EF-hand calcium-binding domain-containing protein 10-like

Overview
NameEF-hand calcium-binding domain-containing protein 10-like
Smed IDSMED30014133
Length (bp)739
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of EF-hand calcium-binding domain-containing protein 10-like (SMED30014133) t-SNE clustered cells

Violin plots show distribution of expression levels for EF-hand calcium-binding domain-containing protein 10-like (SMED30014133) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of EF-hand calcium-binding domain-containing protein 10-like (SMED30014133) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for EF-hand calcium-binding domain-containing protein 10-like (SMED30014133) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014133

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30014133h1SMcG0022070 SmedASXL_019621SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30014133h1SMcG0022070 Contig41574uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014133h1SMcG0022070 Contig41574newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30014133h1SMcG0022070 dd_Smed_v4_6477_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30014133h1SMcG0022070 dd_Smed_v4_6477_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30014133h1SMcG0022070 dd_Smed_v4_6477_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014133h1SMcG0022070 dd_Smed_v4_6477_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014133h1SMcG0022070 dd_Smed_v4_6477_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30014133h1SMcG0022070 dd_Smed_v4_6477_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30014133h1SMcG0022070 dd_Smed_v6_6477_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30014133h1SMcG0022070 dd_Smed_v4_6477_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. Ensembl Human
Match: EFCAB10 (EF-hand calcium binding domain 10 [Source:HGNC Symbol;Acc:HGNC:34531])

HSP 1 Score: 77.0258 bits (188), Expect = 3.078e-17
Identity = 43/131 (32.82%), Postives = 76/131 (58.02%), Query Frame = 3
Query:  207 DDSQRKKEVVDYISEHKINELIHNLTSLVLYYKPESPRRFMXXXXXXXXXXXXGSVDPPSLFSDRNIEAMFMMLDPTDQGIINISQYREAMKALGITEYDQFPIGGDNGTIRKDTFINEAKHGLRKMTASF 599
            + S R+ +  +Y+ +H+I E++  LTS +L+++PE P+ ++I  LE L  A+   V  P    + NI AMF M+D + +G I+  QY+EA+K LG+   D+  +  D   I  D F  E    ++++ ++F
Sbjct:    2 ETSSRELQAAEYLEKHQIKEVVSYLTSALLFFRPEKPKEYLISLLERLRIAKVTGVAFPFFMDNSNIVAMFEMMDSSGRGTISFVQYKEALKTLGLCTEDE-DLQDDGHKITLDKFKEEVNKRMKEIWSAF 131          
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. Ensembl Human
Match: EFCAB10 (EF-hand calcium binding domain 10 [Source:HGNC Symbol;Acc:HGNC:34531])

HSP 1 Score: 73.559 bits (179), Expect = 4.376e-16
Identity = 42/127 (33.07%), Postives = 73/127 (57.48%), Query Frame = 3
Query:  207 DDSQRKKEVVDYISEHKINELIHNLTSLVLYYKPESPRRFMXXXXXXXXXXXXGSVDPPSLFSDRNIEAMFMMLDPTDQGIINISQYREAMKALGITEYDQFPIGGDNGTIRKDTFINEAKHGLRKM 587
            + S R+ +  +Y+ +H+I E++  LTS +L+++PE P+ ++I  LE L  A+   V  P    + NI AMF M+D + +G I+  QY+EA+K LG+   D+  +  D   I  D F  E    ++++
Sbjct:    2 ETSSRELQAAEYLEKHQIKEVVSYLTSALLFFRPEKPKEYLISLLERLRIAKVTGVAFPFFMDNSNIVAMFEMMDSSGRGTISFVQYKEALKTLGLCTEDE-DLQDDGHKITLDKFKEEVNKRMKEI 127          
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. Ensembl Human
Match: EFCAB10 (EF-hand calcium binding domain 10 [Source:HGNC Symbol;Acc:HGNC:34531])

HSP 1 Score: 73.9442 bits (180), Expect = 6.394e-16
Identity = 42/128 (32.81%), Postives = 73/128 (57.03%), Query Frame = 3
Query:  207 DDSQRKKEVVDYISEHKINELIHNLTSLVLYYKPESPRRFMXXXXXXXXXXXXGSVDPPSLFSDRNIEAMFMMLDPTDQGIINISQYREAMKALGITEYDQFPIGGDNGTIRKDTFINEAKHGLRKMT 590
            + S R+ +  +Y+ +H+I E++  LTS +L+++PE P+ ++I  LE L  A+   V  P    + NI AMF M+D + +G I+  QY+EA+K LG+   D+  +  D   I  D F  E    ++++ 
Sbjct:    2 ETSSRELQAAEYLEKHQIKEVVSYLTSALLFFRPEKPKEYLISLLERLRIAKVTGVAFPFFMDNSNIVAMFEMMDSSGRGTISFVQYKEALKTLGLCTEDE-DLQDDGHKITLDKFKEEVNKRMKEIC 128          
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. Ensembl Human
Match: EFCAB10 (EF-hand calcium binding domain 10 [Source:HGNC Symbol;Acc:HGNC:34531])

HSP 1 Score: 44.2838 bits (103), Expect = 7.297e-6
Identity = 23/66 (34.85%), Postives = 38/66 (57.58%), Query Frame = 3
Query:  402 NIEAMFMMLDPTDQGIINISQYREAMKALGITEYDQFPIGGDNGTIRKDTFINEAKHGLRKMTASF 599
            NI AMF M+D + +G I+  QY+EA+K LG+   D+  +  D   I  D F  E    ++++ ++F
Sbjct:    5 NIVAMFEMMDSSGRGTISFVQYKEALKTLGLCTEDE-DLQDDGHKITLDKFKEEVNKRMKEIWSAF 69          
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. Ensembl Zebrafish
Match: si:dkey-42p14.3 (si:dkey-42p14.3 [Source:ZFIN;Acc:ZDB-GENE-041111-13])

HSP 1 Score: 95.9005 bits (237), Expect = 1.644e-24
Identity = 47/118 (39.83%), Postives = 80/118 (67.80%), Query Frame = 3
Query:  213 SQRKKEVVDYISEHKINELIHNLTSLVLYYKPESPRRFMXXXXXXXXXXXXGSVDPPSLFSDRNIEAMFMMLDPTDQGIINISQYREAMKALGITEYDQFPIGGDNGTIRKDTFINEA 566
            S R++E  +YI +H+I +L+ NLTS++ +Y+P+ PR+F+I+QLE L+ +++   + P L +  N++A+F +LDP++QG I   QY+E +K +GI  +  FP G     I ++TFI E 
Sbjct:   27 SPREREAAEYIKKHEIVDLMDNLTSMLFFYRPDRPRKFLIDQLEKLKISKDHQGNTPCLLNVSNLDALFGILDPSNQGCITYGQYKEVLKTIGIKNFSAFPDGASENKISQETFIREV 144          
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. Ensembl Xenopus
Match: vps13b (vacuolar protein sorting 13 homolog B [Source:Xenbase;Acc:XB-GENE-853604])

HSP 1 Score: 92.8189 bits (229), Expect = 2.711e-23
Identity = 58/125 (46.40%), Postives = 79/125 (63.20%), Query Frame = 3
Query:  228 EVVDYISEHKINELIHNLTSLVLYYKPESPRRFMXXXXXXXXXXXXGSVDPPSLFSDRNIEAMFMMLDPTDQGIINISQYREAMKALGITEYDQFPIGGDNGTIRKDTFINEAKHGLRKMTASFC 602
            E  +Y+ E++I ELI+NLTSL+LY++PE PR F+I+QLE L+ A+   VD P LF D N++A+F +LDP  QG I  +QY EA+K LGI   D   +    G I  + F    KHG+R    S C
Sbjct:    8 EAEEYLQENRIPELINNLTSLLLYHRPERPREFLIKQLEKLKYARLSDVDYPCLFDDSNLDAIFGILDPAGQGYITGTQYMEALKTLGI---DVRNVEEPGGKITLELF----KHGMRIQLKSAC 125          
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. Ensembl Mouse
Match: Efcab10 (EF-hand calcium binding domain 10 [Source:MGI Symbol;Acc:MGI:1922290])

HSP 1 Score: 72.4034 bits (176), Expect = 1.181e-15
Identity = 44/129 (34.11%), Postives = 71/129 (55.04%), Query Frame = 3
Query:  213 SQRKKEVVDYISEHKINELIHNLTSLVLYYKPESPRRFMXXXXXXXXXXXXGSVDPPSLFSDRNIEAMFMMLDPTDQGIINISQYREAMKALGITEYDQFPIGGDNGTIRKDTFINEAKHGLRKMTASF 599
            + R+ +   Y+  H+I EL++ LTS +L+ +P+ PR ++I  LE L  A+   V  P    + N  +MF M+D   +G I+  QY+EA+K LG+   D+  +  D   I  DTF +E    + KM + F
Sbjct:    5 ADRELQAKLYLERHRIMELLNQLTSFLLFARPKKPREYLISLLERLRVAKATHVAFPYFMDNSNTVSMFEMMDMAGRGCISFVQYKEALKNLGLCTADEV-LNDDGHIITLDTFRDEMNKRMEKMWSMF 132          
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. UniProt/SwissProt
Match: sp|A6NFE3|EFC10_HUMAN (EF-hand calcium-binding domain-containing protein 10 OS=Homo sapiens OX=9606 GN=EFCAB10 PE=2 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 2.102e-15
Identity = 42/127 (33.07%), Postives = 73/127 (57.48%), Query Frame = 3
Query:  207 DDSQRKKEVVDYISEHKINELIHNLTSLVLYYKPESPRRFMXXXXXXXXXXXXGSVDPPSLFSDRNIEAMFMMLDPTDQGIINISQYREAMKALGITEYDQFPIGGDNGTIRKDTFINEAKHGLRKM 587
            + S R+ +  +Y+ +H+I E++  LTS +L+++PE P+ ++I  LE L  A+   V  P    + NI AMF M+D + +G I+  QY+EA+K LG+   D+  +  D   I  D F  E    ++++
Sbjct:    2 ETSSRELQAAEYLEKHQIKEVVSYLTSALLFFRPEKPKEYLISLLERLRIAKVTGVAFPFFMDNSNIVAMFEMMDSSGRGTISFVQYKEALKTLGLCTEDE-DLQDDGHKITLDKFKEEVNKRMKEI 127          
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. UniProt/SwissProt
Match: sp|Q9D581|EFC10_MOUSE (EF-hand calcium-binding domain-containing protein 10 OS=Mus musculus OX=10090 GN=Efcab10 PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 8.264e-15
Identity = 44/129 (34.11%), Postives = 71/129 (55.04%), Query Frame = 3
Query:  213 SQRKKEVVDYISEHKINELIHNLTSLVLYYKPESPRRFMXXXXXXXXXXXXGSVDPPSLFSDRNIEAMFMMLDPTDQGIINISQYREAMKALGITEYDQFPIGGDNGTIRKDTFINEAKHGLRKMTASF 599
            + R+ +   Y+  H+I EL++ LTS +L+ +P+ PR ++I  LE L  A+   V  P    + N  +MF M+D   +G I+  QY+EA+K LG+   D+  +  D   I  DTF +E    + KM + F
Sbjct:    5 ADRELQAKLYLERHRIMELLNQLTSFLLFARPKKPREYLISLLERLRVAKATHVAFPYFMDNSNTVSMFEMMDMAGRGCISFVQYKEALKNLGLCTADEV-LNDDGHIITLDTFRDEMNKRMEKMWSMF 132          
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. TrEMBL
Match: A0A4S2LSM0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005132 PE=4 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 3.536e-31
Identity = 59/132 (44.70%), Postives = 94/132 (71.21%), Query Frame = 3
Query:  204 YDDSQRKKEVVDYISEHKINELIHNLTSLVLYYKPESPRRFMXXXXXXXXXXXXGSVDPPSLFSDRNIEAMFMMLDPTDQGIINISQYREAMKALGITEYDQFPIGGDNGTIRKDTFINEAKHGLRKMTASF 599
            Y+   RK EV  Y+SEHKI EL  NLTSL++Y++P++P++F+ EQL+ L  AQ  + +PPSLF+  N E++F MLDP ++ +I+  +Y  A++ LGIT+YD+ P G ++ +I K+T++ EA  GL K+  ++
Sbjct:    3 YESCPRKHEVESYLSEHKIPELFQNLTSLLIYHRPDNPKQFLWEQLKQLRDAQNCTQEPPSLFTRENAESIFNMLDPCEKNVISFDRYCHALETLGITKYDKNPAGLESDSISKETYLEEASQGLLKLAKTY 134          
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. TrEMBL
Match: C3YV84 (EF-hand domain-containing protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_276755 PE=4 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 1.652e-29
Identity = 58/127 (45.67%), Postives = 87/127 (68.50%), Query Frame = 3
Query:  219 RKKEVVDYISEHKINELIHNLTSLVLYYKPESPRRFMXXXXXXXXXXXXGSVDPPSLFSDRNIEAMFMMLDPTDQGIINISQYREAMKALGITEYDQFPIGGDNGTIRKDTFINEAKHGLRKMTASF 599
            R++E   Y+ EHKI EL +NLT+ ++Y +P++PR+++I+ LE L  ++   +D P LF D N++A+F +LDPT +G I + +Y+ AM  LG  +YD  P+G D   I  DTF+ EAKHG+ K TASF
Sbjct:    5 REEEARAYLEEHKIIELFNNLTAQLVYSRPDNPRQYLIQYLERLRTSKLSQLDYPVLFDDTNLQALFGILDPTRKGFITLEEYKHAMDNLGALDYDPHPVGADADQINMDTFVREAKHGVTKSTASF 131          
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. TrEMBL
Match: W5NFU7 (Si:dkey-42p14.3 OS=Lepisosteus oculatus OX=7918 PE=4 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 3.418e-29
Identity = 58/127 (45.67%), Postives = 88/127 (69.29%), Query Frame = 3
Query:  219 RKKEVVDYISEHKINELIHNLTSLVLYYKPESPRRFMXXXXXXXXXXXXGSVDPPSLFSDRNIEAMFMMLDPTDQGIINISQYREAMKALGITEYDQFPIGGDNGTIRKDTFINEAKHGLRKMTASF 599
            R++E   Y+ +HKI +L+ NL S++ +++PE PR F+I QLE+L+  +  + D P LF+D N+EA+F +LDP  QG I ++QY+EA+K LGI  +D+ P G +   I +DTF  EAK GL K +A+F
Sbjct:    5 REREAASYLEKHKILDLMDNLASMLFFHRPERPREFLISQLEMLKVTRMRTADSPCLFNDSNLEAIFGILDPPRQGYITLAQYKEALKTLGIKTFDESPEGCEFNRISQDTFKKEAKDGLMKCSATF 131          
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. TrEMBL
Match: A0A5N5NDL4 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00244620 PE=4 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 2.618e-28
Identity = 59/127 (46.46%), Postives = 84/127 (66.14%), Query Frame = 3
Query:  219 RKKEVVDYISEHKINELIHNLTSLVLYYKPESPRRFMXXXXXXXXXXXXGSVDPPSLFSDRNIEAMFMMLDPTDQGIINISQYREAMKALGITEYDQFPIGGDNGTIRKDTFINEAKHGLRKMTASF 599
            R+KE   Y+  HKI EL++NLTS++ YY+PE PR F+I QLE ++ ++  +   P LF D N++A+  +LDPT+QG I+ +QYREA+K LGI  + + P G  N  I  +TF  EAK  L K  A+F
Sbjct:    5 REKEAAKYLENHKILELMNNLTSMLFYYRPEQPREFLISQLEQMQASKLQAAGIPCLFDDSNLDAVCGILDPTNQGYISYNQYREALKTLGIQHFSECPEGLGNDRISHETFKREAKECLLKNAATF 131          
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. TrEMBL
Match: A0A2D0SDA9 (EF-hand calcium-binding domain-containing protein 10-like OS=Ictalurus punctatus OX=7998 GN=LOC108274539 PE=4 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 4.156e-28
Identity = 57/127 (44.88%), Postives = 87/127 (68.50%), Query Frame = 3
Query:  219 RKKEVVDYISEHKINELIHNLTSLVLYYKPESPRRFMXXXXXXXXXXXXGSVDPPSLFSDRNIEAMFMMLDPTDQGIINISQYREAMKALGITEYDQFPIGGDNGTIRKDTFINEAKHGLRKMTASF 599
            R++E   Y+  HKI EL++NLTS++L+Y+PE PR ++I QLE ++ ++  +   P LF D N++A+  +LDPT+QG I+ +QYREA+K LGI  ++++P G  N  I  +TF  EAK  L K  A+F
Sbjct:    5 REQEAAKYLENHKILELMNNLTSMLLFYRPEHPREYLISQLEQMQVSKFQAAASPCLFDDSNLDAVCGILDPTNQGYISYNQYREALKTLGIQHFNEWPEGPGNDRISHETFKREAKECLLKNAATF 131          
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. Ensembl Cavefish
Match: si:dkey-42p14.3 (EF-hand calcium-binding domain-containing protein 10-like [Source:NCBI gene;Acc:103027288])

HSP 1 Score: 102.064 bits (253), Expect = 3.923e-27
Identity = 51/129 (39.53%), Postives = 88/129 (68.22%), Query Frame = 3
Query:  213 SQRKKEVVDYISEHKINELIHNLTSLVLYYKPESPRRFMXXXXXXXXXXXXGSVDPPSLFSDRNIEAMFMMLDPTDQGIINISQYREAMKALGITEYDQFPIGGDNGTIRKDTFINEAKHGLRKMTASF 599
            + R++E  +Y++ H+I EL+ NLTS++L+Y+P+ P+ F+I QLE L+ ++   V+ P L  + N++A+F +LDP ++G I+ +QYREAM  LGI ++ ++    +   I ++TF  EAK GL +  A+F
Sbjct:    3 TSREQEAEEYLNNHRIIELMKNLTSMLLFYRPDRPKEFLISQLEKLKTSRLHGVESPCLIDESNLDAVFGILDPANRGYISCAQYREAMMTLGIKDFSEYTEDLETDRISQETFKREAKEGLLRGAATF 131          
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. Ensembl Nematostella
Match: EDO49685 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFZ4])

HSP 1 Score: 99.3673 bits (246), Expect = 1.928e-26
Identity = 49/130 (37.69%), Postives = 81/130 (62.31%), Query Frame = 3
Query:  210 DSQRKKEVVDYISEHKINELIHNLTSLVLYYKPESPRRFMXXXXXXXXXXXXGSVDPPSLFSDRNIEAMFMMLDPTDQGIINISQYREAMKALGITEYDQFPIGGDNGTIRKDTFINEAKHGLRKMTASF 599
            D+ R++   +Y+ +HKI EL+ NLTS ++Y +PE P+ +M   LE L  A+    + P LF D N+ ++F MLD T +G I   QY+E +  LG+ ++++ P G D   I  +TF+ EA+ GL + +++F
Sbjct:    3 DTNREESAREYLKKHKIMELLDNLTSHLIYERPEEPKEYMCHYLEKLRDARTAQRNYPCLFDDSNVRSLFGMLDVTGKGFITYEQYKEGLDTLGVDKFNRDPPGADIDKITSETFLKEARQGLAQASSTF 132          
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. Ensembl Medaka
Match: si:dkey-42p14.3 (EF-hand calcium-binding domain-containing protein 10 [Source:NCBI gene;Acc:101163486])

HSP 1 Score: 102.064 bits (253), Expect = 4.257e-27
Identity = 54/129 (41.86%), Postives = 89/129 (68.99%), Query Frame = 3
Query:  213 SQRKKEVVDYISEHKINELIHNLTSLVLYYKPESPRRFMXXXXXXXXXXXXGSVDPPSLFSDRNIEAMFMMLDPTDQGIINISQYREAMKALGITEYDQFPIGGDNGTIRKDTFINEAKHGLRKMTASF 599
            ++++K   DY+ +HKI EL+ NL S++L+Y+P++PR F+IEQL++L+ +Q  +V  P L    N++A+F +LDP  Q  I  +QYR+AMK LGI + D+ P G +   I  +TF  EA+ GL++ +A++
Sbjct:    3 TKQEKYAADYLRKHKIAELVENLFSMLLFYRPDNPREFLIEQLKLLKLSQINNVMGPHLLKSSNLDAVFGILDPAKQKHITFAQYRQAMKTLGIKDIDECPEGVNEDRISYETFKAEAERGLQRYSAAY 131          
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. Ensembl Medaka
Match: si:dkey-42p14.3 (EF-hand calcium-binding domain-containing protein 10 [Source:NCBI gene;Acc:101163486])

HSP 1 Score: 102.064 bits (253), Expect = 4.257e-27
Identity = 54/129 (41.86%), Postives = 89/129 (68.99%), Query Frame = 3
Query:  213 SQRKKEVVDYISEHKINELIHNLTSLVLYYKPESPRRFMXXXXXXXXXXXXGSVDPPSLFSDRNIEAMFMMLDPTDQGIINISQYREAMKALGITEYDQFPIGGDNGTIRKDTFINEAKHGLRKMTASF 599
            ++++K   DY+ +HKI EL+ NL S++L+Y+P++PR F+IEQL++L+ +Q  +V  P L    N++A+F +LDP  Q  I  +QYR+AMK LGI + D+ P G +   I  +TF  EA+ GL++ +A++
Sbjct:    3 TKQEKYAADYLRKHKIAELVENLFSMLLFYRPDNPREFLIEQLKLLKLSQINNVMGPHLLKSSNLDAVFGILDPAKQKHITFAQYRQAMKTLGIKDIDECPEGVNEDRISYETFKAEAERGLQRYSAAY 131          
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. Planmine SMEST
Match: SMESG000023074.1 (SMESG000023074.1)

HSP 1 Score: 278.485 bits (711), Expect = 3.271e-96
Identity = 145/146 (99.32%), Postives = 146/146 (100.00%), Query Frame = 3
Query:  171 MNYIECKDKRPYDDSQRKKEVVDYISEHKINELIHNLTSLVLYYKPESPRRFMXXXXXXXXXXXXGSVDPPSLFSDRNIEAMFMMLDPTDQGIINISQYREAMKALGITEYDQFPIGGDNGTIRKDTFINEAKHGLRKMTASFCPK 608
            MNYIECKDKRPYDDSQRKKEVVDYISEHKINELIHNLTSL+LYYKPESPRRFMIEQLEILEQAQEGSVDPPSLFSDRNIEAMFMMLDPTDQGIINISQYREAMKALGITEYDQFPIGGDNGTIRKDTFINEAKHGLRKMTASFCPK
Sbjct:    1 MNYIECKDKRPYDDSQRKKEVVDYISEHKINELIHNLTSLILYYKPESPRRFMIEQLEILEQAQEGSVDPPSLFSDRNIEAMFMMLDPTDQGIINISQYREAMKALGITEYDQFPIGGDNGTIRKDTFINEAKHGLRKMTASFCPK 146          
The following BLAST results are available for this feature:
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
EFCAB103.078e-1732.82EF-hand calcium binding domain 10 [Source:HGNC Sym... [more]
EFCAB104.376e-1633.07EF-hand calcium binding domain 10 [Source:HGNC Sym... [more]
EFCAB106.394e-1632.81EF-hand calcium binding domain 10 [Source:HGNC Sym... [more]
EFCAB107.297e-634.85EF-hand calcium binding domain 10 [Source:HGNC Sym... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkey-42p14.31.644e-2439.83si:dkey-42p14.3 [Source:ZFIN;Acc:ZDB-GENE-041111-1... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
vps13b2.711e-2346.40vacuolar protein sorting 13 homolog B [Source:Xenb... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Efcab101.181e-1534.11EF-hand calcium binding domain 10 [Source:MGI Symb... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|A6NFE3|EFC10_HUMAN2.102e-1533.07EF-hand calcium-binding domain-containing protein ... [more]
sp|Q9D581|EFC10_MOUSE8.264e-1534.11EF-hand calcium-binding domain-containing protein ... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LSM03.536e-3144.70Uncharacterized protein OS=Opisthorchis felineus O... [more]
C3YV841.652e-2945.67EF-hand domain-containing protein OS=Branchiostoma... [more]
W5NFU73.418e-2945.67Si:dkey-42p14.3 OS=Lepisosteus oculatus OX=7918 PE... [more]
A0A5N5NDL42.618e-2846.46Uncharacterized protein OS=Pangasianodon hypophtha... [more]
A0A2D0SDA94.156e-2844.88EF-hand calcium-binding domain-containing protein ... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkey-42p14.33.923e-2739.53EF-hand calcium-binding domain-containing protein ... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO496851.928e-2637.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:dkey-42p14.34.257e-2741.86EF-hand calcium-binding domain-containing protein ... [more]
si:dkey-42p14.34.257e-2741.86EF-hand calcium-binding domain-containing protein ... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 10-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000023074.13.271e-9699.32SMESG000023074.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014133 ID=SMED30014133|Name=EF-hand calcium-binding domain-containing protein 10-like|organism=Schmidtea mediterranea sexual|type=transcript|length=739bp
TTTTCAATAAAATAGGTGAATCGGTTCAACTTGAAATCTTGTCTTATTAC
AATATTACTATTTAGTCAAGCTTTACGAGAATCATGGCAGACCACTCTAA
TAGAAATCGCATTAAATATCACTTTGAAAAATAATGATGATTTTGAAATG
GAAACCTTTTAAAAAGAAAAATGAATTATATTGAATGTAAAGATAAAAGA
CCATATGATGATAGTCAAAGGAAGAAGGAAGTCGTTGATTATATCAGTGA
ACATAAAATTAATGAATTAATTCATAATTTAACGTCCTTGGTTCTGTATT
ATAAGCCTGAAAGCCCGCGGCGATTTATGATTGAACAATTAGAAATTCTA
GAACAAGCACAAGAAGGTTCTGTTGATCCACCCAGTTTATTTTCTGACAG
GAACATTGAAGCAATGTTTATGATGTTAGACCCAACCGATCAAGGCATAA
TTAACATATCGCAATACAGAGAAGCTATGAAAGCTTTAGGAATCACCGAA
TACGACCAATTTCCTATTGGAGGCGATAATGGTACAATTAGAAAAGATAC
ATTTATTAATGAAGCAAAACACGGCCTCAGGAAAATGACTGCAAGTTTTT
GTCCAAAATAAAAATTGATTTGTCTTGTTAATTATTAATCCAAAAAAATT
CGGAAATATTTGTTAATGTTAATGAAAATTTCCTTAAGGCGTTTATTGTC
TTACTTTAATCTAATAAAATATCTTTTCTCAAAAAAAAA
back to top

protein sequence of SMED30014133-orf-1

>SMED30014133-orf-1 ID=SMED30014133-orf-1|Name=SMED30014133-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=147bp
MNYIECKDKRPYDDSQRKKEVVDYISEHKINELIHNLTSLVLYYKPESPR
RFMIEQLEILEQAQEGSVDPPSLFSDRNIEAMFMMLDPTDQGIINISQYR
EAMKALGITEYDQFPIGGDNGTIRKDTFINEAKHGLRKMTASFCPK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR039879EFC10
IPR002048EF_hand_dom
IPR011992EF-hand-dom_pair
IPR003117cAMP_dep_PK_reg_su_I/II_a/b
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR039879EF-hand calcium-binding domain-containing protein 10PANTHERPTHR21847FAMILY NOT NAMEDcoord: 16..141
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 74..109
score: 9.576
NoneNo IPR availableSUPERFAMILYSSF47391Dimerization-anchoring domain of cAMP-dependent PK regulatory subunitcoord: 19..63
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 77..133