIKFTQSALDCMAVEVGRLRAFLQAGQDETQLSVLLKDLDTSCSDIRQFCKKIRRRMPGT-----------DAPGIPAAL--------NFGPQVCETLAESRRQLAWVNAVLQEVAAAGAQLIAPLGEHEGLPTLKLEDMAFKAAEQIYGSQGINPYECLRQSCSVVIATMNKMATAMQEGEYDSEK-PQCGIAPVNVRASALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSA 937          

HSP 2 Score: 64.6994 bits (156), Expect = 7.961e-10
Identity = 28/66 (42.42%), Postives = 40/66 (60.61%), Query Frame = 1
Query:  145 GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQSTEVTSSEN 342
            GTV +IG+T  A G + G+ L    G+ DGT+ G  YF C E HGIF R+SQ+  ++    T+S +
Sbjct:   25 GTVAYIGTTLFASGKWVGVILEEPKGKNDGTVQGKRYFTCLENHGIFVRQSQIQLVEDGADTTSPD 90          
BLAST of Centrosome-associated protein 350 vs. Ensembl Sea Lamprey
Match: si:dkeyp-47f9.4 (si:dkeyp-47f9.4 [Source:ZFIN;Acc:ZDB-GENE-131126-9])

HSP 1 Score: 73.1738 bits (178), Expect = 2.394e-13
Identity = 29/71 (40.85%), Postives = 47/71 (66.20%), Query Frame = 1
Query:  100 EFQIGDSVLYNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKI 312
            E ++G+ +L + +  G +RF G+T  A G +YGIEL    GR DG++ G+ YF+C  KHG+FA  S++ ++
Sbjct:  436 ELELGERLLVSGQRAGVLRFQGTTHFAPGHWYGIELEQPSGRNDGSVAGVRYFQCPAKHGVFAPPSRVQRL 506          

HSP 2 Score: 63.5438 bits (153), Expect = 2.323e-10
Identity = 28/78 (35.90%), Postives = 44/78 (56.41%), Query Frame = 1
Query:  109 IGDSVLYNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQSTEVTSSEN 342
            +G  V+   +  G +RF G T  A   + G+EL  ADG+ +G++DG  YF C  +HGIFA  S++ + + +    S N
Sbjct:  236 VGQRVIVGGRKTGVLRFCGPTEFAGDQWAGVELDEADGKNNGSVDGTRYFTCAPRHGIFAPLSKVARAEESSRHGSLN 313          

HSP 3 Score: 55.4546 bits (132), Expect = 8.612e-8
Identity = 25/66 (37.88%), Postives = 36/66 (54.55%), Query Frame = 1
Query:  112 GDSVLYNSKLE-GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLT 306
            G+ VL     E GTVRF+G    A GT+ G+EL    G+ DG + G  YF C+   G+  R  +++
Sbjct:  578 GNQVLVAGTGEMGTVRFVGEVGFAAGTWLGLELRAPRGKHDGAVGGHRYFSCRPGCGVMVRPGRVS 643          
BLAST of Centrosome-associated protein 350 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006027.1 (pep scaffold:Pmarinus_7.0:GL478150:21952:49796:1 gene:ENSPMAG00000005440.1 transcript:ENSPMAT00000006027.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.1738 bits (178), Expect = 3.298e-13
Identity = 30/71 (42.25%), Postives = 45/71 (63.38%), Query Frame = 1
Query:  100 EFQIGDSVLYNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKI 312
            E +IGD VL +    G VRF+G    AKG + G+EL    G+ DG++ G  YF+C+ K+G+FA   ++T+I
Sbjct:  235 ELKIGDRVLVSGTKAGVVRFLGEADFAKGEWCGVELDEPLGKNDGSVAGTRYFQCQPKYGLFAPTHKVTRI 305          
BLAST of Centrosome-associated protein 350 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006020.1 (pep scaffold:Pmarinus_7.0:GL478150:21952:49796:1 gene:ENSPMAG00000005440.1 transcript:ENSPMAT00000006020.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.4034 bits (176), Expect = 5.451e-13
Identity = 30/71 (42.25%), Postives = 45/71 (63.38%), Query Frame = 1
Query:  100 EFQIGDSVLYNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKI 312
            E +IGD VL +    G VRF+G    AKG + G+EL    G+ DG++ G  YF+C+ K+G+FA   ++T+I
Sbjct:  231 ELKIGDRVLVSGTKAGVVRFLGEADFAKGEWCGVELDEPLGKNDGSVAGTRYFQCQPKYGLFAPTHKVTRI 301          

HSP 2 Score: 55.0694 bits (131), Expect = 1.355e-7
Identity = 24/59 (40.68%), Postives = 36/59 (61.02%), Query Frame = 1
Query:  136 KLEGTVRFIGS--TASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLT 306
            +L+G V F G   T+ A   + GIEL    G+ DG++ G+ YF+C+  HG+F R S+L 
Sbjct:   65 RLDGPVFFWGYGLTSHAVNEWAGIELEEPVGKNDGSVAGVRYFQCRPLHGVFTRPSKLA 123          
BLAST of Centrosome-associated protein 350 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004647.1 (pep scaffold:Pmarinus_7.0:GL484285:5077:12891:1 gene:ENSPMAG00000004232.1 transcript:ENSPMAT00000004647.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.2402 bits (160), Expect = 2.115e-11
Identity = 28/71 (39.44%), Postives = 44/71 (61.97%), Query Frame = 1
Query:  100 EFQIGDSVLYNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKI 312
            + ++GD VL      G VRF+G T  AKG + G+EL    G+ DG + G  YF+C++++G+FA   ++ KI
Sbjct:  190 DLKMGDRVLVGGTKAGVVRFVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQQRYGLFAPIHKVAKI 260          

HSP 2 Score: 64.3142 bits (155), Expect = 9.923e-11
Identity = 28/74 (37.84%), Postives = 44/74 (59.46%), Query Frame = 1
Query:   88 QMINEFQIGDSVLYNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTK 309
            + I++F IG+ V  N    G ++++G T  A G + GI L  A G+ DG + G+ YF C+   GIF R S+L++
Sbjct:   23 EFIDDFIIGERVWVNGSKPGHIQYLGETQFAPGQWAGIVLDEATGKNDGAVSGVRYFMCEAGRGIFTRPSKLSR 96          
BLAST of Centrosome-associated protein 350 vs. Ensembl Sea Lamprey
Match: dctn1a (dynactin 1a [Source:ZFIN;Acc:ZDB-GENE-070117-2205])

HSP 1 Score: 66.2402 bits (160), Expect = 5.233e-11
Identity = 28/67 (41.79%), Postives = 43/67 (64.18%), Query Frame = 1
Query:  145 GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQ-STEVTSSEN 342
            GTV ++G+T  A G + G+ L  A G+ DGT+ G  YF C++ HGIF R+SQ+  ++   + TS E+
Sbjct:   40 GTVAYVGATMFATGKWVGVILDEAKGKNDGTVQGKRYFTCEDNHGIFVRQSQIQLVEDGGDTTSPES 106          

HSP 2 Score: 56.9954 bits (136), Expect = 3.284e-8
Identity = 54/185 (29.19%), Postives = 99/185 (53.51%), Query Frame = 1
Query: 1246 ELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSML------KNSDGTSDAKIFIDQTSTIN-KYKNALLELSQSINCYKEE----NRNL---NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKN 1758
            +LQ++L +AK   + + +  + Y + M    + IEM T+DKEMAEEK E + Q+  NLK+  E++  +  +L      K SDG + +   + Q    N + K AL+ +       K+E     +++   NSELD L+        + E+L++++++ E  + E+K+ VD+    E +++ LT +N
Sbjct:  276 DLQKQLKEAKREAKEVIEAKERYMEEMADVSDAIEMATLDKEMAEEKSESLQQEVENLKEKVEELSMDLEILKHEIEEKGSDGAASS-YHVKQLEEQNARLKEALVRMRDLSTSEKQEYLKQQKHMEKKNSELDTLR-------TQKEKLQAELQQAEGIIDELKEQVDAALGAEDMVETLTERN 452          
BLAST of Centrosome-associated protein 350 vs. Ensembl Yeast
Match: NIP100 (Large subunit of the dynactin complex; dynactin is involved in partitioning the mitotic spindle between mother and daughter cells; putative ortholog of mammalian p150(glued) [Source:SGD;Acc:S000006095])

HSP 1 Score: 60.8474 bits (146), Expect = 1.386e-9
Identity = 31/85 (36.47%), Postives = 50/85 (58.82%), Query Frame = 1
Query:   82 GLQM---INEFQIGDSVLYNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEK--------HGIFARRSQL 303
            G+Q+   + +  + D+VL N +++G V+FIG T  AKG +YGIEL    G+ DG+ +GI YF+   K        +G+F ++  L
Sbjct:    5 GVQVDTNMQKISLQDTVLVN-EMKGRVKFIGETQFAKGIWYGIELDKPLGKNDGSANGIRYFDIDLKKANSNGGYYGLFCKKDTL 88          
BLAST of Centrosome-associated protein 350 vs. Ensembl Nematostella
Match: EDO33600 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRR5])

HSP 1 Score: 75.0998 bits (183), Expect = 3.618e-14
Identity = 40/101 (39.60%), Postives = 60/101 (59.41%), Query Frame = 1
Query:   88 QMINEFQIGDSVLYNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKI-QSTEVTSS--EN----EVHDKLLNS 369
            +++  FQ+GD VL N+   G + F+G T  AKG + GI L    G+ DG++ G  YFECK  HG+F +  ++TK+ Q TE   S  EN    E+ D+++ S
Sbjct:    2 ELLKLFQVGDRVLVNNTKPGVIAFLGETKFAKGDWAGIILDDPTGKNDGSVAGEKYFECKPLHGVFTKLEKITKVNQVTESPGSPVENSSSLEIGDRVVVS 102          

HSP 2 Score: 63.5438 bits (153), Expect = 1.861e-10
Identity = 28/76 (36.84%), Postives = 45/76 (59.21%), Query Frame = 1
Query:  103 FQIGDSVLYNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQSTEVT 330
             +IGD V+ +    GT+R++G+T  AKG + G+EL    G+ DG + G  YF+C + +G+FA   ++ K    E T
Sbjct:   93 LEIGDRVVVSGNKIGTLRYVGTTEFAKGEWAGVELDEPLGKNDGAVAGTRYFQCIQGYGLFAPVHKVIKTGKKETT 168          
BLAST of Centrosome-associated protein 350 vs. Ensembl Nematostella
Match: EDO43343 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ45])

HSP 1 Score: 72.0182 bits (175), Expect = 6.553e-13
Identity = 31/74 (41.89%), Postives = 47/74 (63.51%), Query Frame = 1
Query:   88 QMINEFQIGDSVLYNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTK 309
            ++  +FQIG+ VL   +  G V+FIG T  A G + GIEL    G+ DG++ G+ YF CK + G+FA  +++TK
Sbjct:  354 EIARDFQIGEHVLVAGQKPGIVQFIGQTQFASGWWLGIELSNPVGKNDGSVGGVRYFTCKPRFGVFAPVAKVTK 427          

HSP 2 Score: 71.633 bits (174), Expect = 7.680e-13
Identity = 32/79 (40.51%), Postives = 47/79 (59.49%), Query Frame = 1
Query:   88 QMINEFQIGDSVLYNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQSTE 324
            Q  NE  IG+ V       G +RF G T  A G + G+EL    G+ DG++DG+ YF+C+  HGIFA  S++T+  +T+
Sbjct:  223 QDANELTIGERVYIGGTKSGVLRFCGRTEFASGEWVGVELDQPVGKNDGSVDGVQYFQCEPNHGIFAPASKVTRNGTTQ 301          
BLAST of Centrosome-associated protein 350 vs. Ensembl Nematostella
Match: EDO30218 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1F2])

HSP 1 Score: 55.4546 bits (132), Expect = 7.938e-10
Identity = 22/49 (44.90%), Postives = 32/49 (65.31%), Query Frame = 1
Query:  145 GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFAR 291
            G +RFIG+T  + G + G+EL  A G+ DG++ G+ YF CK + G F R
Sbjct:    3 GVIRFIGATEFSPGPWVGVELDKAGGKNDGSVSGVRYFACKPRFGSFVR 51          
BLAST of Centrosome-associated protein 350 vs. Ensembl Nematostella
Match: EDO44433 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVR2])

HSP 1 Score: 62.7734 bits (151), Expect = 1.107e-9
Identity = 38/114 (33.33%), Postives = 62/114 (54.39%), Query Frame = 1
Query:  109 IGDSVL--YNSKLE-GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQSTEVTSSENEVHDKLLNSCGETRDLTAQTSDKIASHIKTNNI 441
            +GD V+   N +L  G +RF G+T  + G + GI L  A G+ DG++ G+ YF+CK+ HGIF    ++  ++   V  + +E    LLN       L  + + +IA+H   NN+
Sbjct:  202 LGDRVVCVLNKRLRTGVLRFTGTTHFSPGEWCGIVLDDACGKNDGSVKGVRYFDCKQDHGIFVHAHKVRALEEVAVKLTISEA--GLLN-------LQQKGNKRIANHHNNNNM 306          
BLAST of Centrosome-associated protein 350 vs. Ensembl Nematostella
Match: EDO49101 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGS4])

HSP 1 Score: 61.6178 bits (148), Expect = 2.367e-9
Identity = 25/65 (38.46%), Postives = 39/65 (60.00%), Query Frame = 1
Query:  145 GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQSTEVTSSE 339
            GTV ++G+T  A G + G+ L    G+ DGT+ G  YF C++ +GIF R+SQ+  + S   T  +
Sbjct:    6 GTVAYVGATQFATGKWIGVVLDEKKGKNDGTVQGKEYFSCEDGYGIFVRQSQIIVLDSNTSTPQQ 70          
BLAST of Centrosome-associated protein 350 vs. Ensembl Medaka
Match: dctn1b (dynactin subunit 1 [Source:NCBI gene;Acc:101166919])

HSP 1 Score: 112.849 bits (281), Expect = 1.250e-24
Identity = 169/792 (21.34%), Postives = 336/792 (42.42%), Query Frame = 1
Query: 1246 ELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSML------KNSDGTSDAKIFIDQTSTIN-KYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELL----KTTNQMNERICXXXXXXXXXXXXXXXXXXXVKKAKAKDRELSS----------------LTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQQRDNSEKTPENICIQYKLEFLLLIWCGL---LKQLQINIHHSSPEALCQ--------LRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLENNVGEQTLKLMDNLNKISTNVQSTMKNTQMYLRHNQRITFDSSVSKSIDGIIFSLMDIVLS----ISDFALQLTDERIFSDEAMCRLTEIFANNRNPLNPTSDNEILFSLNSID---------------------KQVENIV--------SNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTAVESREIIINQLNQRIYELEA 3387
            ELQR+L +AK   +   +  + Y + M    + IEM T+DKEMAEE+ E +  +  +LK+  E++  +  +L      K SDG + +   + Q    N + K AL+ +       K+E+  L       N ELD L+        + E+L+ ++   E+ + E+K+ VD+    E +++ LT +N                           +E K +++RE   + + +N + +E+Q    + ++E  E+L        +  +R+      + + +  I K  E+    +  +REL+S                  F  +  E     + IE +L+ +E++  S QV LL  ++P SF   GG+HD I  + ++ +LI K  L+ +   +K  L      SE   E + ++  +   L    GL   L  LQ  +H    +AL Q        + S + ++   E+++D LIDL+ +  LD +     + ++I ++Q+ Y+     Q  DC +++ + I        C+  ++  +   L  + G++  +L   L  + T+     +             F   + + + G     +   LS    +SD    L+D R      +  L E+ A     ++P  + E L ++   D                     +Q  NIV        +  + G YD++K        ++  A   R ++   + L  +++ ++ ++  + + LK K  +LSE  ++++  ++KL ++ +  +  + ++  R+ E +A
Sbjct:  247 ELQRQLKEAKREAKEALEAKERYTEEMSDTADAIEMATLDKEMAEERAESLQLEVDSLKERVEELTMDLEILKHEIEEKGSDGAASS-FHVKQLEEQNGRLKEALVRMRDLSASEKQEHVKLQKQMEKKNMELDSLR-------GQKEKLQEEMSAAERTIDELKEQVDAALGAEEMVETLTERNLD-------------------------LEEKVRELRETVTDLEAINEMNDELQENARETELELREMLDLGAARVREAEKRVEAAQETVADYQQTINKYRELTAHLQELNRELTSQQEASAELQQQPPADMFDFKIKFAETKAYAKAIEMELRKMEVAQASRQVSLLTSFMPESFLRHGGDHDCILVLLLIPRLICKAELISKQAEEKFEL------SEGCVERVGLRGSVGEQLSFAAGLVYSLSLLQATLHKYE-QALSQCSVNVYKKVGSLYPEMSVHERSLDFLIDLLHRDQLDETVRVEPLTKAIKYYQHLYSIHLADQTEDCTMQLADHIRFTQSALNCMAVEVGRLRAFL--HAGQEKAELAVLLKDLETSCSDIRQ-------------FCKKIRRRMPGTDAPGIPAALSFGPQVSD---ALSDSRKHLTWVVAVLQEVAAAGAQMMSPLGEQEGLSAVKLEDVAFQATEQVYGSQGANTYECLRQSCNIVIATMNKMATAMQEGEYDSEKPQMKNPPPVELQAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEASVRLSLLEKKLDSSSKDADERVEKIQTRLDETQA 980          

HSP 2 Score: 67.3958 bits (163), Expect = 1.038e-10
Identity = 30/66 (45.45%), Postives = 41/66 (62.12%), Query Frame = 1
Query:  145 GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQSTEVTSSEN 342
            GTV +IG+T  A G + GI L    G+ DGT+ G  YF C+E HGIF R+SQ+  +  T  T+S +
Sbjct:   51 GTVAYIGTTLFASGKWVGIILDEPKGKNDGTVQGKRYFTCEENHGIFVRQSQIQLVDDTADTTSPD 116          
BLAST of Centrosome-associated protein 350 vs. Ensembl Medaka
Match: dctn1b (dynactin subunit 1 [Source:NCBI gene;Acc:101166919])

HSP 1 Score: 112.849 bits (281), Expect = 1.340e-24
Identity = 169/792 (21.34%), Postives = 336/792 (42.42%), Query Frame = 1
Query: 1246 ELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSML------KNSDGTSDAKIFIDQTSTIN-KYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELL----KTTNQMNERICXXXXXXXXXXXXXXXXXXXVKKAKAKDRELSS----------------LTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQQRDNSEKTPENICIQYKLEFLLLIWCGL---LKQLQINIHHSSPEALCQ--------LRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLENNVGEQTLKLMDNLNKISTNVQSTMKNTQMYLRHNQRITFDSSVSKSIDGIIFSLMDIVLS----ISDFALQLTDERIFSDEAMCRLTEIFANNRNPLNPTSDNEILFSLNSID---------------------KQVENIV--------SNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTAVESREIIINQLNQRIYELEA 3387
            ELQR+L +AK   +   +  + Y + M    + IEM T+DKEMAEE+ E +  +  +LK+  E++  +  +L      K SDG + +   + Q    N + K AL+ +       K+E+  L       N ELD L+        + E+L+ ++   E+ + E+K+ VD+    E +++ LT +N                           +E K +++RE   + + +N + +E+Q    + ++E  E+L        +  +R+      + + +  I K  E+    +  +REL+S                  F  +  E     + IE +L+ +E++  S QV LL  ++P SF   GG+HD I  + ++ +LI K  L+ +   +K  L      SE   E + ++  +   L    GL   L  LQ  +H    +AL Q        + S + ++   E+++D LIDL+ +  LD +     + ++I ++Q+ Y+     Q  DC +++ + I        C+  ++  +   L  + G++  +L   L  + T+     +             F   + + + G     +   LS    +SD    L+D R      +  L E+ A     ++P  + E L ++   D                     +Q  NIV        +  + G YD++K        ++  A   R ++   + L  +++ ++ ++  + + LK K  +LSE  ++++  ++KL ++ +  +  + ++  R+ E +A
Sbjct:  266 ELQRQLKEAKREAKEALEAKERYTEEMSDTADAIEMATLDKEMAEERAESLQLEVDSLKERVEELTMDLEILKHEIEEKGSDGAASS-FHVKQLEEQNGRLKEALVRMRDLSASEKQEHVKLQKQMEKKNMELDSLR-------GQKEKLQEEMSAAERTIDELKEQVDAALGAEEMVETLTERNLD-------------------------LEEKVRELRETVTDLEAINEMNDELQENARETELELREMLDLGAARVREAEKRVEAAQETVADYQQTINKYRELTAHLQELNRELTSQQEASAELQQQPPADMFDFKIKFAETKAYAKAIEMELRKMEVAQASRQVSLLTSFMPESFLRHGGDHDCILVLLLIPRLICKAELISKQAEEKFEL------SEGCVERVGLRGSVGEQLSFAAGLVYSLSLLQATLHKYE-QALSQCSVNVYKKVGSLYPEMSVHERSLDFLIDLLHRDQLDETVRVEPLTKAIKYYQHLYSIHLADQTEDCTMQLADHIRFTQSALNCMAVEVGRLRAFL--HAGQEKAELAVLLKDLETSCSDIRQ-------------FCKKIRRRMPGTDAPGIPAALSFGPQVSDA---LSDSRKHLTWVVAVLQEVAAAGAQMMSPLGEQEGLSAVKLEDVAFQATEQVYGSQGANTYECLRQSCNIVIATMNKMATAMQEGEYDSEKPQMKNPPPVELQAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEASVRLSLLEKKLDSSSKDADERVEKIQTRLDETQA 999          

HSP 2 Score: 67.781 bits (164), Expect = 9.396e-11
Identity = 30/66 (45.45%), Postives = 41/66 (62.12%), Query Frame = 1
Query:  145 GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQSTEVTSSEN 342
            GTV +IG+T  A G + GI L    G+ DGT+ G  YF C+E HGIF R+SQ+  +  T  T+S +
Sbjct:   44 GTVAYIGTTLFASGKWVGIILDEPKGKNDGTVQGKRYFTCEENHGIFVRQSQIQLVDDTADTTSPD 109          
BLAST of Centrosome-associated protein 350 vs. Ensembl Medaka
Match: dctn1b (dynactin subunit 1 [Source:NCBI gene;Acc:101166919])

HSP 1 Score: 112.849 bits (281), Expect = 1.405e-24
Identity = 169/792 (21.34%), Postives = 336/792 (42.42%), Query Frame = 1
Query: 1246 ELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSML------KNSDGTSDAKIFIDQTSTIN-KYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELL----KTTNQMNERICXXXXXXXXXXXXXXXXXXXVKKAKAKDRELSS----------------LTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQQRDNSEKTPENICIQYKLEFLLLIWCGL---LKQLQINIHHSSPEALCQ--------LRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLENNVGEQTLKLMDNLNKISTNVQSTMKNTQMYLRHNQRITFDSSVSKSIDGIIFSLMDIVLS----ISDFALQLTDERIFSDEAMCRLTEIFANNRNPLNPTSDNEILFSLNSID---------------------KQVENIV--------SNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTAVESREIIINQLNQRIYELEA 3387
            ELQR+L +AK   +   +  + Y + M    + IEM T+DKEMAEE+ E +  +  +LK+  E++  +  +L      K SDG + +   + Q    N + K AL+ +       K+E+  L       N ELD L+        + E+L+ ++   E+ + E+K+ VD+    E +++ LT +N                           +E K +++RE   + + +N + +E+Q    + ++E  E+L        +  +R+      + + +  I K  E+    +  +REL+S                  F  +  E     + IE +L+ +E++  S QV LL  ++P SF   GG+HD I  + ++ +LI K  L+ +   +K  L      SE   E + ++  +   L    GL   L  LQ  +H    +AL Q        + S + ++   E+++D LIDL+ +  LD +     + ++I ++Q+ Y+     Q  DC +++ + I        C+  ++  +   L  + G++  +L   L  + T+     +             F   + + + G     +   LS    +SD    L+D R      +  L E+ A     ++P  + E L ++   D                     +Q  NIV        +  + G YD++K        ++  A   R ++   + L  +++ ++ ++  + + LK K  +LSE  ++++  ++KL ++ +  +  + ++  R+ E +A
Sbjct:  259 ELQRQLKEAKREAKEALEAKERYTEEMSDTADAIEMATLDKEMAEERAESLQLEVDSLKERVEELTMDLEILKHEIEEKGSDGAASS-FHVKQLEEQNGRLKEALVRMRDLSASEKQEHVKLQKQMEKKNMELDSLR-------GQKEKLQEEMSAAERTIDELKEQVDAALGAEEMVETLTERNLD-------------------------LEEKVRELRETVTDLEAINEMNDELQENARETELELREMLDLGAARVREAEKRVEAAQETVADYQQTINKYRELTAHLQELNRELTSQQEASAELQQQPPADMFDFKIKFAETKAYAKAIEMELRKMEVAQASRQVSLLTSFMPESFLRHGGDHDCILVLLLIPRLICKAELISKQAEEKFEL------SEGCVERVGLRGSVGEQLSFAAGLVYSLSLLQATLHKYE-QALSQCSVNVYKKVGSLYPEMSVHERSLDFLIDLLHRDQLDETVRVEPLTKAIKYYQHLYSIHLADQTEDCTMQLADHIRFTQSALNCMAVEVGRLRAFL--HAGQEKAELAVLLKDLETSCSDIRQ-------------FCKKIRRRMPGTDAPGIPAALSFGPQVSDA---LSDSRKHLTWVVAVLQEVAAAGAQMMSPLGEQEGLSAVKLEDVAFQATEQVYGSQGANTYECLRQSCNIVIATMNKMATAMQEGEYDSEKPQMKNPPPVELQAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEASVRLSLLEKKLDSSSKDADERVEKIQTRLDETQA 992          

HSP 2 Score: 67.781 bits (164), Expect = 8.694e-11
Identity = 30/66 (45.45%), Postives = 41/66 (62.12%), Query Frame = 1
Query:  145 GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQSTEVTSSEN 342
            GTV +IG+T  A G + GI L    G+ DGT+ G  YF C+E HGIF R+SQ+  +  T  T+S +
Sbjct:   44 GTVAYIGTTLFASGKWVGIILDEPKGKNDGTVQGKRYFTCEENHGIFVRQSQIQLVDDTADTTSPD 109          
BLAST of Centrosome-associated protein 350 vs. Ensembl Medaka
Match: dctn1b (dynactin subunit 1 [Source:NCBI gene;Acc:101166919])

HSP 1 Score: 112.849 bits (281), Expect = 1.492e-24
Identity = 169/792 (21.34%), Postives = 336/792 (42.42%), Query Frame = 1
Query: 1246 ELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSML------KNSDGTSDAKIFIDQTSTIN-KYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELL----KTTNQMNERICXXXXXXXXXXXXXXXXXXXVKKAKAKDRELSS----------------LTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQQRDNSEKTPENICIQYKLEFLLLIWCGL---LKQLQINIHHSSPEALCQ--------LRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLENNVGEQTLKLMDNLNKISTNVQSTMKNTQMYLRHNQRITFDSSVSKSIDGIIFSLMDIVLS----ISDFALQLTDERIFSDEAMCRLTEIFANNRNPLNPTSDNEILFSLNSID---------------------KQVENIV--------SNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTAVESREIIINQLNQRIYELEA 3387
            ELQR+L +AK   +   +  + Y + M    + IEM T+DKEMAEE+ E +  +  +LK+  E++  +  +L      K SDG + +   + Q    N + K AL+ +       K+E+  L       N ELD L+        + E+L+ ++   E+ + E+K+ VD+    E +++ LT +N                           +E K +++RE   + + +N + +E+Q    + ++E  E+L        +  +R+      + + +  I K  E+    +  +REL+S                  F  +  E     + IE +L+ +E++  S QV LL  ++P SF   GG+HD I  + ++ +LI K  L+ +   +K  L      SE   E + ++  +   L    GL   L  LQ  +H    +AL Q        + S + ++   E+++D LIDL+ +  LD +     + ++I ++Q+ Y+     Q  DC +++ + I        C+  ++  +   L  + G++  +L   L  + T+     +             F   + + + G     +   LS    +SD    L+D R      +  L E+ A     ++P  + E L ++   D                     +Q  NIV        +  + G YD++K        ++  A   R ++   + L  +++ ++ ++  + + LK K  +LSE  ++++  ++KL ++ +  +  + ++  R+ E +A
Sbjct:  260 ELQRQLKEAKREAKEALEAKERYTEEMSDTADAIEMATLDKEMAEERAESLQLEVDSLKERVEELTMDLEILKHEIEEKGSDGAASS-FHVKQLEEQNGRLKEALVRMRDLSASEKQEHVKLQKQMEKKNMELDSLR-------GQKEKLQEEMSAAERTIDELKEQVDAALGAEEMVETLTERNLD-------------------------LEEKVRELRETVTDLEAINEMNDELQENARETELELREMLDLGAARVREAEKRVEAAQETVADYQQTINKYRELTAHLQELNRELTSQQEASAELQQQPPADMFDFKIKFAETKAYAKAIEMELRKMEVAQASRQVSLLTSFMPESFLRHGGDHDCILVLLLIPRLICKAELISKQAEEKFEL------SEGCVERVGLRGSVGEQLSFAAGLVYSLSLLQATLHKYE-QALSQCSVNVYKKVGSLYPEMSVHERSLDFLIDLLHRDQLDETVRVEPLTKAIKYYQHLYSIHLADQTEDCTMQLADHIRFTQSALNCMAVEVGRLRAFL--HAGQEKAELAVLLKDLETSCSDIRQ-------------FCKKIRRRMPGTDAPGIPAALSFGPQVSDA---LSDSRKHLTWVVAVLQEVAAAGAQMMSPLGEQEGLSAVKLEDVAFQATEQVYGSQGANTYECLRQSCNIVIATMNKMATAMQEGEYDSEKPQMKNPPPVELQAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEASVRLSLLEKKLDSSSKDADERVEKIQTRLDETQA 993          

HSP 2 Score: 67.781 bits (164), Expect = 9.071e-11
Identity = 30/66 (45.45%), Postives = 41/66 (62.12%), Query Frame = 1
Query:  145 GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQSTEVTSSEN 342
            GTV +IG+T  A G + GI L    G+ DGT+ G  YF C+E HGIF R+SQ+  +  T  T+S +
Sbjct:   44 GTVAYIGTTLFASGKWVGIILDEPKGKNDGTVQGKRYFTCEENHGIFVRQSQIQLVDDTADTTSPD 109          
BLAST of Centrosome-associated protein 350 vs. Ensembl Medaka
Match: dctn1b (dynactin subunit 1 [Source:NCBI gene;Acc:101166919])

HSP 1 Score: 112.849 bits (281), Expect = 1.517e-24
Identity = 169/792 (21.34%), Postives = 336/792 (42.42%), Query Frame = 1
Query: 1246 ELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSML------KNSDGTSDAKIFIDQTSTIN-KYKNALLELSQSINCYKEENRNL-------NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELL----KTTNQMNERICXXXXXXXXXXXXXXXXXXXVKKAKAKDRELSS----------------LTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQQRDNSEKTPENICIQYKLEFLLLIWCGL---LKQLQINIHHSSPEALCQ--------LRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLENNVGEQTLKLMDNLNKISTNVQSTMKNTQMYLRHNQRITFDSSVSKSIDGIIFSLMDIVLS----ISDFALQLTDERIFSDEAMCRLTEIFANNRNPLNPTSDNEILFSLNSID---------------------KQVENIV--------SNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTAVESREIIINQLNQRIYELEA 3387
            ELQR+L +AK   +   +  + Y + M    + IEM T+DKEMAEE+ E +  +  +LK+  E++  +  +L      K SDG + +   + Q    N + K AL+ +       K+E+  L       N ELD L+        + E+L+ ++   E+ + E+K+ VD+    E +++ LT +N                           +E K +++RE   + + +N + +E+Q    + ++E  E+L        +  +R+      + + +  I K  E+    +  +REL+S                  F  +  E     + IE +L+ +E++  S QV LL  ++P SF   GG+HD I  + ++ +LI K  L+ +   +K  L      SE   E + ++  +   L    GL   L  LQ  +H    +AL Q        + S + ++   E+++D LIDL+ +  LD +     + ++I ++Q+ Y+     Q  DC +++ + I        C+  ++  +   L  + G++  +L   L  + T+     +             F   + + + G     +   LS    +SD    L+D R      +  L E+ A     ++P  + E L ++   D                     +Q  NIV        +  + G YD++K        ++  A   R ++   + L  +++ ++ ++  + + LK K  +LSE  ++++  ++KL ++ +  +  + ++  R+ E +A
Sbjct:  259 ELQRQLKEAKREAKEALEAKERYTEEMSDTADAIEMATLDKEMAEERAESLQLEVDSLKERVEELTMDLEILKHEIEEKGSDGAASS-FHVKQLEEQNGRLKEALVRMRDLSASEKQEHVKLQKQMEKKNMELDSLR-------GQKEKLQEEMSAAERTIDELKEQVDAALGAEEMVETLTERNLD-------------------------LEEKVRELRETVTDLEAINEMNDELQENARETELELREMLDLGAARVREAEKRVEAAQETVADYQQTINKYRELTAHLQELNRELTSQQEASAELQQQPPADMFDFKIKFAETKAYAKAIEMELRKMEVAQASRQVSLLTSFMPESFLRHGGDHDCILVLLLIPRLICKAELISKQAEEKFEL------SEGCVERVGLRGSVGEQLSFAAGLVYSLSLLQATLHKYE-QALSQCSVNVYKKVGSLYPEMSVHERSLDFLIDLLHRDQLDETVRVEPLTKAIKYYQHLYSIHLADQTEDCTMQLADHIRFTQSALNCMAVEVGRLRAFL--HAGQEKAELAVLLKDLETSCSDIRQ-------------FCKKIRRRMPGTDAPGIPAALSFGPQVSDA---LSDSRKHLTWVVAVLQEVAAAGAQMMSPLGEQEGLSAVKLEDVAFQATEQVYGSQGANTYECLRQSCNIVIATMNKMATAMQEGEYDSEKPQMKNPPPVELQAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEASVRLSLLEKKLDSSSKDADERVEKIQTRLDETQA 992          

HSP 2 Score: 67.781 bits (164), Expect = 8.548e-11
Identity = 30/66 (45.45%), Postives = 41/66 (62.12%), Query Frame = 1
Query:  145 GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQSTEVTSSEN 342
            GTV +IG+T  A G + GI L    G+ DGT+ G  YF C+E HGIF R+SQ+  +  T  T+S +
Sbjct:   44 GTVAYIGTTLFASGKWVGIILDEPKGKNDGTVQGKRYFTCEENHGIFVRQSQIQLVDDTADTTSPD 109          
BLAST of Centrosome-associated protein 350 vs. Planmine SMEST
Match: SMESG000069358.1 (SMESG000069358.1)

HSP 1 Score: 2358.95 bits (6112), Expect = 0.000e+0
Identity = 1244/1255 (99.12%), Postives = 1247/1255 (99.36%), Query Frame = 1
Query:   91 MINEFQIGDSVLYNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQSTEVTSSENEVHDKLLNSCGETRDLTAQTSDKIASHIKTNNIVTSVPSIINSTYRENLETTFDSKFAKDFRRNTISSTLKTIENHVQSSFDITTQESATKEISKQESNLVHKKEIIIEDLTPMKKHESASQIDNHSKLKFHRNSVDLKLKSHENLKQNQLELEIPKNYRRNTVGNNEIETKFRHNFGIKEPVHQHLSTIFEKNPNDKQLNNSNVPNKLMATQETANQIENGKQQTKITSFKYARRNTLASKSVVCESRQGKENQLIHPRNTVSXXXXXXXXXXXXXXXXTLQILKKKEYKRCGDLEKLNNELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSMLKNSDGTSDAKIFIDQTSTINKYKNALLELSQSINCYKEENRNLNSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNXXXXXXXXXXXXXXXXXXXXXXXXXXVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICXXXXXXXXXXXXXXXXXXXVKKAKAKDRELSSLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQQRDNSEKTPENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLENNVGEQTLKLMDNLNKISTNVQSTMKNTQMYLRHNQRITFDSSVSKSIDGIIFSLMDIVLSISDFALQLTDERIFSDEAMCRLTEIFANNRNPLNPTSDNEILFSLNSIDKQVENIVSNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTAVESREIIINQLNQRIYELEANAAKRNETEKLSEFESETLKISCEPISHLSVSNEENFKSCSIDINDYQNEIRNLTIIVKYLMRKLHKSNAIKSDKRLQELKPIKTQTFISDKELNLLMQRAVTINRDIYESLSNVKIPDLSSRKDIKQFSEKSIIFSKLKNQSEKLIIDGMKKCNQ 3855
            MINEFQIGDSVLYNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQSTEVTSSE+EVHDKLLNSCGE RDLTAQTSDKIASHIKTN+IVTSVPSIINSTYRENLETTFDSKFAKDFRRNTISSTLKTIENHVQSSFDITTQESATKEISKQESNLVHKKEIIIEDLTPMKKHESASQIDN+SKLKFHRNSVDLKLKSHENLK NQLELEIPKNYRRNTVGNNEIETKFRHNFGIKEPVHQHLSTIFEKNPNDKQLNNSNVPNKLMATQETANQIENGKQQTKITSFKYARRNTLASKSVVCESRQGKENQLIHPRNTVSNLDKDKEIKDLKEKNETLQILKKKEYKRCGDLEKLNNELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSMLKNSDGTSDAKIFIDQTSTINKYKNALLELSQSINCYKEENRNLNSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNEYLEKELKKLKKRLIELDKLEDDRLEVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICLLTNELKEKELEIQKQNEIVKKAKAKDRELSSLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQQRDNSEKTPENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSI FFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLENNVGEQTLKLMDNLNKISTNVQSTMKNTQMYLRHNQRITFDSSVSKSIDGIIF LMDIVLSISDFALQLTDERIFSDEAMCRLTEIFANNRNPLNPTSDNEILFSLNSIDKQVENIVSNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTAVESREIIINQLNQRIYELEANAAKRNETEKLSEFESE LKISCEPISH SVSNEENFKSCSIDINDYQNEIRNLTIIVKYLM KLHKSNAIKSD RLQELKPIKTQTFISDKELNLLMQRAVTINRDIYESLSNVKIPDLSSRKDIKQFSEKSIIFSKLKNQSEKLIIDGMKKCNQ
Sbjct:    1 MINEFQIGDSVLYNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQSTEVTSSESEVHDKLLNSCGENRDLTAQTSDKIASHIKTNDIVTSVPSIINSTYRENLETTFDSKFAKDFRRNTISSTLKTIENHVQSSFDITTQESATKEISKQESNLVHKKEIIIEDLTPMKKHESASQIDNNSKLKFHRNSVDLKLKSHENLKPNQLELEIPKNYRRNTVGNNEIETKFRHNFGIKEPVHQHLSTIFEKNPNDKQLNNSNVPNKLMATQETANQIENGKQQTKITSFKYARRNTLASKSVVCESRQGKENQLIHPRNTVSNLDKDKEIKDLKEKNETLQILKKKEYKRCGDLEKLNNELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSMLKNSDGTSDAKIFIDQTSTINKYKNALLELSQSINCYKEENRNLNSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILDKLTFKNEYLEKELKKLKKRLIELDKLEDDRLEVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICLLTNELKEKELEIQKQNEIVKKAKAKDRELSSLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQQRDNSEKTPENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIEFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSWIDQMLENNVGEQTLKLMDNLNKISTNVQSTMKNTQMYLRHNQRITFDSSVSKSIDGIIFLLMDIVLSISDFALQLTDERIFSDEAMCRLTEIFANNRNPLNPTSDNEILFSLNSIDKQVENIVSNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTAVESREIIINQLNQRIYELEANAAKRNETEKLSEFESEPLKISCEPISHSSVSNEENFKSCSIDINDYQNEIRNLTIIVKYLMSKLHKSNAIKSDNRLQELKPIKTQTFISDKELNLLMQRAVTINRDIYESLSNVKIPDLSSRKDIKQFSEKSIIFSKLKNQSEKLIIDGMKKCNQ 1255          

HSP 2 Score: 108.997 bits (271), Expect = 1.595e-23
Identity = 50/50 (100.00%), Postives = 50/50 (100.00%), Query Frame = 3
Query: 3855 KLVYFDSPNSACTNNSIGLIRFDRNSVNDQSMKSVSIDNWSLKKLEELFC 4004
            KLVYFDSPNSACTNNSIGLIRFDRNSVNDQSMKSVSIDNWSLKKLEELFC
Sbjct: 1256 KLVYFDSPNSACTNNSIGLIRFDRNSVNDQSMKSVSIDNWSLKKLEELFC 1305          
BLAST of Centrosome-associated protein 350 vs. Planmine SMEST
Match: SMESG000029463.1 (SMESG000029463.1)

HSP 1 Score: 154.066 bits (388), Expect = 2.130e-37
Identity = 158/615 (25.69%), Postives = 292/615 (47.48%), Query Frame = 1
Query: 2137 IENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQQRDNSEKTPENI----CIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSW-IDQMLENNV-GEQTLKLMDNLNKISTNVQSTMKNTQMYLRHNQRITFDSSVSKSIDGIIFSLMDIVLSISDFALQLT------DERIFSDEAMCRLTEIFANNRNPLNPTSDNEILFSLNSIDKQVENIVSNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTAVESREIIINQLNQRIYELEANAAKRNETEKLSEFESETLKISCEPISHLSVSNEE-----------NF----------------KSCSIDINDYQNEIRNLTIIVKYLMRKLHKSNAIKSDKRLQELKPI------------KTQTFISDKEL-NLLMQRAVTINRDIYESLSNVKIPDLSSRKDIKQFSEKSIIFSKLKNQSEKL 3825
            IEN+L+ +++S  S  VQ+L ++LP  F   G ++D I  + ++DKLI KI  +   I ++  L           +NI       +KL +LL  W  +L+  +  +         +L S F ++   E+++D LIDL++K  LD + +   + +SI +FQ FY      +  DC +KM +F+ I+  GS+ +     + I+ M+++N+   ++ + +  L +   +++S  +N + +L  +  + F+S +S ++D  +  L  I   I+ + L+L       D +  +  ++ +  E F   R   N +S   I  +  +I K   NI  + + G YD +         I   ATN++ +L  L+   ++++ KDE L      LK K  +LSE  +++N  ++KL   ++ ++ II +L Q++ + +A   ++   EK  +  SE L+     I+HL +  EE           NF                   S +I+ + +EI+ L  I+  L  +  +  +  + K  Q+LKP+            +  + I   E  NL +  +  + RDIY  LS+VKI DLS R   K++  +    +++K Q EKL
Sbjct:  490 IENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCCKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKSPSLQFNSGLSTNLDKCVTDLSAITKIITSYCLELATVSDEDDAKSVNMSSLYKYIEKFMEIR---NLSSTLPIFTNTENILKISANISDSMEHGEYDYEGTAVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRK---EKELDQTSEALQ---SDINHLEMQREELKKQLKETKKRNFFDNINISTSKIADQVDSGSSQEISAFLSEIQTLRTIIHNLRNENIRLRSQITSKHAQKLKPLSIPISLNTPNANRNSSLIKKMEYANLTITSSENLTRDIYSHLSSVKIIDLSIRHPEKEYLNELSAKTRIKLQFEKL 1095          

HSP 2 Score: 96.2857 bits (238), Expect = 1.264e-19
Identity = 39/84 (46.43%), Postives = 58/84 (69.05%), Query Frame = 1
Query:   94 INEFQIGDSVLYNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQSTEVTSSENE 345
            +++F+I D VLYN  L+GTV FIG+T  A G +YG++L +  G+ DG++ G SYF+C + HGIF R +QL K+   E T++  E
Sbjct:    1 MSDFKINDIVLYNGTLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDESTNTSAE 84          
BLAST of Centrosome-associated protein 350 vs. Planmine SMEST
Match: SMESG000029463.1 (SMESG000029463.1)

HSP 1 Score: 154.066 bits (388), Expect = 2.182e-37
Identity = 158/615 (25.69%), Postives = 292/615 (47.48%), Query Frame = 1
Query: 2137 IENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQQRDNSEKTPENI----CIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSW-IDQMLENNV-GEQTLKLMDNLNKISTNVQSTMKNTQMYLRHNQRITFDSSVSKSIDGIIFSLMDIVLSISDFALQLT------DERIFSDEAMCRLTEIFANNRNPLNPTSDNEILFSLNSIDKQVENIVSNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTAVESREIIINQLNQRIYELEANAAKRNETEKLSEFESETLKISCEPISHLSVSNEE-----------NF----------------KSCSIDINDYQNEIRNLTIIVKYLMRKLHKSNAIKSDKRLQELKPI------------KTQTFISDKEL-NLLMQRAVTINRDIYESLSNVKIPDLSSRKDIKQFSEKSIIFSKLKNQSEKL 3825
            IEN+L+ +++S  S  VQ+L ++LP  F   G ++D I  + ++DKLI KI  +   I ++  L           +NI       +KL +LL  W  +L+  +  +         +L S F ++   E+++D LIDL++K  LD + +   + +SI +FQ FY      +  DC +KM +F+ I+  GS+ +     + I+ M+++N+   ++ + +  L +   +++S  +N + +L  +  + F+S +S ++D  +  L  I   I+ + L+L       D +  +  ++ +  E F   R   N +S   I  +  +I K   NI  + + G YD +         I   ATN++ +L  L+   ++++ KDE L      LK K  +LSE  +++N  ++KL   ++ ++ II +L Q++ + +A   ++   EK  +  SE L+     I+HL +  EE           NF                   S +I+ + +EI+ L  I+  L  +  +  +  + K  Q+LKP+            +  + I   E  NL +  +  + RDIY  LS+VKI DLS R   K++  +    +++K Q EKL
Sbjct:  503 IENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCCKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKSPSLQFNSGLSTNLDKCVTDLSAITKIITSYCLELATVSDEDDAKSVNMSSLYKYIEKFMEIR---NLSSTLPIFTNTENILKISANISDSMEHGEYDYEGTAVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRK---EKELDQTSEALQ---SDINHLEMQREELKKQLKETKKRNFFDNINISTSKIADQVDSGSSQEISAFLSEIQTLRTIIHNLRNENIRLRSQITSKHAQKLKPLSIPISLNTPNANRNSSLIKKMEYANLTITSSENLTRDIYSHLSSVKIIDLSIRHPEKEYLNELSAKTRIKLQFEKL 1108          

HSP 2 Score: 96.2857 bits (238), Expect = 1.294e-19
Identity = 39/84 (46.43%), Postives = 58/84 (69.05%), Query Frame = 1
Query:   94 INEFQIGDSVLYNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQSTEVTSSENE 345
            +++F+I D VLYN  L+GTV FIG+T  A G +YG++L +  G+ DG++ G SYF+C + HGIF R +QL K+   E T++  E
Sbjct:    1 MSDFKINDIVLYNGTLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDESTNTSAE 84          
BLAST of Centrosome-associated protein 350 vs. Planmine SMEST
Match: SMESG000015470.1 (SMESG000015470.1)

HSP 1 Score: 75.485 bits (184), Expect = 1.408e-13
Identity = 31/74 (41.89%), Postives = 47/74 (63.51%), Query Frame = 1
Query:   97 NEFQIGDSVLYNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQS 318
            +  QI D VL   + +G +RF+G T  + GT+YGIEL    G+ DG ++G+ YF+C    G+FA  S+L K++S
Sbjct:  238 SPLQICDRVLVAGQRKGVIRFVGPTKFSPGTWYGIELDKPVGKNDGAVNGVRYFQCGANRGVFAPLSRLHKLRS 311          

HSP 2 Score: 62.7734 bits (151), Expect = 1.079e-9
Identity = 24/70 (34.29%), Postives = 45/70 (64.29%), Query Frame = 1
Query:  109 IGDSVLYNSKLE--GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKI 312
            +GD VL    ++  G +R+ G    A G + G+EL    G+  GT++G+ YF+C+E++G+FA  ++++K+
Sbjct:  124 LGDRVLVRGDVDRSGILRYCGPVEFADGVWAGVELDEPQGKNSGTVNGVWYFQCEEQYGVFAPVTRVSKV 193          
BLAST of Centrosome-associated protein 350 vs. Planmine SMEST
Match: SMESG000015470.1 (SMESG000015470.1)

HSP 1 Score: 75.0998 bits (183), Expect = 2.047e-13
Identity = 31/74 (41.89%), Postives = 47/74 (63.51%), Query Frame = 1
Query:   97 NEFQIGDSVLYNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQS 318
            +  QI D VL   + +G +RF+G T  + GT+YGIEL    G+ DG ++G+ YF+C    G+FA  S+L K++S
Sbjct:  304 SPLQICDRVLVAGQRKGVIRFVGPTKFSPGTWYGIELDKPVGKNDGAVNGVRYFQCGANRGVFAPLSRLHKLRS 377          

HSP 2 Score: 62.7734 bits (151), Expect = 1.431e-9
Identity = 24/70 (34.29%), Postives = 45/70 (64.29%), Query Frame = 1
Query:  109 IGDSVLYNSKLE--GTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKI 312
            +GD VL    ++  G +R+ G    A G + G+EL    G+  GT++G+ YF+C+E++G+FA  ++++K+
Sbjct:  190 LGDRVLVRGDVDRSGILRYCGPVEFADGVWAGVELDEPQGKNSGTVNGVWYFQCEEQYGVFAPVTRVSKV 259          
The following BLAST results are available for this feature:
BLAST of Centrosome-associated protein 350 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DCTN16.441e-2121.00dynactin subunit 1 [Source:HGNC Symbol;Acc:HGNC:27... [more]
DCTN17.006e-2121.00dynactin subunit 1 [Source:HGNC Symbol;Acc:HGNC:27... [more]
DCTN17.086e-2121.00dynactin subunit 1 [Source:HGNC Symbol;Acc:HGNC:27... [more]
DCTN17.575e-2121.00dynactin subunit 1 [Source:HGNC Symbol;Acc:HGNC:27... [more]
DCTN18.225e-2120.46dynactin subunit 1 [Source:HGNC Symbol;Acc:HGNC:27... [more]
back to top
BLAST of Centrosome-associated protein 350 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnc-11.926e-1121.12DyNactin Complex component [Source:UniProtKB/TrEM... [more]
dnc-11.938e-1121.12DyNactin Complex component [Source:UniProtKB/TrEM... [more]
dnc-12.735e-1121.12DyNactin Complex component [Source:UniProtKB/TrEM... [more]
dnc-13.207e-1121.12DyNactin Complex component [Source:UniProtKB/TrEM... [more]
dnc-13.327e-1121.12DyNactin Complex component [Source:UniProtKB/TrEM... [more]
back to top
BLAST of Centrosome-associated protein 350 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Khc-733.408e-1244.12gene:FBgn0019968 transcript:FBtr0087357[more]
Khc-733.612e-1244.12gene:FBgn0019968 transcript:FBtr0346265[more]
Khc-733.641e-1244.12gene:FBgn0019968 transcript:FBtr0329956[more]
Khc-733.731e-1244.12gene:FBgn0019968 transcript:FBtr0329955[more]
Khc-733.914e-1244.12gene:FBgn0019968 transcript:FBtr0329957[more]
back to top
BLAST of Centrosome-associated protein 350 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dctn1a4.358e-2521.68dynactin 1a [Source:ZFIN;Acc:ZDB-GENE-070117-2205][more]
dctn1a4.621e-2521.68dynactin 1a [Source:ZFIN;Acc:ZDB-GENE-070117-2205][more]
dctn1a4.621e-2521.68dynactin 1a [Source:ZFIN;Acc:ZDB-GENE-070117-2205][more]
dctn1a1.428e-2020.59dynactin 1a [Source:ZFIN;Acc:ZDB-GENE-070117-2205][more]
dctn1b6.854e-2021.25dynactin 1b [Source:ZFIN;Acc:ZDB-GENE-050419-28][more]
back to top
BLAST of Centrosome-associated protein 350 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000000206.14.061e-2020.11dynactin subunit 1 [Source:NCBI gene;Acc:447948][more]
ENSXETT00000028179.14.879e-2020.11dynactin subunit 1 [Source:NCBI gene;Acc:447948][more]
ENSXETT00000011502.15.031e-2020.11dynactin subunit 1 [Source:NCBI gene;Acc:447948][more]
ENSXETT00000028089.15.076e-2020.11dynactin subunit 1 [Source:NCBI gene;Acc:447948][more]
ENSXETT00000011652.15.354e-2020.11dynactin subunit 1 [Source:NCBI gene;Acc:447948][more]
back to top
BLAST of Centrosome-associated protein 350 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dctn11.120e-2020.13dynactin 1 [Source:MGI Symbol;Acc:MGI:107745][more]
Dctn11.282e-2020.13dynactin 1 [Source:MGI Symbol;Acc:MGI:107745][more]
Dctn11.491e-2020.13dynactin 1 [Source:MGI Symbol;Acc:MGI:107745][more]
Dctn11.797e-2020.13dynactin 1 [Source:MGI Symbol;Acc:MGI:107745][more]
Dctn15.213e-2020.13dynactin 1 [Source:MGI Symbol;Acc:MGI:107745][more]
back to top
BLAST of Centrosome-associated protein 350 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q14203|DCTN1_HUMAN3.403e-2021.00Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN... [more]
sp|O08788|DCTN1_MOUSE1.257e-1920.13Dynactin subunit 1 OS=Mus musculus OX=10090 GN=Dct... [more]
sp|P28023|DCTN1_RAT1.824e-1921.55Dynactin subunit 1 OS=Rattus norvegicus OX=10116 G... [more]
sp|Q6PCJ1|DCTN1_XENLA7.047e-1719.76Dynactin subunit 1 OS=Xenopus laevis OX=8355 GN=dc... [more]
sp|P35458|DCTN1_CHICK1.149e-1622.39Dynactin subunit 1 OS=Gallus gallus OX=9031 GN=DCT... [more]
back to top
BLAST of Centrosome-associated protein 350 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B7AZ822.589e-2524.43Dynactin domain-containing protein (Fragment) OS=A... [more]
A0A0B7AYS53.023e-2524.43Dynactin domain-containing protein (Fragment) OS=A... [more]
A0A2C9LC921.635e-2324.49CAP-Gly domain-containing protein OS=Biomphalaria ... [more]
Q07DR33.637e-2221.68Dynactin 1a OS=Danio rerio OX=7955 GN=dctn1a PE=2 ... [more]
A0A286YA279.751e-2221.68Dynactin 1a OS=Danio rerio OX=7955 GN=dctn1a PE=1 ... [more]
back to top
BLAST of Centrosome-associated protein 350 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000043575.11.034e-2020.21dynactin subunit 1-like [Source:NCBI gene;Acc:1030... [more]
ENSAMXT00000057148.14.372e-2020.19dynactin subunit 1-like [Source:NCBI gene;Acc:1030... [more]
ENSAMXT00000040825.15.047e-2020.19dynactin subunit 1-like [Source:NCBI gene;Acc:1030... [more]
dctn1b2.302e-1921.28dynactin subunit 1 [Source:NCBI gene;Acc:103040401... [more]
dctn1b3.421e-1921.28dynactin subunit 1 [Source:NCBI gene;Acc:103040401... [more]
back to top
BLAST of Centrosome-associated protein 350 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkeyp-47f9.42.394e-1340.85si:dkeyp-47f9.4 [Source:ZFIN;Acc:ZDB-GENE-131126-9... [more]
ENSPMAT00000006027.13.298e-1342.25pep scaffold:Pmarinus_7.0:GL478150:21952:49796:1 g... [more]
ENSPMAT00000006020.15.451e-1342.25pep scaffold:Pmarinus_7.0:GL478150:21952:49796:1 g... [more]
ENSPMAT00000004647.12.115e-1139.44pep scaffold:Pmarinus_7.0:GL484285:5077:12891:1 ge... [more]
dctn1a5.233e-1141.79dynactin 1a [Source:ZFIN;Acc:ZDB-GENE-070117-2205][more]
back to top
BLAST of Centrosome-associated protein 350 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
NIP1001.386e-936.47Large subunit of the dynactin complex; dynactin is... [more]
back to top
BLAST of Centrosome-associated protein 350 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO336003.618e-1439.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433436.553e-1341.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302187.938e-1044.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO444331.107e-933.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491012.367e-938.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Centrosome-associated protein 350 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dctn1b1.250e-2421.34dynactin subunit 1 [Source:NCBI gene;Acc:101166919... [more]
dctn1b1.340e-2421.34dynactin subunit 1 [Source:NCBI gene;Acc:101166919... [more]
dctn1b1.405e-2421.34dynactin subunit 1 [Source:NCBI gene;Acc:101166919... [more]
dctn1b1.492e-2421.34dynactin subunit 1 [Source:NCBI gene;Acc:101166919... [more]
dctn1b1.517e-2421.34dynactin subunit 1 [Source:NCBI gene;Acc:101166919... [more]
back to top
BLAST of Centrosome-associated protein 350 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069358.11.595e-2399.12SMESG000069358.1[more]
SMESG000029463.12.130e-3725.69SMESG000029463.1[more]
SMESG000029463.12.182e-3725.69SMESG000029463.1[more]
SMESG000015470.11.408e-1341.89SMESG000015470.1[more]
SMESG000015470.12.047e-1341.89SMESG000015470.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014136 ID=SMED30014136|Name=Centrosome-associated protein 350|organism=Schmidtea mediterranea sexual|type=transcript|length=4055bp
AAATAATTAGTATTATAGATTAAAATTATAAATATATTGTTCAATAATCA
TTTATCAAGCAAAATTATTTTTATTATACACGGTTTACAAATGATAAACG
AATTCCAAATTGGTGACTCTGTTTTATATAACTCTAAATTGGAAGGAACT
GTCAGATTTATTGGTTCTACAGCTTCAGCTAAAGGAACTTTTTATGGAAT
TGAACTACATACTGCTGATGGTAGAACTGATGGCACTATGGATGGAATTT
CTTATTTCGAATGCAAAGAAAAGCATGGCATATTTGCACGTCGATCTCAA
TTGACTAAAATTCAATCAACAGAGGTTACTTCGTCTGAAAATGAGGTCCA
TGACAAGTTATTGAATAGCTGTGGTGAAACCCGAGATTTAACGGCACAAA
CATCTGACAAAATTGCTAGTCATATTAAAACTAATAATATAGTTACATCA
GTTCCTTCAATAATTAATTCAACGTATCGGGAAAATTTAGAAACTACATT
TGATTCAAAATTTGCTAAAGATTTCCGTAGAAATACAATTTCATCAACTT
TAAAAACAATAGAAAATCACGTTCAATCATCTTTTGATATTACTACTCAG
GAATCAGCGACTAAAGAAATTTCGAAACAAGAAAGCAACTTAGTACATAA
AAAAGAAATTATCATAGAAGATTTGACGCCGATGAAAAAACACGAAAGTG
CAAGTCAAATTGACAATCATTCTAAATTGAAATTTCACAGAAACTCTGTT
GATTTGAAATTGAAATCGCATGAAAATTTGAAACAAAATCAATTAGAACT
AGAAATTCCTAAAAATTATCGAAGGAATACTGTTGGTAATAATGAAATAG
AAACCAAATTTCGGCATAATTTTGGGATAAAGGAACCGGTTCATCAACAC
CTTTCAACAATTTTTGAAAAAAATCCAAACGATAAACAACTTAATAACTC
TAATGTACCGAATAAACTAATGGCGACTCAAGAAACTGCAAACCAAATAG
AGAACGGAAAACAACAAACTAAAATTACCAGTTTTAAATATGCACGACGA
AATACTTTAGCTTCTAAATCGGTTGTCTGTGAAAGCCGACAAGGAAAAGA
AAATCAGTTGATTCATCCGAGAAATACAGTTTCTAATCTAGATAAAGATA
AAGAAATTAAAGATTTAAAAGAAAAAAATGAAACTCTTCAAATCCTCAAG
AAGAAAGAATATAAACGATGTGGAGATTTAGAGAAATTGAACAATGAGTT
ACAAAGGGAATTGCTCGATGCTAAAGAGAGAGAAGAAAGAATTAAAAAGG
AGTTTGATAGTTATCGTGATATGATGAGATCTGGAGAGGAAGAAATCGAA
ATGATTACAATCGATAAAGAAATGGCAGAAGAAAAACTCGAACAGGTGAA
TCAAGATTACCGTAATCTTAAAAAGCTTTACGAACAAGTATTGGAAGAAA
ATTCAATGCTGAAAAATAGTGACGGAACATCCGATGCCAAAATCTTTATT
GACCAAACTTCTACTATAAACAAATATAAAAATGCACTGTTAGAATTGTC
ACAGTCAATTAATTGTTACAAAGAAGAAAATCGAAACCTAAATTCCGAGC
TAGATATTCTAAAGGAATTGCAAATTTTTCAAGAAAATGAATCTGAACAA
TTGAAATCAAAAATTGAAAAACACGAGAAAGATCTGAAAGAGATGAAAGA
TCTGGTTGATAGTACCGCTGACGTTGAAGTCATTCTGGATAAACTGACTT
TCAAAAATGAATACTTGGAAAAAGAACTTAAAAAACTCAAAAAACGATTA
ATTGAACTTGATAAACTAGAAGACGACAGACTGGAAGTTATTGAATCTAA
AGATAAGAAAATCCGAGAATTCCACGAAGAATGCGATTGTCTCAATCTGA
TTGTTAATGAAATACAAAATGCTCTCGACAAAAAGAAAATTGAAAACAGT
GAATTATTGAAAACTACCAATCAAATGAATGAAAGAATTTGCCTATTAAC
AAATGAACTGAAAGAAAAAGAGCTTGAAATTCAGAAACAAAACGAAATTG
TTAAAAAAGCTAAAGCGAAAGATCGAGAGTTATCGAGTTTAACATTTTCG
AAACAAAATATCGAAAAAAACGAAATGAAACGGGATATTGAAAACAAATT
GAAAACGATAGAAATCAGTCACAAGTCCCATCAAGTCCAGCTACTGATCC
AATATTTACCGGCATCGTTTTCTCTACCAGGGGGCGAGCATGACCTCATC
GAAACCGTTCAGATCGTCGATAAACTTATTGACAAAATATCTCTAGTCTT
GGAATATATCATCCAAAAACGAAGGCTCTATCAACAGAGAGATAATTCAG
AGAAAACTCCAGAAAATATTTGCATTCAGTATAAATTGGAATTTCTCTTA
TTAATTTGGTGTGGACTGTTGAAACAATTACAAATAAACATTCACCATTC
TTCTCCGGAAGCTCTCTGTCAGCTGAGGAGTGAATTTAAACAAATACTCC
AACAGGAACAAAACATAGATCTATTAATCGACCTCATGAAGAAGCAATGC
CTTGATAATAGCAGAAATTTCTCTGGTGTGCTACAATCAATAGCGTTTTT
TCAGAATTTTTATGCCGATCGATTTTGTTATCAGCAAATCGACTGTAATT
TGAAAATGGAAAATTTCATCTCAATCCTAAGTAAAGGTTCAGAATGCCTT
CGTAACGATTTATCATGGATTGATCAGATGTTGGAAAATAATGTAGGTGA
GCAAACACTAAAGTTAATGGATAATTTGAATAAGATTTCAACTAATGTGC
AATCAACCATGAAAAATACTCAAATGTATCTACGACACAATCAACGGATT
ACATTTGATTCGTCTGTATCAAAATCTATTGATGGAATAATCTTTTCGCT
AATGGATATTGTCTTGTCGATATCGGATTTTGCGTTACAATTGACAGATG
AAAGAATATTTTCCGATGAGGCCATGTGTAGATTAACGGAAATTTTTGCC
AACAATAGAAATCCTTTGAATCCGACGTCAGATAATGAAATTCTATTCTC
ACTGAATTCCATCGATAAGCAAGTGGAAAATATCGTTTCGAATTTCAAAT
CTGGAGTATATGATGCGGATAAACTGAATAAAACGTTCAATTCCGCCATC
GATACAAATGCTACAAATTATCGGGAGAAATTAATGGGGCTTCAAGCTTT
ATCGTTTGAAATCAAATTGAAGGATGAAATGTTGGCATTAATTAATCAAG
AGTTGAAAGAGAAATCCAGTCAATTATCTGAGATCTTAATGCAAGTCAAT
TTTTACAAGCAAAAATTACAAACAGCAGTTGAGTCTCGGGAAATTATAAT
CAACCAGTTAAATCAGAGGATTTATGAATTGGAAGCCAATGCTGCTAAAC
GGAATGAGACTGAAAAACTGTCAGAATTTGAAAGTGAAACATTGAAAATT
TCCTGTGAACCTATTTCTCATTTATCTGTTTCAAACGAAGAAAATTTCAA
ATCATGTTCAATTGACATAAATGACTACCAAAATGAGATCCGCAACTTGA
CCATTATAGTAAAATATCTGATGAGAAAGTTACACAAATCAAACGCCATC
AAATCTGATAAACGTTTACAAGAATTGAAACCGATAAAAACCCAAACGTT
CATATCGGACAAAGAACTTAATTTGTTGATGCAACGAGCAGTAACTATCA
ATAGAGATATCTATGAAAGTCTATCAAATGTTAAAATCCCAGATTTATCC
TCAAGAAAGGATATAAAGCAATTTTCTGAAAAATCAATTATATTTTCAAA
GTTGAAAAATCAAAGTGAAAAATTGATTATCGACGGAATGAAAAAATGTA
ATCAAAATTGGTTTATTTTGATTCGCCAAATTCCGCCTGTACAAATAATT
CGATTGGCCTAATCCGATTCGATAGGAATTCCGTAAATGACCAATCAATG
AAATCCGTTTCAATAGATAACTGGTCTTTGAAAAAATTGGAAGAATTATT
TTGTTAATAATAATACATCTTATTGTTTTGTGTTAATAAATAATTATTGT
CGTTT
back to top

protein sequence of SMED30014136-orf-1

>SMED30014136-orf-1 ID=SMED30014136-orf-1|Name=SMED30014136-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1274bp
MINEFQIGDSVLYNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTM
DGISYFECKEKHGIFARRSQLTKIQSTEVTSSENEVHDKLLNSCGETRDL
TAQTSDKIASHIKTNNIVTSVPSIINSTYRENLETTFDSKFAKDFRRNTI
SSTLKTIENHVQSSFDITTQESATKEISKQESNLVHKKEIIIEDLTPMKK
HESASQIDNHSKLKFHRNSVDLKLKSHENLKQNQLELEIPKNYRRNTVGN
NEIETKFRHNFGIKEPVHQHLSTIFEKNPNDKQLNNSNVPNKLMATQETA
NQIENGKQQTKITSFKYARRNTLASKSVVCESRQGKENQLIHPRNTVSNL
DKDKEIKDLKEKNETLQILKKKEYKRCGDLEKLNNELQRELLDAKEREER
IKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQV
LEENSMLKNSDGTSDAKIFIDQTSTINKYKNALLELSQSINCYKEENRNL
NSELDILKELQIFQENESEQLKSKIEKHEKDLKEMKDLVDSTADVEVILD
KLTFKNEYLEKELKKLKKRLIELDKLEDDRLEVIESKDKKIREFHEECDC
LNLIVNEIQNALDKKKIENSELLKTTNQMNERICLLTNELKEKELEIQKQ
NEIVKKAKAKDRELSSLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQ
LLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQQR
DNSEKTPENICIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFK
QILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIAFFQNFYADRFCYQQI
DCNLKMENFISILSKGSECLRNDLSWIDQMLENNVGEQTLKLMDNLNKIS
TNVQSTMKNTQMYLRHNQRITFDSSVSKSIDGIIFSLMDIVLSISDFALQ
LTDERIFSDEAMCRLTEIFANNRNPLNPTSDNEILFSLNSIDKQVENIVS
NFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLAL
INQELKEKSSQLSEILMQVNFYKQKLQTAVESREIIINQLNQRIYELEAN
AAKRNETEKLSEFESETLKISCEPISHLSVSNEENFKSCSIDINDYQNEI
RNLTIIVKYLMRKLHKSNAIKSDKRLQELKPIKTQTFISDKELNLLMQRA
VTINRDIYESLSNVKIPDLSSRKDIKQFSEKSIIFSKLKNQSEKLIIDGM
KKCNQNWFILIRQIPPVQIIRLA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005813centrosome
GO:0005869dynactin complex
Vocabulary: molecular function
TermDefinition
GO:0008017microtubule binding
GO:0004871signal transducer activity
GO:0070840dynein complex binding
Vocabulary: biological process
TermDefinition
GO:0034453microtubule anchoring
GO:0000160phosphorelay signal transduction system
GO:0010970transport along microtubule
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036859CAP-Gly_dom_sf
IPR000938CAP-Gly_domain
IPR022157Dynactin
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1087..1107
NoneNo IPR availableCOILSCoilCoilcoord: 412..460
NoneNo IPR availableCOILSCoilCoilcoord: 476..545
NoneNo IPR availableCOILSCoilCoilcoord: 605..625
NoneNo IPR availableCOILSCoilCoilcoord: 640..660
NoneNo IPR availableCOILSCoilCoilcoord: 549..579
NoneNo IPR availableCOILSCoilCoilcoord: 349..404
NoneNo IPR availablePANTHERPTHR18916DYNACTIN 1-RELATED MICROTUBULE-BINDINGcoord: 3..1114
NoneNo IPR availablePANTHERPTHR18916:SF6DYNACTIN SUBUNIT 1-RELATEDcoord: 3..1114
IPR000938CAP Gly-rich domainSMARTSM01052CAP_GLY_2coord: 7..72
e-value: 1.6E-23
score: 94.1
IPR000938CAP Gly-rich domainPFAMPF01302CAP_GLYcoord: 7..70
e-value: 2.1E-18
score: 66.1
IPR000938CAP Gly-rich domainPROSITEPS50245CAP_GLY_2coord: 25..67
score: 14.602
IPR036859CAP Gly-rich domain superfamilyGENE3DG3DSA:2.30.30.190coord: 1..88
e-value: 1.4E-24
score: 87.4
IPR036859CAP Gly-rich domain superfamilySUPERFAMILYSSF74924Cap-Gly domaincoord: 3..83
IPR022157Dynein associated proteinPFAMPF12455Dynactincoord: 643..908
e-value: 4.3E-22
score: 78.7