RPTOR independent companion of MTOR, complex 2 a

Overview
NameRPTOR independent companion of MTOR, complex 2 a
Smed IDSMED30014131
Length (bp)6177
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RPTOR independent companion of MTOR, complex 2 a (SMED30014131) t-SNE clustered cells

Violin plots show distribution of expression levels for RPTOR independent companion of MTOR, complex 2 a (SMED30014131) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RPTOR independent companion of MTOR, complex 2 a (SMED30014131) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RPTOR independent companion of MTOR, complex 2 a (SMED30014131) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014131

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30014131SMESG000033571.1 SMESG000033570.1 JN815259.1smed_ncbi_20200123PMID:22451003
González-Sastre et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30014131SMESG000033571.1 SMESG000033570.1 JN815259.1smed_ncbi_20200123PMID:22451003
González-Sastre et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30014131SMESG000033571.1 SMESG000033570.1 JN815259.1smed_ncbi_20200123PMID:22451003
González-Sastre et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30014131SMESG000033571.1 SMESG000033570.1 JN815259.1smed_ncbi_20200123PMID:22451003
González-Sastre et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30014131SMESG000033571.1 SMESG000033570.1 JN815259.1smed_ncbi_20200123PMID:22451003
González-Sastre et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30014131SMESG000024212.1 SMESG000033570.1 dd_Smed_v4_9324_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30014131SMESG000024212.1 SMESG000033570.1 dd_Smed_v4_9324_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30014131SMESG000024212.1 SMESG000033570.1 dd_Smed_v4_9324_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014131SMESG000024212.1 SMESG000033570.1 dd_Smed_v4_9324_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30014131SMESG000024212.1 SMESG000033570.1 dd_Smed_v4_9324_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014131SMESG000024212.1 SMESG000033570.1 dd_Smed_v4_9324_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30014131SMESG000024212.1 SMESG000033570.1 dd_Smed_v4_9324_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30014131SMESG000024212.1 SMESG000033570.1 dd_Smed_v6_9324_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Human
Match: RICTOR (RPTOR independent companion of MTOR complex 2 [Source:HGNC Symbol;Acc:HGNC:28611])

HSP 1 Score: 130.183 bits (326), Expect = 3.206e-29
Identity = 120/438 (27.40%), Postives = 217/438 (49.54%), Query Frame = 2
Query:  293 LWSDSKLVRTAALRCLRYYVLNVYHVELFLKMRLDFLIMRSLDLSYENAINNQYRNSDDAERIHAMRLLYRLSLISPKLFPFSLINALTVICLSGSDSSGNVLDIAIRPAXXXXXXXXXXYPDFASKNEILYT-LQTVICNQDGKAWRLNFRIIEAVLLTQLKLITHSYWRSTVPIGY-FNKTLTPFSILSKIQSEPIFESGYFGNYVSTQHEFESTSISILLTLFQSWSGLLYLFGSNNKPILSLTGLLAVGCSGIRGRILDLLFQLFNIYRPPNTCTDFVSSLESITEQSTGKNRPVWNLDDEFLVGQCNDCLPHLSGNRINVIDNYQAILLGIFVQCNIFEALESAVADDNELISSRAGILLANISYKVSILLPADHP-----LSSKTNASVLFNNPKSQK-----ALLWIHQVHQLLEHHQFEITPFLTYIIQQ 1570
            L +++K VR A LR LRY + +   ++  LK+++D+LI R +D+          + S++ ER  A+RL+ ++  ++  LFP S+ N+L  +   G        D  +R  + I+C+L +  P+  +    L T L+ VI   D +  R+N    EA++ T L L+ H   R  V       + L P++      S P    G        +  F ++ + I+ T F+SW+G++ L    N  I SL G+L +    IR  +L++L+ +F +  P  T  +F+ +L S+     G+ +  W L D F+  +    LPH + +R +++DNY A++L  F++  + E L   + + ++ IS RA ILL  + +  + +LP  H      L +  N +  F+ PK ++     AL  + + H++ +      +  L +IIQ+
Sbjct:   92 LLNEAKEVRAAGLRALRYLIQDSSILQKVLKLKVDYLIARCIDI----------QQSNEVERTQALRLVRKMITVNASLFPSSVTNSLIAVGNDGLQER----DRMVRACIAIICELALQNPEVVALRGGLNTILKNVI---DCQLSRIN----EALITTILHLLNHPKTRQYVRADVELERILAPYTDFHYRHS-PDTAEGQLKE--DREARFLASKMGIIAT-FRSWAGIINLCKPGNSGIQSLIGVLCIPNMEIRRGLLEVLYDIFRLPLPVVT-EEFIEALLSV---DPGRFQDSWRLSDGFVAAEAKTILPHRARSRPDLMDNYLALILSAFIRNGLLEGLVEVITNSDDHISVRATILLGELLHMANTILPHSHSHHLHCLPTLMNMAASFDIPKEKRLRASAALNCLKRFHEMKKRGPKPYSLHLDHIIQK 500          

HSP 2 Score: 111.309 bits (277), Expect = 3.102e-26
Identity = 68/184 (36.96%), Postives = 95/184 (51.63%), Query Frame = 2
Query: 2258 SSYLILAIGRMSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLY 2809
            S +  L IG +S    G  +LEK                D L KL + SLDY+R  L R +LS  + +     R Y+TK L+VLLRA V FF++WG+  L+ QLHD ++ +   A +IL EA ED+A ++ LI    A  H    G +L  R LS+P  F  L  +  V   L+ W + YN+ Y
Sbjct:  656 SQHYFLFIGTLSCHPHGVKMLEKCSVFQCLLNLCSLKNQDHLLKLTVSSLDYSRDGLARVILSKILTAATDACRLYATKHLRVLLRANVEFFNNWGIELLVTQLHDKNKTISSEALDILDEACEDKANLHALIQMKPALSHLGDKGLLLLLRFLSIPKGFSYLNERGYVAKQLEKWHREYNSKY 839          

HSP 3 Score: 30.0314 bits (66), Expect = 3.102e-26
Identity = 28/123 (22.76%), Postives = 52/123 (42.28%), Query Frame = 1
Query: 2851 RISNKIKCKPRDLILLCHPYGSISEHKAGMDILYKRGDLQECLVVI----MDEWNRLRDGDIQNETHTSFLKVDEHELILRSSMLAICHIARSPWGLEFIIEMNIPLIVSRLTQFHPSFNVRG 3207
            R SN+   +P  + L  H YG +  HK G  +L  +  + E    +    +D+W  ++                     L++S+ A+ +I  S WGL  + E N+   + +L +     ++RG
Sbjct:  865 RRSNQRLQRPH-VYLPIHLYGQLVHHKTGCHLLEVQNIITELCRNVRTPDLDKWEEIKK--------------------LKASLWALGNIGSSNWGLNLLQEENVIPDILKLAKQCEVLSIRG 966          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Human
Match: RICTOR (RPTOR independent companion of MTOR complex 2 [Source:HGNC Symbol;Acc:HGNC:28611])

HSP 1 Score: 130.183 bits (326), Expect = 3.256e-29
Identity = 120/438 (27.40%), Postives = 217/438 (49.54%), Query Frame = 2
Query:  293 LWSDSKLVRTAALRCLRYYVLNVYHVELFLKMRLDFLIMRSLDLSYENAINNQYRNSDDAERIHAMRLLYRLSLISPKLFPFSLINALTVICLSGSDSSGNVLDIAIRPAXXXXXXXXXXYPDFASKNEILYT-LQTVICNQDGKAWRLNFRIIEAVLLTQLKLITHSYWRSTVPIGY-FNKTLTPFSILSKIQSEPIFESGYFGNYVSTQHEFESTSISILLTLFQSWSGLLYLFGSNNKPILSLTGLLAVGCSGIRGRILDLLFQLFNIYRPPNTCTDFVSSLESITEQSTGKNRPVWNLDDEFLVGQCNDCLPHLSGNRINVIDNYQAILLGIFVQCNIFEALESAVADDNELISSRAGILLANISYKVSILLPADHP-----LSSKTNASVLFNNPKSQK-----ALLWIHQVHQLLEHHQFEITPFLTYIIQQ 1570
            L +++K VR A LR LRY + +   ++  LK+++D+LI R +D+          + S++ ER  A+RL+ ++  ++  LFP S+ N+L  +   G        D  +R  + I+C+L +  P+  +    L T L+ VI   D +  R+N    EA++ T L L+ H   R  V       + L P++      S P    G        +  F ++ + I+ T F+SW+G++ L    N  I SL G+L +    IR  +L++L+ +F +  P  T  +F+ +L S+     G+ +  W L D F+  +    LPH + +R +++DNY A++L  F++  + E L   + + ++ IS RA ILL  + +  + +LP  H      L +  N +  F+ PK ++     AL  + + H++ +      +  L +IIQ+
Sbjct:   92 LLNEAKEVRAAGLRALRYLIQDSSILQKVLKLKVDYLIARCIDI----------QQSNEVERTQALRLVRKMITVNASLFPSSVTNSLIAVGNDGLQER----DRMVRACIAIICELALQNPEVVALRGGLNTILKNVI---DCQLSRIN----EALITTILHLLNHPKTRQYVRADVELERILAPYTDFHYRHS-PDTAEGQLKE--DREARFLASKMGIIAT-FRSWAGIINLCKPGNSGIQSLIGVLCIPNMEIRRGLLEVLYDIFRLPLPVVT-EEFIEALLSV---DPGRFQDSWRLSDGFVAAEAKTILPHRARSRPDLMDNYLALILSAFIRNGLLEGLVEVITNSDDHISVRATILLGELLHMANTILPHSHSHHLHCLPTLMNMAASFDIPKEKRLRASAALNCLKRFHEMKKRGPKPYSLHLDHIIQK 500          

HSP 2 Score: 111.309 bits (277), Expect = 3.481e-26
Identity = 68/184 (36.96%), Postives = 95/184 (51.63%), Query Frame = 2
Query: 2258 SSYLILAIGRMSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLY 2809
            S +  L IG +S    G  +LEK                D L KL + SLDY+R  L R +LS  + +     R Y+TK L+VLLRA V FF++WG+  L+ QLHD ++ +   A +IL EA ED+A ++ LI    A  H    G +L  R LS+P  F  L  +  V   L+ W + YN+ Y
Sbjct:  656 SQHYFLFIGTLSCHPHGVKMLEKCSVFQCLLNLCSLKNQDHLLKLTVSSLDYSRDGLARVILSKILTAATDACRLYATKHLRVLLRANVEFFNNWGIELLVTQLHDKNKTISSEALDILDEACEDKANLHALIQMKPALSHLGDKGLLLLLRFLSIPKGFSYLNERGYVAKQLEKWHREYNSKY 839          

HSP 3 Score: 30.0314 bits (66), Expect = 3.481e-26
Identity = 28/123 (22.76%), Postives = 52/123 (42.28%), Query Frame = 1
Query: 2851 RISNKIKCKPRDLILLCHPYGSISEHKAGMDILYKRGDLQECLVVI----MDEWNRLRDGDIQNETHTSFLKVDEHELILRSSMLAICHIARSPWGLEFIIEMNIPLIVSRLTQFHPSFNVRG 3207
            R SN+   +P  + L  H YG +  HK G  +L  +  + E    +    +D+W  ++                     L++S+ A+ +I  S WGL  + E N+   + +L +     ++RG
Sbjct:  865 RRSNQRLQRPH-VYLPIHLYGQLVHHKTGCHLLEVQNIITELCRNVRTPDLDKWEEIKK--------------------LKASLWALGNIGSSNWGLNLLQEENVIPDILKLAKQCEVLSIRG 966          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Human
Match: RICTOR (RPTOR independent companion of MTOR complex 2 [Source:HGNC Symbol;Acc:HGNC:28611])

HSP 1 Score: 59.6918 bits (143), Expect = 1.167e-8
Identity = 54/184 (29.35%), Postives = 95/184 (51.63%), Query Frame = 2
Query:  293 LWSDSKLVRTAALRCLRYYVLNVYHVELFLKMRLDFLIMRSLDLSYENAINNQYRNSDDAERIHAMRLLYRLSLISPKLFPFSLINALTVICLSGSDSSGNVLDIAIRPAXXXXXXXXXXYPDFASKNEILYT-LQTVICNQDGKAWRLNFRIIEAVLLTQLKLITH----SYWRSTVPIGYFN 829
            L +++K VR A LR LRY + +   ++  LK+++D+LI R +D+          + S++ ER  A+RL+ ++  ++  LFP S+ N+L  +   G        D  +R  + I+C+L +  P+  +    L T L+ VI   D +  R+N    EA++ T L L+ H     Y R+ V +  F+
Sbjct:   92 LLNEAKEVRAAGLRALRYLIQDSSILQKVLKLKVDYLIARCIDI----------QQSNEVERTQALRLVRKMITVNASLFPSSVTNSLIAVGNDGLQER----DRMVRACIAIICELALQNPEVVALRGGLNTILKNVI---DCQLSRIN----EALITTILHLLNHPKTRQYVRADVELENFS 254          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Human
Match: RICTOR (RPTOR independent companion of MTOR complex 2 [Source:HGNC Symbol;Acc:HGNC:28611])

HSP 1 Score: 57.3806 bits (137), Expect = 5.607e-8
Identity = 50/167 (29.94%), Postives = 88/167 (52.69%), Query Frame = 2
Query:  293 LWSDSKLVRTAALRCLRYYVLNVYHVELFLKMRLDFLIMRSLDLSYENAINNQYRNSDDAERIHAMRLLYRLSLISPKLFPFSLINALTVICLSGSDSSGNVLDIAIRPAXXXXXXXXXXYPDFASKNEILYT-LQTVICNQDGKAWRLNFRIIEAVLLTQLKLITH 790
            L +++K VR A LR LRY + +   ++  LK+++D+LI R +D+          + S++ ER  A+RL+ ++  ++  LFP S+ N+L  +   G        D  +R  + I+C+L +  P+  +    L T L+ VI   D +  R+N    EA++ T L L+ H
Sbjct:   76 LLNEAKEVRAAGLRALRYLIQDSSILQKVLKLKVDYLIARCIDI----------QQSNEVERTQALRLVRKMITVNASLFPSSVTNSLIAVGNDGLQER----DRMVRACIAIICELALQNPEVVALRGGLNTILKNVI---DCQLSRIN----EALITTILHLLNH 221          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Celegans
Match: rict-1 (pep chromosome:WBcel235:II:13098250:13116806:-1 gene:WBGene00009245.1 transcript:F29C12.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:rict-1)

HSP 1 Score: 67.781 bits (164), Expect = 1.059e-10
Identity = 38/129 (29.46%), Postives = 69/129 (53.49%), Query Frame = 2
Query: 2228 FTEYDLNYKCSSYLILAIGRMSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEIL 2614
            F   +L+Y  S      IG  +++  G +IL   G ++++   L  +     TK+I+ SLDYT   + R ++  A+ S +  +R+++T++L VL    +P FS WG+ ++++QL D    V +    IL
Sbjct:  791 FAARNLSYTNSMLHFAIIGTFTMTSKGLSILTNAGVLHMYVDILSSTSQLEYTKVIISSLDYTNEGMVRVIIGKALTSTSEASRKWTTRYLAVLASFDLPTFSDWGIQYMLRQLADESSKVVRHTIRIL 919          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Celegans
Match: rict-1 (pep chromosome:WBcel235:II:13098249:13116806:-1 gene:WBGene00009245.1 transcript:F29C12.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:rict-1)

HSP 1 Score: 67.781 bits (164), Expect = 1.095e-10
Identity = 38/129 (29.46%), Postives = 69/129 (53.49%), Query Frame = 2
Query: 2228 FTEYDLNYKCSSYLILAIGRMSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEIL 2614
            F   +L+Y  S      IG  +++  G +IL   G ++++   L  +     TK+I+ SLDYT   + R ++  A+ S +  +R+++T++L VL    +P FS WG+ ++++QL D    V +    IL
Sbjct:  789 FAARNLSYTNSMLHFAIIGTFTMTSKGLSILTNAGVLHMYVDILSSTSQLEYTKVIISSLDYTNEGMVRVIIGKALTSTSEASRKWTTRYLAVLASFDLPTFSDWGIQYMLRQLADESSKVVRHTIRIL 917          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Celegans
Match: rict-1 (pep chromosome:WBcel235:II:13098249:13110236:-1 gene:WBGene00009245.1 transcript:F29C12.3c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:rict-1)

HSP 1 Score: 60.077 bits (144), Expect = 1.707e-8
Identity = 32/103 (31.07%), Postives = 58/103 (56.31%), Query Frame = 2
Query: 2306 GETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEIL 2614
            G +IL   G ++++   L  +     TK+I+ SLDYT   + R ++  A+ S +  +R+++T++L VL    +P FS WG+ ++++QL D    V +    IL
Sbjct:    5 GLSILTNAGVLHMYVDILSSTSQLEYTKVIISSLDYTNEGMVRVIIGKALTSTSEASRKWTTRYLAVLASFDLPTFSDWGIQYMLRQLADESSKVVRHTIRIL 107          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Fly
Match: rictor (gene:FBgn0031006 transcript:FBtr0343635)

HSP 1 Score: 88.9669 bits (219), Expect = 4.667e-17
Identity = 65/234 (27.78%), Postives = 105/234 (44.87%), Query Frame = 2
Query: 2120 MYSNLKDCLLSIADEKYIQEIKDNFGF----NKTYEACGIFTEYDLNYKCSSYLILAIGRMSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLY 2809
            + SN  +C+  I D  Y  +I          N+ ++ C    ++  N  C  Y  L IGRM  +  G  +L+           +  +      KLI+  L+Y+   L R +L  A+ S     R YST+F+ VLLRA++P F  WG+  ++ Q  D DR V  AA ++L EA  D+  +  ++       H+   G +L +R  SLP   +    +  +   +  W+  YN  Y
Sbjct:  656 LSSNELECMRFITD--YFSDISQQLAAVTTSNRAHD-CLFSPQHMNNTMCQQYF-LYIGRMCRTVKGIEVLKNTTVFEYLINLVRVTDHVCYVKLIVSGLNYSYEKLPRQVLEKALTSAKTRGRLYSTQFMAVLLRARLPHFEVWGIPLIINQTRDSDRSVGLAAMDVLEEACHDKYYLEEIVSRWPNLTHRGDAGRLLMARYYSLPRGLNSTMAR--IEDEIRYWRNGYNKRY 883          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Fly
Match: rictor (gene:FBgn0031006 transcript:FBtr0074689)

HSP 1 Score: 88.9669 bits (219), Expect = 4.674e-17
Identity = 65/234 (27.78%), Postives = 105/234 (44.87%), Query Frame = 2
Query: 2120 MYSNLKDCLLSIADEKYIQEIKDNFGF----NKTYEACGIFTEYDLNYKCSSYLILAIGRMSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLY 2809
            + SN  +C+  I D  Y  +I          N+ ++ C    ++  N  C  Y  L IGRM  +  G  +L+           +  +      KLI+  L+Y+   L R +L  A+ S     R YST+F+ VLLRA++P F  WG+  ++ Q  D DR V  AA ++L EA  D+  +  ++       H+   G +L +R  SLP   +    +  +   +  W+  YN  Y
Sbjct:  668 LSSNELECMRFITD--YFSDISQQLAAVTTSNRAHD-CLFSPQHMNNTMCQQYF-LYIGRMCRTVKGIEVLKNTTVFEYLINLVRVTDHVCYVKLIVSGLNYSYEKLPRQVLEKALTSAKTRGRLYSTQFMAVLLRARLPHFEVWGIPLIINQTRDSDRSVGLAAMDVLEEACHDKYYLEEIVSRWPNLTHRGDAGRLLMARYYSLPRGLNSTMAR--IEDEIRYWRNGYNKRY 895          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Fly
Match: rictor (gene:FBgn0031006 transcript:FBtr0343634)

HSP 1 Score: 88.9669 bits (219), Expect = 4.822e-17
Identity = 65/234 (27.78%), Postives = 105/234 (44.87%), Query Frame = 2
Query: 2120 MYSNLKDCLLSIADEKYIQEIKDNFGF----NKTYEACGIFTEYDLNYKCSSYLILAIGRMSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLY 2809
            + SN  +C+  I D  Y  +I          N+ ++ C    ++  N  C  Y  L IGRM  +  G  +L+           +  +      KLI+  L+Y+   L R +L  A+ S     R YST+F+ VLLRA++P F  WG+  ++ Q  D DR V  AA ++L EA  D+  +  ++       H+   G +L +R  SLP   +    +  +   +  W+  YN  Y
Sbjct:  648 LSSNELECMRFITD--YFSDISQQLAAVTTSNRAHD-CLFSPQHMNNTMCQQYF-LYIGRMCRTVKGIEVLKNTTVFEYLINLVRVTDHVCYVKLIVSGLNYSYEKLPRQVLEKALTSAKTRGRLYSTQFMAVLLRARLPHFEVWGIPLIINQTRDSDRSVGLAAMDVLEEACHDKYYLEEIVSRWPNLTHRGDAGRLLMARYYSLPRGLNSTMAR--IEDEIRYWRNGYNKRY 875          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Zebrafish
Match: rictorb (RPTOR independent companion of MTOR, complex 2b [Source:ZFIN;Acc:ZDB-GENE-070810-5])

HSP 1 Score: 129.798 bits (325), Expect = 2.510e-29
Identity = 106/368 (28.80%), Postives = 187/368 (50.82%), Query Frame = 2
Query:  293 LWSDSKLVRTAALRCLRYYVLNVYHVELFLKMRLDFLIMRSLDLSYENAINNQYRNSDDAERIHAMRLLYRLSLISPKLFPFSLINALTVICLSGSDSSGNVLDIAIRPAXXXXXXXXXXYPDFASKNEILYT-LQTVICNQDGKAWRLNFRIIEAVLLTQLKLITHSYWRSTVPIGY-FNKTLTPFSILSKIQSEPIFESGYFGNYVSTQHEFESTSISILLTLFQSWSGLLYLFGSNNKPILSLTGLLAVGCSGIRGRILDLLFQLFNIYRPPNTCTDFVSSLESITEQSTGKNRPVWNLDDEFLVGQCNDCLPHLSGNRINVIDNYQAILLGIFVQCNIFEALESAVADDNELISSRAGILLANI 1390
            L +++K VR A LR LRY + +   ++  L++++D+LI R +D+          + S++ ER  A+RL+ ++  ++  LFP S+ N+L  +   G        D  +R  + I+C+L +  P+  +K   L T L+ VI   D +  R+N    EA++ T L L+ H + R  V       + L P++     +  P    G        +  F ++ +SI+ +L +SWSG++ L  S N  I SL GLL +    +R  +L++++++F +  P  T  DFV +L S+      + +  W L D F+  +    LPH + +R +++DNY A+LL  F+   + E L   +    + +S RA ILL  +
Sbjct:   61 LLNEAKEVRAAGLRSLRYLIRDSNILQKVLRLQVDYLISRCIDI----------QQSNEVERTQALRLVRKMITVNALLFPSSVANSLIAVGNDGPQER----DRMVRACIAIICELALENPEIVAKRGGLSTILKNVI---DCQLSRIN----EALMTTILHLLNHPHTRQYVRSDVELEQILAPYTDF-HYRHNPDTAEGQLKE--DREARFLASKMSIVASL-RSWSGIINLCKSGNSGIQSLIGLLCIPNMEVRRGLLEVMYEIFRLPVPVVT-QDFVEALLSV---DPSRFQDSWRLSDGFVASEAKIILPHRARSRPDLMDNYLALLLSAFIHSGLLEGLVEVITSSEDSVSVRATILLGEL 399          

HSP 2 Score: 113.235 bits (282), Expect = 5.193e-26
Identity = 71/203 (34.98%), Postives = 104/203 (51.23%), Query Frame = 2
Query: 2201 NKTYEACGIFTEYDLNYKCSSYLILAIGRMSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLY 2809
            +++ ++ G+ T    +Y       L +G +S +  G  +LEK                D L KL++ +LDY+R  L R +LS  + +     R Y+TK L+VLLRA V FFS+WG+  L+ QLHD  + V   A +IL EA ED+A ++ LI    A  H    G +L  R LS+P  F  L  +  V   L+ W+K YN  Y
Sbjct:  612 DRSLQSNGLLTTLSQHY------FLFLGTLSANPQGVKMLEKCSVFQCLLNLCSLKNQDHLLKLVVSTLDYSRDGLARVILSKILTAATDNCRLYATKHLRVLLRANVEFFSNWGIELLVTQLHDRSKAVSVEALDILDEACEDKANLHALIHMKPALTHLGDKGVLLLLRFLSIPKGFSYLNERGYVSKQLEKWQKEYNLKY 808          

HSP 3 Score: 26.9498 bits (58), Expect = 5.193e-26
Identity = 26/111 (23.42%), Postives = 48/111 (43.24%), Query Frame = 1
Query: 2851 RISNKIKCKPRDLILLCHPYGSISEHKAGMDILYKRGDLQECLVVI----MDEWNRLRDGDIQNETHTSFLKVDEHELILRSSMLAICHIARSPWGLEFIIEMN-IPLIVS 3168
            R SN+   +P ++ L  H YG +   K G  +L  +  + +    +    +D+W  ++                     L++++ A+ +I  S WGL  + E N IP IV+
Sbjct:  834 RRSNQRLQRP-NVFLPVHLYGQLVHDKTGCHLLEAQNVVSDLSYTVRCPLLDKWEGIKQ--------------------LKAALWALGNIGTSNWGLNLLQEENVIPDIVA 923          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Zebrafish
Match: rictorb (RPTOR independent companion of MTOR, complex 2b [Source:ZFIN;Acc:ZDB-GENE-070810-5])

HSP 1 Score: 129.413 bits (324), Expect = 2.982e-29
Identity = 106/368 (28.80%), Postives = 187/368 (50.82%), Query Frame = 2
Query:  293 LWSDSKLVRTAALRCLRYYVLNVYHVELFLKMRLDFLIMRSLDLSYENAINNQYRNSDDAERIHAMRLLYRLSLISPKLFPFSLINALTVICLSGSDSSGNVLDIAIRPAXXXXXXXXXXYPDFASKNEILYT-LQTVICNQDGKAWRLNFRIIEAVLLTQLKLITHSYWRSTVPIGY-FNKTLTPFSILSKIQSEPIFESGYFGNYVSTQHEFESTSISILLTLFQSWSGLLYLFGSNNKPILSLTGLLAVGCSGIRGRILDLLFQLFNIYRPPNTCTDFVSSLESITEQSTGKNRPVWNLDDEFLVGQCNDCLPHLSGNRINVIDNYQAILLGIFVQCNIFEALESAVADDNELISSRAGILLANI 1390
            L +++K VR A LR LRY + +   ++  L++++D+LI R +D+          + S++ ER  A+RL+ ++  ++  LFP S+ N+L  +   G        D  +R  + I+C+L +  P+  +K   L T L+ VI   D +  R+N    EA++ T L L+ H + R  V       + L P++     +  P    G        +  F ++ +SI+ +L +SWSG++ L  S N  I SL GLL +    +R  +L++++++F +  P  T  DFV +L S+      + +  W L D F+  +    LPH + +R +++DNY A+LL  F+   + E L   +    + +S RA ILL  +
Sbjct:   41 LLNEAKEVRAAGLRSLRYLIRDSNILQKVLRLQVDYLISRCIDI----------QQSNEVERTQALRLVRKMITVNALLFPSSVANSLIAVGNDGPQER----DRMVRACIAIICELALENPEIVAKRGGLSTILKNVI---DCQLSRIN----EALMTTILHLLNHPHTRQYVRSDVELEQILAPYTDF-HYRHNPDTAEGQLKE--DREARFLASKMSIVASL-RSWSGIINLCKSGNSGIQSLIGLLCIPNMEVRRGLLEVMYEIFRLPVPVVT-QDFVEALLSV---DPSRFQDSWRLSDGFVASEAKIILPHRARSRPDLMDNYLALLLSAFIHSGLLEGLVEVITSSEDSVSVRATILLGEL 379          

HSP 2 Score: 113.235 bits (282), Expect = 1.983e-26
Identity = 69/184 (37.50%), Postives = 96/184 (52.17%), Query Frame = 2
Query: 2258 SSYLILAIGRMSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLY 2809
            S +  L +G +S +  G  +LEK                D L KL++ +LDY+R  L R +LS  + +     R Y+TK L+VLLRA V FFS+WG+  L+ QLHD  + V   A +IL EA ED+A ++ LI    A  H    G +L  R LS+P  F  L  +  V   L+ W+K YN  Y
Sbjct:  605 SQHYFLFLGTLSANPQGVKMLEKCSVFQCLLNLCSLKNQDHLLKLVVSTLDYSRDGLARVILSKILTAATDNCRLYATKHLRVLLRANVEFFSNWGIELLVTQLHDRSKAVSVEALDILDEACEDKANLHALIHMKPALTHLGDKGVLLLLRFLSIPKGFSYLNERGYVSKQLEKWQKEYNLKY 788          

HSP 3 Score: 28.1054 bits (61), Expect = 1.983e-26
Identity = 31/107 (28.97%), Postives = 47/107 (43.93%), Query Frame = 1
Query: 2851 RISNKIKCKPRDLILLCHPYGSISEHKAGMDILYKRGDLQECLVVIMDEWNRLRDGDIQNETHTSFLKVDEHELILRSSMLAICHIARSPWGLEFIIEMN-IPLIVS 3168
            R SN+   +P ++ L  H YG +   K G  +L    + Q C VV           D+        L   E    L++++ A+ +I  S WGL  + E N IP IV+
Sbjct:  814 RRSNQRLQRP-NVFLPVHLYGQLVHDKTGCHLL----EAQVCNVV----------SDLSYTVRCPLLDKWEGIKQLKAALWALGNIGTSNWGLNLLQEENVIPDIVA 905          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Zebrafish
Match: rictora (RPTOR independent companion of MTOR, complex 2 a [Source:ZFIN;Acc:ZDB-GENE-060526-49])

HSP 1 Score: 127.102 bits (318), Expect = 1.399e-28
Identity = 105/368 (28.53%), Postives = 188/368 (51.09%), Query Frame = 2
Query:  293 LWSDSKLVRTAALRCLRYYVLNVYHVELFLKMRLDFLIMRSLDLSYENAINNQYRNSDDAERIHAMRLLYRLSLISPKLFPFSLINALTVICLSGSDSSGNVLDIAIRPAXXXXXXXXXXYPDFASKNEILYT-LQTVICNQDGKAWRLNFRIIEAVLLTQLKLITHSYWRSTVPIGY-FNKTLTPFSILSKIQSEPIFESGYFGNYVSTQHEFESTSISILLTLFQSWSGLLYLFGSNNKPILSLTGLLAVGCSGIRGRILDLLFQLFNIYRPPNTCTDFVSSLESITEQSTGKNRPVWNLDDEFLVGQCNDCLPHLSGNRINVIDNYQAILLGIFVQCNIFEALESAVADDNELISSRAGILLANI 1390
            L ++ K VR A LR LRY + +   ++  L++++D+LI R +D+          + S++ ER  A+RL+ ++  ++ +LFP S+ N+L  +   GSD      D  +R  + I+C+L +  P+  ++   L T L+ VI   D +  R+N    EA++ T L L+ H + R  +       + L P++      +    E+    +    +  F ++ ++I+   F+SWSG++ L  S N  + SL GLL +    +R  +L++L+++F +  P  T  DF  +L S+      + +  W L D F+  +    LPH + +R +++DNY A+LL  F+   + E L   V   +  IS RA ILL  +
Sbjct:   79 LLNEVKEVRAAGLRALRYLIRDSSILQKVLQLQVDYLISRCIDI----------QQSNEVERTQALRLVRKMITVNAQLFPSSVTNSLIAV---GSDGLQE-RDRMVRACIAIICELALKNPEVVAQRGGLSTILKNVI---DCQLSRIN----EALITTILHLLNHPHTRQFIRADVELEQILAPYTDFHYRHNPETAEAQIKEDR---EARFLASKMAIVAA-FRSWSGIINLCKSGNSGVQSLIGLLCIPNMDVRKALLEVLYEIFRLPVPLVT-GDFEEALHSV---DPSRFQDSWRLSDGFVAAEAKVILPHRARSRPDLMDNYLALLLSAFINSGLLEGLVEVVTSSDGQISVRATILLGEL 417          

HSP 2 Score: 110.153 bits (274), Expect = 1.641e-26
Identity = 71/202 (35.15%), Postives = 102/202 (50.50%), Query Frame = 2
Query: 2204 KTYEACGIFTEYDLNYKCSSYLILAIGRMSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLY 2809
            ++  + G+ T  + +Y       L +G +S    G  +LEK G              D L KL + +LDY+R  L R +LS  + +     R Y+TK L+VLLRA V FFS+WG+  L+ QLHD ++ +   A +IL EA ED+A ++ LI    A  H    G +L  R LS+P  F  L  +  V   L+ W K YN  Y
Sbjct:  632 RSLHSNGLLTTLNQHY------FLFLGTLSAQPHGVKMLEKCGVFQCLLNLCSMKNQDHLLKLTVSTLDYSRDGLARVILSKILTAATDNCRLYATKHLRVLLRANVEFFSNWGMELLVTQLHDHNKTISMEALDILDEACEDKANLHALIHMKPALSHLGDKGLLLLLRFLSIPKGFSYLNERGYVSKQLEKWLKEYNLKY 827          

HSP 3 Score: 31.9574 bits (71), Expect = 1.641e-26
Identity = 30/124 (24.19%), Postives = 56/124 (45.16%), Query Frame = 1
Query: 2851 RISNKIKCKPRDLILLCHPYGSISEHKAGMDILYKRGDLQECLVVI----MDEWNRLRDGDIQNETHTSFLKVDEHELILRSSMLAICHIARSPWGLEFIIEMN-IPLIVSRLTQFHPSFNVRG 3207
            R SN+   +P ++ L  H YG +   K G  +L  +G + +    +    +D+W  ++                     L++++ A+ +I  S WGL  ++E N IP I++ L Q     ++RG
Sbjct:  853 RRSNQRLQRP-NVFLPVHLYGQLVHDKTGCLLLEAQGVIPDLSYTVRSPVLDKWEGVKQ--------------------LKAALWALGNIGSSNWGLNLLLEENVIPDIIA-LAQHCEVLSIRG 954          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Zebrafish
Match: rictora (RPTOR independent companion of MTOR, complex 2 a [Source:ZFIN;Acc:ZDB-GENE-060526-49])

HSP 1 Score: 127.102 bits (318), Expect = 1.534e-28
Identity = 105/368 (28.53%), Postives = 188/368 (51.09%), Query Frame = 2
Query:  293 LWSDSKLVRTAALRCLRYYVLNVYHVELFLKMRLDFLIMRSLDLSYENAINNQYRNSDDAERIHAMRLLYRLSLISPKLFPFSLINALTVICLSGSDSSGNVLDIAIRPAXXXXXXXXXXYPDFASKNEILYT-LQTVICNQDGKAWRLNFRIIEAVLLTQLKLITHSYWRSTVPIGY-FNKTLTPFSILSKIQSEPIFESGYFGNYVSTQHEFESTSISILLTLFQSWSGLLYLFGSNNKPILSLTGLLAVGCSGIRGRILDLLFQLFNIYRPPNTCTDFVSSLESITEQSTGKNRPVWNLDDEFLVGQCNDCLPHLSGNRINVIDNYQAILLGIFVQCNIFEALESAVADDNELISSRAGILLANI 1390
            L ++ K VR A LR LRY + +   ++  L++++D+LI R +D+          + S++ ER  A+RL+ ++  ++ +LFP S+ N+L  +   GSD      D  +R  + I+C+L +  P+  ++   L T L+ VI   D +  R+N    EA++ T L L+ H + R  +       + L P++      +    E+    +    +  F ++ ++I+   F+SWSG++ L  S N  + SL GLL +    +R  +L++L+++F +  P  T  DF  +L S+      + +  W L D F+  +    LPH + +R +++DNY A+LL  F+   + E L   V   +  IS RA ILL  +
Sbjct:   99 LLNEVKEVRAAGLRALRYLIRDSSILQKVLQLQVDYLISRCIDI----------QQSNEVERTQALRLVRKMITVNAQLFPSSVTNSLIAV---GSDGLQE-RDRMVRACIAIICELALKNPEVVAQRGGLSTILKNVI---DCQLSRIN----EALITTILHLLNHPHTRQFIRADVELEQILAPYTDFHYRHNPETAEAQIKEDR---EARFLASKMAIVAA-FRSWSGIINLCKSGNSGVQSLIGLLCIPNMDVRKALLEVLYEIFRLPVPLVT-GDFEEALHSV---DPSRFQDSWRLSDGFVAAEAKVILPHRARSRPDLMDNYLALLLSAFINSGLLEGLVEVVTSSDGQISVRATILLGEL 437          

HSP 2 Score: 109.383 bits (272), Expect = 2.943e-26
Identity = 72/202 (35.64%), Postives = 104/202 (51.49%), Query Frame = 2
Query: 2204 KTYEACGIFTEYDLNYKCSSYLILAIGRMSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLY 2809
            ++  + G+ T  + +Y       L +G +S    G  +LEK G  +L          D L KL + +LDY+R  L R +LS  + +     R Y+TK L+VLLRA V FFS+WG+  L+ QLHD ++ +   A +IL EA ED+A ++ LI    A  H    G +L  R LS+P  F  L  +  V   L+ W K YN  Y
Sbjct:  652 RSLHSNGLLTTLNQHY------FLFLGTLSAQPHGVKMLEKCGVFHLLN-LCSMKNQDHLLKLTVSTLDYSRDGLARVILSKILTAATDNCRLYATKHLRVLLRANVEFFSNWGMELLVTQLHDHNKTISMEALDILDEACEDKANLHALIHMKPALSHLGDKGLLLLLRFLSIPKGFSYLNERGYVSKQLEKWLKEYNLKY 846          

HSP 3 Score: 31.5722 bits (70), Expect = 2.943e-26
Identity = 32/124 (25.81%), Postives = 57/124 (45.97%), Query Frame = 1
Query: 2851 RISNKIKCKPRDLILLCHPYGSISEHKAGMDILYKRG---DLQECL-VVIMDEWNRLRDGDIQNETHTSFLKVDEHELILRSSMLAICHIARSPWGLEFIIEMN-IPLIVSRLTQFHPSFNVRG 3207
            R SN+   +P ++ L  H YG +   K G  +L  +G   DL   +   ++D+W  ++                     L++++ A+ +I  S WGL  ++E N IP I++ L Q     ++RG
Sbjct:  872 RRSNQRLQRP-NVFLPVHLYGQLVHDKTGCLLLEAQGVIPDLSYTVRSPVLDKWEGVKQ--------------------LKAALWALGNIGSSNWGLNLLLEENVIPDIIA-LAQHCEVLSIRG 973          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Zebrafish
Match: rictorb (RPTOR independent companion of MTOR, complex 2b [Source:ZFIN;Acc:ZDB-GENE-070810-5])

HSP 1 Score: 65.855 bits (159), Expect = 1.258e-10
Identity = 64/231 (27.71%), Postives = 115/231 (49.78%), Query Frame = 2
Query:  293 LWSDSKLVRTAALRCLRYYVLNVYHVELFLKMRLDFLIMRSLDLSYENAINNQYRNSDDAERIHAMRLLYRLSLISPKLFPFSLINALTVICLSGSDSSGNVLDIAIRPAXXXXXXXXXXYPDFASKNEILYT-LQTVICNQDGKAWRLNFRIIEAVLLTQLKLITHSYWRSTVPIGY-FNKTLTPFSILSKIQSEPIFESGYFGNYVSTQHEFESTSISILLTLFQSWSG 979
            L +++K VR A LR LRY + +   ++  L++++D+LI R +D+          + S++ ER  A+RL+ ++  ++  LFP S+ N+L  +   G        D  +R  + I+C+L +  P+  +K   L T L+ VI   D +  R+N    EA++ T L L+ H + R  V       + L P++     +  P    G        +  F ++ +SI+ +L +SWSG
Sbjct:   92 LLNEAKEVRAAGLRSLRYLIRDSNILQKVLRLQVDYLISRCIDI----------QQSNEVERTQALRLVRKMITVNALLFPSSVANSLIAVGNDGPQER----DRMVRACIAIICELALENPEIVAKRGGLSTILKNVI---DCQLSRIN----EALMTTILHLLNHPHTRQYVRSDVELEQILAPYTDF-HYRHNPDTAEGQLKE--DREARFLASKMSIVASL-RSWSG 297          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Xenopus
Match: smarcc1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 [Source:Xenbase;Acc:XB-GENE-5906750])

HSP 1 Score: 109.768 bits (273), Expect = 1.030e-26
Identity = 71/187 (37.97%), Postives = 99/187 (52.94%), Query Frame = 2
Query: 2258 SSYLILAIGRMSVSDIGETILEKIGFVNLFKAFLDY---SRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLY 2809
            S +  L IG +S    G  +LEK    N+F+  L+       D L KL +  LDY+R  L R +LS  + +     R Y+TK L+VLLRA V FFS+WG+  L+ QLHD  + +   A +IL EA ED+A ++ LI    A  H    G +L  R +S+P  F  L  +  V   L+ W+K YN  Y
Sbjct:  656 SQHYFLFIGTLSCHPHGVKMLEK---CNVFQCLLNLCSLKNQDHLLKLAISCLDYSRDGLARVILSKTLTASTDSCRLYATKHLRVLLRANVEFFSNWGIELLVTQLHDKSKNISSEAVDILDEACEDKANLHALIQMKPALSHLGDKGLLLLLRFMSIPKGFSYLNERGYVTKQLEKWQKEYNLKY 839          

HSP 2 Score: 33.4982 bits (75), Expect = 1.030e-26
Identity = 37/122 (30.33%), Postives = 57/122 (46.72%), Query Frame = 1
Query: 2851 RISNKIKCKPRDLILLCHPYGSISEHKAGMDILYKRGDLQECLVVIMDEWNRLRDGDIQNETHTSFLKVDEHELI--LRSSMLAICHIARSPWGLEFIIEMN-IPLIVSRLTQFHPSFNVRG 3207
            R SN+ + +P  + L  H YG +  HK G  +L       E  V  M+E   +R   +           D+ + I  L++++ A+ +I  S WGL  + E N IP IVS L Q     ++RG
Sbjct:  865 RRSNQRQQRPH-VYLPVHLYGQLVYHKTGCHLL-------EVQVRAMNEGYTVRSPSL-----------DKWDGIKQLKAALWALGNIGSSNWGLNLLQEENVIPDIVS-LAQHCDVLSIRG 966          

HSP 3 Score: 119.783 bits (299), Expect = 4.104e-26
Identity = 116/443 (26.19%), Postives = 215/443 (48.53%), Query Frame = 2
Query:  293 LWSDSKLVRTAALRCLRYYVLNVYHVELFLKMRLDFLIMRSLDLSYENAINNQYRNSDDAERIHAMRLLYRLSLISPKLFPFSLINALTVICLSGSDSSGNVLDIAIRPAXXXXXXXXXXYPDFASKNEILYT-LQTVICNQDGKAWRLNFRIIEAVLLTQLKLITHSYWRSTVPIGY-FNKTLTPFSILSKIQSEPIFESGYFGNYVSTQHEFESTSISILLTLFQSWSGLLYLFGSNNKPILSLTGLLAVGCSGIRGRILDLLFQLFNIYRPPNTCTDFVSSLESITEQSTGKNRPVWNLDDEFLVGQCNDCLPHLSGNRINVIDNYQAILLGIFVQCNIFEALESAVADDNELISSRAGILLANISYKVSILLPADHP-----LSSKTNASVLFNNPKSQK-----ALLWIHQVHQLLEHHQFEITPFLTYIIQQHPTIN 1585
            L +++K VR A LR LRY + +   ++  L +++D+LI R +D+          + S++ ER  A+RL+ ++  ++  LFP S+ N L  +   G        D  +R  + ILC+L +L P+  +    L T L+ VI   D +  R+N    EA++ T L L+ H   R  V       + L P++     +  P    G        +  F+++ + I+   F+SW+G++ L    N  I SL G+L +    IR  +L++L+ +F +  P  T  +F  +L S+      + +  W L D F+  +    LPH + +R +++DNY A++L  F+   + E L   +   ++ +S RA I+L  + +  + +LP  H      L +  N +  F+ PK ++     AL  + + H++ +      + +L +I+Q+  T +
Sbjct:   92 LLNEAKEVRAAGLRALRYLIRDSSILQKVLTLKVDYLIARCIDI----------QQSNEVERTQALRLVRKMITVNASLFPSSITNTLIAVGNDGLQER----DRMVRACIAILCELALLNPEVVALRGGLSTILKNVI---DCQLSRIN----EALITTVLHLLNHPDTRQYVRADIELEQILAPYTDF-HYRHNPDTAEGQLKE--DREARFQASKLGIVAA-FRSWAGIISLCKPGNSGIQSLIGVLCIPNMEIRRGLLEVLYDIFRLPLPVVT-KEFTEALLSV---DPSRFQDSWRLSDGFVAAEAKTILPHRARSRPDLMDNYLALVLSAFITNGLLEGLVEVITSSDDDVSVRATIILGELLHIANTILPHSHSHHLHCLPTLMNLAASFDIPKEKRLWASAALNCLKRFHEMKKRGPKPYSLYLDHIVQKAVTTH 505          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Xenopus
Match: smarcc1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 [Source:Xenbase;Acc:XB-GENE-5906750])

HSP 1 Score: 109.768 bits (273), Expect = 1.109e-26
Identity = 71/187 (37.97%), Postives = 99/187 (52.94%), Query Frame = 2
Query: 2258 SSYLILAIGRMSVSDIGETILEKIGFVNLFKAFLDY---SRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLY 2809
            S +  L IG +S    G  +LEK    N+F+  L+       D L KL +  LDY+R  L R +LS  + +     R Y+TK L+VLLRA V FFS+WG+  L+ QLHD  + +   A +IL EA ED+A ++ LI    A  H    G +L  R +S+P  F  L  +  V   L+ W+K YN  Y
Sbjct:  637 SQHYFLFIGTLSCHPHGVKMLEK---CNVFQCLLNLCSLKNQDHLLKLAISCLDYSRDGLARVILSKTLTASTDSCRLYATKHLRVLLRANVEFFSNWGIELLVTQLHDKSKNISSEAVDILDEACEDKANLHALIQMKPALSHLGDKGLLLLLRFMSIPKGFSYLNERGYVTKQLEKWQKEYNLKY 820          

HSP 2 Score: 33.113 bits (74), Expect = 1.109e-26
Identity = 32/124 (25.81%), Postives = 56/124 (45.16%), Query Frame = 1
Query: 2851 RISNKIKCKPRDLILLCHPYGSISEHKAGMDILYKRGDLQECLVVI----MDEWNRLRDGDIQNETHTSFLKVDEHELILRSSMLAICHIARSPWGLEFIIEMN-IPLIVSRLTQFHPSFNVRG 3207
            R SN+ + +P  + L  H YG +  HK G  +L  +  + +    +    +D+W+ ++                     L++++ A+ +I  S WGL  + E N IP IVS L Q     ++RG
Sbjct:  846 RRSNQRQQRPH-VYLPVHLYGQLVYHKTGCHLLEVQNVVPDLSYTVRSPSLDKWDGIKQ--------------------LKAALWALGNIGSSNWGLNLLQEENVIPDIVS-LAQHCDVLSIRG 947          

HSP 3 Score: 119.783 bits (299), Expect = 3.995e-26
Identity = 116/443 (26.19%), Postives = 215/443 (48.53%), Query Frame = 2
Query:  293 LWSDSKLVRTAALRCLRYYVLNVYHVELFLKMRLDFLIMRSLDLSYENAINNQYRNSDDAERIHAMRLLYRLSLISPKLFPFSLINALTVICLSGSDSSGNVLDIAIRPAXXXXXXXXXXYPDFASKNEILYT-LQTVICNQDGKAWRLNFRIIEAVLLTQLKLITHSYWRSTVPIGY-FNKTLTPFSILSKIQSEPIFESGYFGNYVSTQHEFESTSISILLTLFQSWSGLLYLFGSNNKPILSLTGLLAVGCSGIRGRILDLLFQLFNIYRPPNTCTDFVSSLESITEQSTGKNRPVWNLDDEFLVGQCNDCLPHLSGNRINVIDNYQAILLGIFVQCNIFEALESAVADDNELISSRAGILLANISYKVSILLPADHP-----LSSKTNASVLFNNPKSQK-----ALLWIHQVHQLLEHHQFEITPFLTYIIQQHPTIN 1585
            L +++K VR A LR LRY + +   ++  L +++D+LI R +D+          + S++ ER  A+RL+ ++  ++  LFP S+ N L  +   G        D  +R  + ILC+L +L P+  +    L T L+ VI   D +  R+N    EA++ T L L+ H   R  V       + L P++     +  P    G        +  F+++ + I+   F+SW+G++ L    N  I SL G+L +    IR  +L++L+ +F +  P  T  +F  +L S+      + +  W L D F+  +    LPH + +R +++DNY A++L  F+   + E L   +   ++ +S RA I+L  + +  + +LP  H      L +  N +  F+ PK ++     AL  + + H++ +      + +L +I+Q+  T +
Sbjct:   73 LLNEAKEVRAAGLRALRYLIRDSSILQKVLTLKVDYLIARCIDI----------QQSNEVERTQALRLVRKMITVNASLFPSSITNTLIAVGNDGLQER----DRMVRACIAILCELALLNPEVVALRGGLSTILKNVI---DCQLSRIN----EALITTVLHLLNHPDTRQYVRADIELEQILAPYTDF-HYRHNPDTAEGQLKE--DREARFQASKLGIVAA-FRSWAGIISLCKPGNSGIQSLIGVLCIPNMEIRRGLLEVLYDIFRLPLPVVT-KEFTEALLSV---DPSRFQDSWRLSDGFVAAEAKTILPHRARSRPDLMDNYLALVLSAFITNGLLEGLVEVITSSDDDVSVRATIILGELLHIANTILPHSHSHHLHCLPTLMNLAASFDIPKEKRLWASAALNCLKRFHEMKKRGPKPYSLYLDHIVQKAVTTH 486          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Xenopus
Match: smarcc1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 [Source:Xenbase;Acc:XB-GENE-5906750])

HSP 1 Score: 109.768 bits (273), Expect = 1.128e-26
Identity = 71/187 (37.97%), Postives = 99/187 (52.94%), Query Frame = 2
Query: 2258 SSYLILAIGRMSVSDIGETILEKIGFVNLFKAFLDY---SRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLY 2809
            S +  L IG +S    G  +LEK    N+F+  L+       D L KL +  LDY+R  L R +LS  + +     R Y+TK L+VLLRA V FFS+WG+  L+ QLHD  + +   A +IL EA ED+A ++ LI    A  H    G +L  R +S+P  F  L  +  V   L+ W+K YN  Y
Sbjct:  656 SQHYFLFIGTLSCHPHGVKMLEK---CNVFQCLLNLCSLKNQDHLLKLAISCLDYSRDGLARVILSKTLTASTDSCRLYATKHLRVLLRANVEFFSNWGIELLVTQLHDKSKNISSEAVDILDEACEDKANLHALIQMKPALSHLGDKGLLLLLRFMSIPKGFSYLNERGYVTKQLEKWQKEYNLKY 839          

HSP 2 Score: 33.113 bits (74), Expect = 1.128e-26
Identity = 32/124 (25.81%), Postives = 56/124 (45.16%), Query Frame = 1
Query: 2851 RISNKIKCKPRDLILLCHPYGSISEHKAGMDILYKRGDLQECLVVI----MDEWNRLRDGDIQNETHTSFLKVDEHELILRSSMLAICHIARSPWGLEFIIEMN-IPLIVSRLTQFHPSFNVRG 3207
            R SN+ + +P  + L  H YG +  HK G  +L  +  + +    +    +D+W+ ++                     L++++ A+ +I  S WGL  + E N IP IVS L Q     ++RG
Sbjct:  865 RRSNQRQQRPH-VYLPVHLYGQLVYHKTGCHLLEVQNVVPDLSYTVRSPSLDKWDGIKQ--------------------LKAALWALGNIGSSNWGLNLLQEENVIPDIVS-LAQHCDVLSIRG 966          

HSP 3 Score: 119.783 bits (299), Expect = 4.138e-26
Identity = 116/443 (26.19%), Postives = 215/443 (48.53%), Query Frame = 2
Query:  293 LWSDSKLVRTAALRCLRYYVLNVYHVELFLKMRLDFLIMRSLDLSYENAINNQYRNSDDAERIHAMRLLYRLSLISPKLFPFSLINALTVICLSGSDSSGNVLDIAIRPAXXXXXXXXXXYPDFASKNEILYT-LQTVICNQDGKAWRLNFRIIEAVLLTQLKLITHSYWRSTVPIGY-FNKTLTPFSILSKIQSEPIFESGYFGNYVSTQHEFESTSISILLTLFQSWSGLLYLFGSNNKPILSLTGLLAVGCSGIRGRILDLLFQLFNIYRPPNTCTDFVSSLESITEQSTGKNRPVWNLDDEFLVGQCNDCLPHLSGNRINVIDNYQAILLGIFVQCNIFEALESAVADDNELISSRAGILLANISYKVSILLPADHP-----LSSKTNASVLFNNPKSQK-----ALLWIHQVHQLLEHHQFEITPFLTYIIQQHPTIN 1585
            L +++K VR A LR LRY + +   ++  L +++D+LI R +D+          + S++ ER  A+RL+ ++  ++  LFP S+ N L  +   G        D  +R  + ILC+L +L P+  +    L T L+ VI   D +  R+N    EA++ T L L+ H   R  V       + L P++     +  P    G        +  F+++ + I+   F+SW+G++ L    N  I SL G+L +    IR  +L++L+ +F +  P  T  +F  +L S+      + +  W L D F+  +    LPH + +R +++DNY A++L  F+   + E L   +   ++ +S RA I+L  + +  + +LP  H      L +  N +  F+ PK ++     AL  + + H++ +      + +L +I+Q+  T +
Sbjct:   92 LLNEAKEVRAAGLRALRYLIRDSSILQKVLTLKVDYLIARCIDI----------QQSNEVERTQALRLVRKMITVNASLFPSSITNTLIAVGNDGLQER----DRMVRACIAILCELALLNPEVVALRGGLSTILKNVI---DCQLSRIN----EALITTVLHLLNHPDTRQYVRADIELEQILAPYTDF-HYRHNPDTAEGQLKE--DREARFQASKLGIVAA-FRSWAGIISLCKPGNSGIQSLIGVLCIPNMEIRRGLLEVLYDIFRLPLPVVT-KEFTEALLSV---DPSRFQDSWRLSDGFVAAEAKTILPHRARSRPDLMDNYLALVLSAFITNGLLEGLVEVITSSDDDVSVRATIILGELLHIANTILPHSHSHHLHCLPTLMNLAASFDIPKEKRLWASAALNCLKRFHEMKKRGPKPYSLYLDHIVQKAVTTH 505          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Xenopus
Match: smarcc1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 [Source:Xenbase;Acc:XB-GENE-5906750])

HSP 1 Score: 109.768 bits (273), Expect = 1.287e-26
Identity = 71/187 (37.97%), Postives = 99/187 (52.94%), Query Frame = 2
Query: 2258 SSYLILAIGRMSVSDIGETILEKIGFVNLFKAFLDY---SRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLY 2809
            S +  L IG +S    G  +LEK    N+F+  L+       D L KL +  LDY+R  L R +LS  + +     R Y+TK L+VLLRA V FFS+WG+  L+ QLHD  + +   A +IL EA ED+A ++ LI    A  H    G +L  R +S+P  F  L  +  V   L+ W+K YN  Y
Sbjct:  656 SQHYFLFIGTLSCHPHGVKMLEK---CNVFQCLLNLCSLKNQDHLLKLAISCLDYSRDGLARVILSKTLTASTDSCRLYATKHLRVLLRANVEFFSNWGIELLVTQLHDKSKNISSEAVDILDEACEDKANLHALIQMKPALSHLGDKGLLLLLRFMSIPKGFSYLNERGYVTKQLEKWQKEYNLKY 839          

HSP 2 Score: 33.113 bits (74), Expect = 1.287e-26
Identity = 32/124 (25.81%), Postives = 56/124 (45.16%), Query Frame = 1
Query: 2851 RISNKIKCKPRDLILLCHPYGSISEHKAGMDILYKRGDLQECLVVI----MDEWNRLRDGDIQNETHTSFLKVDEHELILRSSMLAICHIARSPWGLEFIIEMN-IPLIVSRLTQFHPSFNVRG 3207
            R SN+ + +P  + L  H YG +  HK G  +L  +  + +    +    +D+W+ ++                     L++++ A+ +I  S WGL  + E N IP IVS L Q     ++RG
Sbjct:  865 RRSNQRQQRPH-VYLPVHLYGQLVYHKTGCHLLEVQNVVPDLSYTVRSPSLDKWDGIKQ--------------------LKAALWALGNIGSSNWGLNLLQEENVIPDIVS-LAQHCDVLSIRG 966          

HSP 3 Score: 119.783 bits (299), Expect = 3.593e-26
Identity = 116/443 (26.19%), Postives = 215/443 (48.53%), Query Frame = 2
Query:  293 LWSDSKLVRTAALRCLRYYVLNVYHVELFLKMRLDFLIMRSLDLSYENAINNQYRNSDDAERIHAMRLLYRLSLISPKLFPFSLINALTVICLSGSDSSGNVLDIAIRPAXXXXXXXXXXYPDFASKNEILYT-LQTVICNQDGKAWRLNFRIIEAVLLTQLKLITHSYWRSTVPIGY-FNKTLTPFSILSKIQSEPIFESGYFGNYVSTQHEFESTSISILLTLFQSWSGLLYLFGSNNKPILSLTGLLAVGCSGIRGRILDLLFQLFNIYRPPNTCTDFVSSLESITEQSTGKNRPVWNLDDEFLVGQCNDCLPHLSGNRINVIDNYQAILLGIFVQCNIFEALESAVADDNELISSRAGILLANISYKVSILLPADHP-----LSSKTNASVLFNNPKSQK-----ALLWIHQVHQLLEHHQFEITPFLTYIIQQHPTIN 1585
            L +++K VR A LR LRY + +   ++  L +++D+LI R +D+          + S++ ER  A+RL+ ++  ++  LFP S+ N L  +   G        D  +R  + ILC+L +L P+  +    L T L+ VI   D +  R+N    EA++ T L L+ H   R  V       + L P++     +  P    G        +  F+++ + I+   F+SW+G++ L    N  I SL G+L +    IR  +L++L+ +F +  P  T  +F  +L S+      + +  W L D F+  +    LPH + +R +++DNY A++L  F+   + E L   +   ++ +S RA I+L  + +  + +LP  H      L +  N +  F+ PK ++     AL  + + H++ +      + +L +I+Q+  T +
Sbjct:   92 LLNEAKEVRAAGLRALRYLIRDSSILQKVLTLKVDYLIARCIDI----------QQSNEVERTQALRLVRKMITVNASLFPSSITNTLIAVGNDGLQER----DRMVRACIAILCELALLNPEVVALRGGLSTILKNVI---DCQLSRIN----EALITTVLHLLNHPDTRQYVRADIELEQILAPYTDF-HYRHNPDTAEGQLKE--DREARFQASKLGIVAA-FRSWAGIISLCKPGNSGIQSLIGVLCIPNMEIRRGLLEVLYDIFRLPLPVVT-KEFTEALLSV---DPSRFQDSWRLSDGFVAAEAKTILPHRARSRPDLMDNYLALVLSAFITNGLLEGLVEVITSSDDDVSVRATIILGELLHIANTILPHSHSHHLHCLPTLMNLAASFDIPKEKRLWASAALNCLKRFHEMKKRGPKPYSLYLDHIVQKAVTTH 505          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Mouse
Match: Rictor (RPTOR independent companion of MTOR, complex 2 [Source:MGI Symbol;Acc:MGI:1926007])

HSP 1 Score: 129.798 bits (325), Expect = 2.395e-29
Identity = 120/438 (27.40%), Postives = 218/438 (49.77%), Query Frame = 2
Query:  293 LWSDSKLVRTAALRCLRYYVLNVYHVELFLKMRLDFLIMRSLDLSYENAINNQYRNSDDAERIHAMRLLYRLSLISPKLFPFSLINALTVICLSGSDSSGNVLDIAIRPAXXXXXXXXXXYPDFASKNEILYT-LQTVICNQDGKAWRLNFRIIEAVLLTQLKLITHSYWRSTVPIGY-FNKTLTPFSILSKIQSEPIFESGYFGNYVSTQHEFESTSISILLTLFQSWSGLLYLFGSNNKPILSLTGLLAVGCSGIRGRILDLLFQLFNIYRPPNTCTDFVSSLESITEQSTGKNRPVWNLDDEFLVGQCNDCLPHLSGNRINVIDNYQAILLGIFVQCNIFEALESAVADDNELISSRAGILLANISYKVSILLPADHP-----LSSKTNASVLFNNPKSQK-----ALLWIHQVHQLLEHHQFEITPFLTYIIQQ 1570
            L +++K VR A LR LRY + +   ++  LK+++D+LI R +D+          + S++ ER  A+RL+ ++  ++  LFP S+ N+L  +   G        D  +R  + I+C+L +  P+  +    L T L+ VI   D +  R+N    EA++ T L L+ H   R  V       + L P++      S P    G        +  F ++ + I+ T F+SW+G++ L    N  I SL G+L +    IR  +L++L+ +F +  P  T  +F+ +L S+     G+ +  W L D F+  +    LPH + +R +++DNY A++L  F++  + E L   + + ++ IS RA ILL  + +  + +LP  H      L +  N +  F+ PK ++     AL  +++ H++ +      +  L +IIQ+
Sbjct:   92 LLNEAKEVRAAGLRALRYLIQDSSILQKVLKLKVDYLIARCIDI----------QQSNEVERTQALRLVRKMITVNASLFPSSVANSLIAVGNDGLQER----DRMVRACIAIICELALQNPEVVALRGGLNTILKNVI---DCQLSRIN----EALITTILHLLNHPKTRQYVRADVELERILAPYTDFHYRHS-PDTAEGQLKE--DREARFLASKMGIIAT-FRSWAGIINLCKPGNSGIQSLIGVLCIPNMEIRRGLLEVLYDIFRLPLPVVT-DEFIEALLSV---DPGRFQDSWRLSDGFVAAEAKTILPHRARSRPDLMDNYLALILSAFIRNGLLEGLVEVITNSDDHISVRATILLGELLHMANTILPHSHSHHLHCLPTLMNMAASFDIPKEKRLRASAALNCLNRFHEMKKRGPKPYSLHLDHIIQK 500          

HSP 2 Score: 112.464 bits (280), Expect = 6.854e-27
Identity = 69/184 (37.50%), Postives = 95/184 (51.63%), Query Frame = 2
Query: 2258 SSYLILAIGRMSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLY 2809
            S +  L IG +S    G  +LEK                D L KL + SLDY+R  L R +LS  + +     R Y+TK L+VLLRA V FF++WG+  L+ QLHD ++ +   A +IL EA ED+A ++ LI    A  H    G +L  R LS+P  F  L  +  V   L+ W K YN+ Y
Sbjct:  656 SQHYFLFIGTLSCHPHGVKMLEKCSVFQCLLNLCSLKNQDHLIKLTVSSLDYSRDGLARVILSKILTAATDACRLYATKHLRVLLRANVEFFNNWGIELLVTQLHDKNKTISSEALDILDEACEDKANLHALIQMKPALSHLGDKGLLLLLRFLSIPKGFSYLNERGYVAKQLEKWHKEYNSKY 839          

HSP 3 Score: 30.8018 bits (68), Expect = 6.854e-27
Identity = 32/121 (26.45%), Postives = 55/121 (45.45%), Query Frame = 1
Query: 2851 RISNKIKCKPRDLILLCHPYGSISEHKAGMDILYKRGDLQECLVVIMDEWNRLRDGDIQNETHTSFLKVDEHELI--LRSSMLAICHIARSPWGLEFIIEMNIPLIVSRLTQFHPSFNVRG 3207
            R SN+   +P  + L  H YG +  HK G  +L       E   +I +  + +R  D+           D+ E I  L++S+ A+ +I  S WGL  + E N+   + +L +     ++RG
Sbjct:  865 RRSNQRLQRPH-VYLPVHLYGQLVHHKTGCHLL-------EVQSIITELCHNVRTPDL-----------DKWEDIKKLKASLWALGNIGSSNWGLNLLQEENVIPDILKLAKQCEVLSIRG 966          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. UniProt/SwissProt
Match: sp|Q6R327|RICTR_HUMAN (Rapamycin-insensitive companion of mTOR OS=Homo sapiens OX=9606 GN=RICTOR PE=1 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 1.539e-28
Identity = 120/438 (27.40%), Postives = 217/438 (49.54%), Query Frame = 2
Query:  293 LWSDSKLVRTAALRCLRYYVLNVYHVELFLKMRLDFLIMRSLDLSYENAINNQYRNSDDAERIHAMRLLYRLSLISPKLFPFSLINALTVICLSGSDSSGNVLDIAIRPAXXXXXXXXXXYPDFASKNEILYT-LQTVICNQDGKAWRLNFRIIEAVLLTQLKLITHSYWRSTVPIGY-FNKTLTPFSILSKIQSEPIFESGYFGNYVSTQHEFESTSISILLTLFQSWSGLLYLFGSNNKPILSLTGLLAVGCSGIRGRILDLLFQLFNIYRPPNTCTDFVSSLESITEQSTGKNRPVWNLDDEFLVGQCNDCLPHLSGNRINVIDNYQAILLGIFVQCNIFEALESAVADDNELISSRAGILLANISYKVSILLPADHP-----LSSKTNASVLFNNPKSQK-----ALLWIHQVHQLLEHHQFEITPFLTYIIQQ 1570
            L +++K VR A LR LRY + +   ++  LK+++D+LI R +D+          + S++ ER  A+RL+ ++  ++  LFP S+ N+L  +   G        D  +R  + I+C+L +  P+  +    L T L+ VI   D +  R+N    EA++ T L L+ H   R  V       + L P++      S P    G        +  F ++ + I+ T F+SW+G++ L    N  I SL G+L +    IR  +L++L+ +F +  P  T  +F+ +L S+     G+ +  W L D F+  +    LPH + +R +++DNY A++L  F++  + E L   + + ++ IS RA ILL  + +  + +LP  H      L +  N +  F+ PK ++     AL  + + H++ +      +  L +IIQ+
Sbjct:   92 LLNEAKEVRAAGLRALRYLIQDSSILQKVLKLKVDYLIARCIDI----------QQSNEVERTQALRLVRKMITVNASLFPSSVTNSLIAVGNDGLQER----DRMVRACIAIICELALQNPEVVALRGGLNTILKNVI---DCQLSRIN----EALITTILHLLNHPKTRQYVRADVELERILAPYTDFHYRHS-PDTAEGQLKE--DREARFLASKMGIIAT-FRSWAGIINLCKPGNSGIQSLIGVLCIPNMEIRRGLLEVLYDIFRLPLPVVT-EEFIEALLSV---DPGRFQDSWRLSDGFVAAEAKTILPHRARSRPDLMDNYLALILSAFIRNGLLEGLVEVITNSDDHISVRATILLGELLHMANTILPHSHSHHLHCLPTLMNMAASFDIPKEKRLRASAALNCLKRFHEMKKRGPKPYSLHLDHIIQK 500          

HSP 2 Score: 111.309 bits (277), Expect = 1.383e-25
Identity = 68/184 (36.96%), Postives = 95/184 (51.63%), Query Frame = 2
Query: 2258 SSYLILAIGRMSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLY 2809
            S +  L IG +S    G  +LEK                D L KL + SLDY+R  L R +LS  + +     R Y+TK L+VLLRA V FF++WG+  L+ QLHD ++ +   A +IL EA ED+A ++ LI    A  H    G +L  R LS+P  F  L  +  V   L+ W + YN+ Y
Sbjct:  656 SQHYFLFIGTLSCHPHGVKMLEKCSVFQCLLNLCSLKNQDHLLKLTVSSLDYSRDGLARVILSKILTAATDACRLYATKHLRVLLRANVEFFNNWGIELLVTQLHDKNKTISSEALDILDEACEDKANLHALIQMKPALSHLGDKGLLLLLRFLSIPKGFSYLNERGYVAKQLEKWHREYNSKY 839          

HSP 3 Score: 30.0314 bits (66), Expect = 1.383e-25
Identity = 28/123 (22.76%), Postives = 52/123 (42.28%), Query Frame = 1
Query: 2851 RISNKIKCKPRDLILLCHPYGSISEHKAGMDILYKRGDLQECLVVI----MDEWNRLRDGDIQNETHTSFLKVDEHELILRSSMLAICHIARSPWGLEFIIEMNIPLIVSRLTQFHPSFNVRG 3207
            R SN+   +P  + L  H YG +  HK G  +L  +  + E    +    +D+W  ++                     L++S+ A+ +I  S WGL  + E N+   + +L +     ++RG
Sbjct:  865 RRSNQRLQRPH-VYLPIHLYGQLVHHKTGCHLLEVQNIITELCRNVRTPDLDKWEEIKK--------------------LKASLWALGNIGSSNWGLNLLQEENVIPDILKLAKQCEVLSIRG 966          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. UniProt/SwissProt
Match: sp|Q6QI06|RICTR_MOUSE (Rapamycin-insensitive companion of mTOR OS=Mus musculus OX=10090 GN=Rictor PE=1 SV=2)

HSP 1 Score: 129.798 bits (325), Expect = 1.675e-28
Identity = 120/438 (27.40%), Postives = 218/438 (49.77%), Query Frame = 2
Query:  293 LWSDSKLVRTAALRCLRYYVLNVYHVELFLKMRLDFLIMRSLDLSYENAINNQYRNSDDAERIHAMRLLYRLSLISPKLFPFSLINALTVICLSGSDSSGNVLDIAIRPAXXXXXXXXXXYPDFASKNEILYT-LQTVICNQDGKAWRLNFRIIEAVLLTQLKLITHSYWRSTVPIGY-FNKTLTPFSILSKIQSEPIFESGYFGNYVSTQHEFESTSISILLTLFQSWSGLLYLFGSNNKPILSLTGLLAVGCSGIRGRILDLLFQLFNIYRPPNTCTDFVSSLESITEQSTGKNRPVWNLDDEFLVGQCNDCLPHLSGNRINVIDNYQAILLGIFVQCNIFEALESAVADDNELISSRAGILLANISYKVSILLPADHP-----LSSKTNASVLFNNPKSQK-----ALLWIHQVHQLLEHHQFEITPFLTYIIQQ 1570
            L +++K VR A LR LRY + +   ++  LK+++D+LI R +D+          + S++ ER  A+RL+ ++  ++  LFP S+ N+L  +   G        D  +R  + I+C+L +  P+  +    L T L+ VI   D +  R+N    EA++ T L L+ H   R  V       + L P++      S P    G        +  F ++ + I+ T F+SW+G++ L    N  I SL G+L +    IR  +L++L+ +F +  P  T  +F+ +L S+     G+ +  W L D F+  +    LPH + +R +++DNY A++L  F++  + E L   + + ++ IS RA ILL  + +  + +LP  H      L +  N +  F+ PK ++     AL  +++ H++ +      +  L +IIQ+
Sbjct:   92 LLNEAKEVRAAGLRALRYLIQDSSILQKVLKLKVDYLIARCIDI----------QQSNEVERTQALRLVRKMITVNASLFPSSVANSLIAVGNDGLQER----DRMVRACIAIICELALQNPEVVALRGGLNTILKNVI---DCQLSRIN----EALITTILHLLNHPKTRQYVRADVELERILAPYTDFHYRHS-PDTAEGQLKE--DREARFLASKMGIIAT-FRSWAGIINLCKPGNSGIQSLIGVLCIPNMEIRRGLLEVLYDIFRLPLPVVT-DEFIEALLSV---DPGRFQDSWRLSDGFVAAEAKTILPHRARSRPDLMDNYLALILSAFIRNGLLEGLVEVITNSDDHISVRATILLGELLHMANTILPHSHSHHLHCLPTLMNMAASFDIPKEKRLRASAALNCLNRFHEMKKRGPKPYSLHLDHIIQK 500          

HSP 2 Score: 112.464 bits (280), Expect = 4.191e-26
Identity = 69/184 (37.50%), Postives = 95/184 (51.63%), Query Frame = 2
Query: 2258 SSYLILAIGRMSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLY 2809
            S +  L IG +S    G  +LEK                D L KL + SLDY+R  L R +LS  + +     R Y+TK L+VLLRA V FF++WG+  L+ QLHD ++ +   A +IL EA ED+A ++ LI    A  H    G +L  R LS+P  F  L  +  V   L+ W K YN+ Y
Sbjct:  656 SQHYFLFIGTLSCHPHGVKMLEKCSVFQCLLNLCSLKNQDHLIKLTVSSLDYSRDGLARVILSKILTAATDACRLYATKHLRVLLRANVEFFNNWGIELLVTQLHDKNKTISSEALDILDEACEDKANLHALIQMKPALSHLGDKGLLLLLRFLSIPKGFSYLNERGYVAKQLEKWHKEYNSKY 839          

HSP 3 Score: 30.8018 bits (68), Expect = 4.191e-26
Identity = 32/121 (26.45%), Postives = 55/121 (45.45%), Query Frame = 1
Query: 2851 RISNKIKCKPRDLILLCHPYGSISEHKAGMDILYKRGDLQECLVVIMDEWNRLRDGDIQNETHTSFLKVDEHELI--LRSSMLAICHIARSPWGLEFIIEMNIPLIVSRLTQFHPSFNVRG 3207
            R SN+   +P  + L  H YG +  HK G  +L       E   +I +  + +R  D+           D+ E I  L++S+ A+ +I  S WGL  + E N+   + +L +     ++RG
Sbjct:  865 RRSNQRLQRPH-VYLPVHLYGQLVHHKTGCHLL-------EVQSIITELCHNVRTPDL-----------DKWEDIKKLKASLWALGNIGSSNWGLNLLQEENVIPDILKLAKQCEVLSIRG 966          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. UniProt/SwissProt
Match: sp|O77203|PIAA_DICDI (Protein pianissimo A OS=Dictyostelium discoideum OX=44689 GN=piaA PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.605e-12
Identity = 52/161 (32.30%), Postives = 79/161 (49.07%), Query Frame = 2
Query: 2279 IGRMSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNG 2761
            +G +S + +G  IL +    +  K   +    D L+ LI+ SLDY      R++L   + S +   R  +TK+L+ LLR+ V  FS+WGV  L++QL+D D  V   +  +L EA +D + +  LI      L     G  L  R LS P   + L   NG
Sbjct:  701 LGTLSSNLLGLEILARNNIFDYIKPLAELPGRDDLSHLIMTSLDYNVNGASRTILQKILTSSSRVVRYLATKYLRFLLRSGVQDFSNWGVELLVQQLNDVDAKVSALSLNVLDEACDDPSCLEVLIDLKPNLLKLGKPGKSLLLRFLSSPKGLENLLQNNG 861          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. TrEMBL
Match: H9XVZ8 (Rictor (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1054.28 bits (2725), Expect = 0.000e+0
Identity = 546/616 (88.64%), Postives = 547/616 (88.80%), Query Frame = 2
Query: 1061 GRILDLLFQLFNIYRPPNTCTDFVSSLESITEQSTGKNRPVWNLDDEFLVGQCNDCLPHLSGNRINVIDNYQAILLGIFVQCNIFEALESAVADDNELISSRAGILLANISYKVSILLPADHPLSSKTNASVLFNNPKSQKALLWIHQVHQLLEHHQFEITPFLTYIIQQHPTINVNDYGVQSKRFLQPANIDEILDSCYLPYLGSANKPSQPSLSQQTSNKNY-------------------------------RVGALLDQIVRYSNIFESINEKAFYDSWDWDLLMVFGRSLVDSKPTLNIDKESLSRVIQVLMKFFTLKATAANSSYSGKNLSIAKFALLPLTWKHSTNAAFVITDIICYLVXXXXXXXXXXXXXXFLIGMYSNLKDCLLSIADEKYIQEIKDNFGFNKTYEACGIFTEYDLNYKCSSYLILAIGRMSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLYCQ 2815
            GRILDLLFQLFNIYRPPNTCTDFVSSLESITEQSTGKNRPVWNLDDEFL                                     ALESAVADDNELISSRAGILLANISYKVSIL PADHPLSSKTNASVLFNNPKSQKALLWIHQVHQLLEHHQFEITPFLTYIIQQHPTINVNDYGVQSKRFLQPANIDEILDSCYLPYLGSANKPSQPSLSQQTSNKNY                               R+GALLDQIVRYSNIFESINEKAFYDSWDWDLLMVFGRSLVDSKPTLNIDKESLSRVIQVLMKFFTLKATAANSSYSGKNLSIAKFALLPLTWKHSTNAAFVITDIICYLVESSKESEISEELNEFLIGMYSNLKDCLLSIADEKYIQEIKDNFGFNKTYEACGIFTEYDLNYKCSSYLILAIGRMSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLYCQ
Sbjct:    1 GRILDLLFQLFNIYRPPNTCTDFVSSLESITEQSTGKNRPVWNLDDEFL-------------------------------------ALESAVADDNELISSRAGILLANISYKVSILFPADHPLSSKTNASVLFNNPKSQKALLWIHQVHQLLEHHQFEITPFLTYIIQQHPTINVNDYGVQSKRFLQPANIDEILDSCYLPYLGSANKPSQPSLSQQTSNKNYEFICLAEALQILEQDSITFREFNEIIHRNQKRIGALLDQIVRYSNIFESINEKAFYDSWDWDLLMVFGRSLVDSKPTLNIDKESLSRVIQVLMKFFTLKATAANSSYSGKNLSIAKFALLPLTWKHSTNAAFVITDIICYLVESSKESEISEELNEFLIGMYSNLKDCLLSIADEKYIQEIKDNFGFNKTYEACGIFTEYDLNYKCSSYLILAIGRMSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLYCQ 579          

HSP 2 Score: 608.216 bits (1567), Expect = 0.000e+0
Identity = 363/370 (98.11%), Postives = 364/370 (98.38%), Query Frame = 2
Query: 4358 TGVLCLGLLGSTRKGADVLLNYDWLTLRSDRFDKWPLLLDAFHNVQQNRSKLRRQFQSTNELGNTLKKKSMFLDEFDKVNINSEQSSAVGYSVFAAPLASDEPIKKTSFALIDDPTFILNMXXXXXXXXXXXXXXXXXRCXXXXXXXXXXHISDGDHQQKLNKFIHHKRDFSGGSASLFNVNTEETSEAFTPHDVLGIATMRKLQTKFRNDLSQKXXXXXXXXXXXXXEPRCCDQMDQSLVGIFSNIRKTXXXXXXXXXXXXXXXFINPRSNLNRYRGLVLPINFNDLIMNIFKTPEERNAERSSYEKVQMWEVSNETGLSLENSIKESSVLEGKESVSLQKSRSITFEESSCVLDIALLGNESTLHYEC 5467
            TGVLCLGLLGSTRKGADVLLNYDWLTLRSDRFDKWPLLLDAFHNVQQNRSK RRQFQSTNELGNTLKKKSMFLDEFDKVNINSEQSSAVGYSVFAAPLASDEPIKKT     +DPTFILNMKKFKIYSKSIDDSIIKSRCTTVTSSSSSTHISDGDHQQKLNKFIHHKRDFSGGSASLFNVNTEETSEAFTPHDVLGIATMRKLQTKFRNDLSQKNTSSVSSYYNNYNEPRCCDQMDQSLVGIFSNIRKTSSCVDKKSRKKKFSSFINPRSNLNRYRGLVLPINFNDLIMNIFKTPEERNAERSSYEKVQMWEVSNETGLSLENSIKESSVLEGKESVSLQKSRSITFEESSCVLDIALLGNESTLHYEC
Sbjct:  725 TGVLCLGLLGSTRKGADVLLNYDWLTLRSDRFDKWPLLLDAFHNVQQNRSKHRRQFQSTNELGNTLKKKSMFLDEFDKVNINSEQSSAVGYSVFAAPLASDEPIKKT-----NDPTFILNMKKFKIYSKSIDDSIIKSRCTTVTSSSSSTHISDGDHQQKLNKFIHHKRDFSGGSASLFNVNTEETSEAFTPHDVLGIATMRKLQTKFRNDLSQKNTSSVSSYYNNYNEPRCCDQMDQSLVGIFSNIRKTSSCVDKKSRKKKFSSFINPRSNLNRYRGLVLPINFNDLIMNIFKTPEERNAERSSYEKVQMWEVSNETGLSLENSIKESSVLEGKESVSLQKSRSITFEESSCVLDIALLGNESTLHYEC 1089          

HSP 3 Score: 368.237 bits (944), Expect = 7.661e-101
Identity = 175/175 (100.00%), Postives = 175/175 (100.00%), Query Frame = 2
Query: 5468 VDKIKPTRSSSDEQNWAGKEIIFIRPRAITDIKEFEKLPKDNRHSGSIGYHVTHFRDAFLFIGDKLPKRIEQRNGLSYHSQDHCVHVYCQSEQVSEEVIEFRQKILKSVSLMLTISSKTKKTEMNLARLKSGQNQLFWIDPCLFSEICILMSLYSFSRLSRQYIQELFLSVPMNQ 5992
            VDKIKPTRSSSDEQNWAGKEIIFIRPRAITDIKEFEKLPKDNRHSGSIGYHVTHFRDAFLFIGDKLPKRIEQRNGLSYHSQDHCVHVYCQSEQVSEEVIEFRQKILKSVSLMLTISSKTKKTEMNLARLKSGQNQLFWIDPCLFSEICILMSLYSFSRLSRQYIQELFLSVPMNQ
Sbjct: 1172 VDKIKPTRSSSDEQNWAGKEIIFIRPRAITDIKEFEKLPKDNRHSGSIGYHVTHFRDAFLFIGDKLPKRIEQRNGLSYHSQDHCVHVYCQSEQVSEEVIEFRQKILKSVSLMLTISSKTKKTEMNLARLKSGQNQLFWIDPCLFSEICILMSLYSFSRLSRQYIQELFLSVPMNQ 1346          

HSP 4 Score: 278.485 bits (711), Expect = 5.084e-72
Identity = 130/130 (100.00%), Postives = 130/130 (100.00%), Query Frame = 1
Query: 2818 VNHNSDDPDENRISNKIKCKPRDLILLCHPYGSISEHKAGMDILYKRGDLQECLVVIMDEWNRLRDGDIQNETHTSFLKVDEHELILRSSMLAICHIARSPWGLEFIIEMNIPLIVSRLTQFHPSFNVRG 3207
            VNHNSDDPDENRISNKIKCKPRDLILLCHPYGSISEHKAGMDILYKRGDLQECLVVIMDEWNRLRDGDIQNETHTSFLKVDEHELILRSSMLAICHIARSPWGLEFIIEMNIPLIVSRLTQFHPSFNVRG
Sbjct:  595 VNHNSDDPDENRISNKIKCKPRDLILLCHPYGSISEHKAGMDILYKRGDLQECLVVIMDEWNRLRDGDIQNETHTSFLKVDEHELILRSSMLAICHIARSPWGLEFIIEMNIPLIVSRLTQFHPSFNVRG 724          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. TrEMBL
Match: C3ZJ41 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_70035 PE=4 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 2.450e-60
Identity = 232/858 (27.04%), Postives = 391/858 (45.57%), Query Frame = 2
Query:  293 LWSDSKLVRTAALRCLRYYVLNVYHVELFLKMRLDFLIMRSLDLSYENAINNQYRNSDDAERIHAMRLLYRLSLISPKLFPFSLINALTVICLSGSDSSGNVLDIAIRPAXXXXXXXXXXYPDFASKNEILYTLQTVICNQDGKAWRLNF-------RIIEAVLLTQLKLITHSYWRSTVPIGYFNKTLTPFSILSKIQSEPIFESGYFGNYVSTQHEFE--STSISILLTLFQSWSGLLYLFGSNNKPILSLTGLLAVGCSGIRGRILDLLFQLFNIYRPPNTCTDFVSSLESITEQSTGKNRPVWNLDDEFLVGQCNDCLPHLSGNRINVIDNYQAILLGIFVQCNIFEALESAVADDNELISSRAGILLANISYKVSILLPAD-----HPLSSKTNASVLFN-----NPKSQKALLWIHQVHQLLEHHQFEITPFLTYIIQQHPTINVNDYGVQSKRFLQPANIDEILDSCYLPYLGSANKPSQPSLSQQTSNKNYRVGALLDQIVRYSNIFESINEKAFYDSWDWDLLMVFGRSLVDSKPTLNIDKESLSRVIQVLMKFFTLKATAANSSYSGKNLSIAKFALLPLTWKHSTNAAFVITDIICYLVXXXXXXXXXXXXXXFLIGMYSNLKDCLLSIADEKYIQEIKDNFGFNKTYEACGIFTEYDLNYKCSSYLILAIGRMSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLY 2809
            L S+ K +R A LR  RY++ +   +EL L++++DFLI R LD++           S+D ER+ A+RL+ ++  +SP LFP SL+N L  +   GS     +L  ++            +  + A  N +      V+    G    LN        RI E+++ T L LI     R  V      + L PF+      +    +S     +++   E    S+ ++I  T+F+SW G++ L   +   + SL G+L +  + +R  I+D+LF +F +  P  T  DF  +L+S ++ ST ++   W L   F+V +    LP    +R N+I+NY  ++L  F+   + E+L   +   +   S RA +LL  + +  + LLP +     H L S  N +  F+       ++  A++ ++++H+L +      + +L  +++    +              PA+              S+++ +Q S  +     N      L Q ++ + +   I ++    SWDWDL+ V  +  V     L  D  + +R ++ L+ F+  K    N  YSG  L  +      LT         V   ++ +L+      +  EE + F+  +   + +CL  + D       KD+          G+F++  L         L IGR+S    GE +LE  G    F +       D L KLI+  LDY++  L R +LS A+ +    +R Y+T FL+VLLRA+VPFF+ WGV FL+ QL+D  +VV   A +IL EA E+EA ++ L+    + LH    G +L  R LS+   F  L   N     LD W K++N  Y
Sbjct:   90 LLSERKEIRAAGLRVFRYFLKDAATMELLLRLKVDFLIARCLDIA----------QSNDGERVQALRLIRKMVYVSPSLFPCSLVNTLVAVGNEGSQERDRLLRASL-----------CVLCELAIHNPL------VVSRCGGVGTILNHILDCHLARINESLMATVLHLINQPQTRCYVRAIELQQMLAPFTDFHYRHNADTPDS-----HINDARETTLLSSKMAI-ATIFRSWPGVVVLCKPDGSGVESLLGVLCIPNNEVRKGIMDILFDIFRLPIPSWT-EDFTVALKS-SDPSTFQD--TWQLSQGFVVEEAKSILPSRMSSRTNLIENYLGLVLSAFLNAGLLESLVEVIRSSDNHNSVRATVLLGELLHMANRLLPHECGQHSHCLPSLVNLAASFDVSAQERQRASTAVMCLNRLHELKKRGPVPHSLYLDQLMRHGHRL--------------PAH--------------SSSRMAQVSREKLAQYLNKDTDETLQQAMKDTQVL--ITKENL--SWDWDLIAVVLKLSVGGPRWL--DDAANARFVRRLVFFYRPK----NLLYSGLKLDSSLVEPRKLT--------IVGCQLMEFLL------DCQEEGHRFVEEVIREVVECLCEVYDG------KDD----------GLFSDQSLQTSVCQDFFLLIGRLSRLQAGEKVLEASGVYQCFMSICGLKGCDLLRKLIIACLDYSKDGLARVVLSKALTAPAESSRLYATSFLRVLLRARVPFFNQWGVEFLVTQLYDKSKVVAMEAIDILDEACEEEANLHALVDMRPSLLHLGDKGAMLLIRFLSISKGFTFLSEVNYTANVLDKWYKSFNKKY 842          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. TrEMBL
Match: K1PHU1 (Rapamycin-insensitive companion of mTOR OS=Crassostrea gigas OX=29159 GN=CGI_10004570 PE=4 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 3.341e-59
Identity = 224/890 (25.17%), Postives = 400/890 (44.94%), Query Frame = 2
Query:  188 VAYLNILVYLSKDLLQEYDN---KGLXXXXXXXXXXXXLWSDSKLVRTAALRCLRYYVLNVYHVELFLKMRLDFLIMRSLDLSYENAINNQYRNSDDAERIHAMRLLYRLSLISPKLFPFSLINALTVICLSGSDSSGNVLDIAIRPAXXXXXXXXXXYPDFASKNEILYTLQTVICNQDGKAWRLNFRIIEAVLLTQLKLITHSYWRSTVPIGY-FNKTLTPFSILS-KIQSEPIFESGYFGNYVSTQHEFESTSISILLTLFQSWSGLLYLFGSNNKPILSLTGLLAVGCSGIRGRILDLLFQLFNIYRPPNTCTDFVSSLESITEQSTGKNRPVWNLDDEFLVGQCNDCLPHLSGNRINVIDNYQAILLGIFVQCNIFEALESAVADDNELISSRAGILLANISYKVSILLPAD--HPLSSKTNASVLFNNP--------KSQKALLWIHQVHQLLEHHQFEITPFLTYIIQQHPTINVNDYGVQSKRFLQPANIDEILDSCYLPYLGSANKPSQPSLSQQTSNKNYRVGALLDQIVRYSNIFESINEKAFYDSWDWDLLMVFGRSLVDSKPTLNIDKESLSRV-IQVLMKFFTLKATAANSSYSGKNLSIAKFALLPLTWKHSTNAAFVITDIICYLVXXXXXXXXXXXXXXFLIGMYSNLKDCLLSIADEKYIQEIKDNFGFNKTYEACGIFTEYDLNYKCSSYLILAIGRMSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLY 2809
            +AYLN LV     L+ +Y N    GL    I   ++  L+ ++K VR A LR LRY++     V+L   + +D+LI+RS+D+S +N +          ERIHA++L+ R+  I+PK     L+  L  I   G+     ++ IA+            L       + IL     + C+Q         RI E+++ T L L+ H   R  +       + L PF+    +  +E + +S    +    +H F ++ ++++ ++ ++WSG++     +   + SL G+L +    IR  IL++LF LF + + P    DF ++L S+      +N   W+L D F+  +    LPH++  R N+I+N+ A+LL  ++   I EAL   +   +  +  RA I+L ++ +  S +LPA+  H      +   L ++P        ++++A+  + ++H + +      + +L  +IQ++    V     Q+K +L+    D +++            P++  + Q   +          Q++   +I            W+WDL+             L   +E + R+  Q+++KFF          Y   N   ++     L + H      V +   C LV+    +E  E     L  + +++  C+  IA ++ + E               + +  ++   CS +  L +GR S + IG+  LEK G        +  +  D+  KL + SL+Y+R    R +L+ A+ S     R Y TKFL+ LLRA+V  FSSWG+  L+ QL+D    V QAA  +L EA + +  +N++I      LH    G +L  R +S    F  L + N +   +  W+K YN  Y
Sbjct: 2781 LAYLNALV----KLVLKYGNDKYSGLSKRDILCCLRLGLFHEAKEVRAAVLRVLRYFLQESETVDLLYSLHIDYLIVRSIDISLDNEV----------ERIHAIKLVRRILQIAPKKLSDLLLYPLVAISNDGTGERDRMVRIALETICETAFVNPELLARCGGISAILRA--ALDCHQYP-------RINESLVATILHLLNHPRTRHFIKFNTDLEQLLAPFTDCHYRFSAESLEQS----SGEEKEHRFAASKMAVI-SIMRTWSGIIRFCRPDASGLQSLVGILYLPYKEIRHGILEILFDLFRL-KIPELTEDFNTALLSVDPSDIQEN---WSLTDGFVAEEGKCILPHMAKIRPNLIENHLALLLSAWIGAGILEALIEVIISSDRQLFVRATIILGDLLHLASTMLPAECTHHNHCLPSLLALASSPDLTSAQTYQAREAIYNLERLHSMKKRGPVPCSLYLDQLIQRNGGRPVG----QTKFYLR-KKYDLLIN----------KSPTEDMIGQAIRD---------SQVIGTKDIVH----------WEWDLIPAI----------LKWPEEKVRRLDDQIILKFFKRLV----HFYKPTNHRFSR-----LEFGHRLGQKMVHSG--CLLVDFLLSTEQDEVQKLAL-DLINDIGGCMSEIAQQRLVPE--------------SVLSPGNVINTCSQFYFLFVGRFSGTIIGDKYLEKTGVYQYLLDIVSIAPQDSFVKLTVSSLNYSRDGNTRPVLAKALCSATESARLYCTKFLRTLLRARVAGFSSWGMELLVNQLYDQSNQVAQAALHVLEEACDIQPCLNSVIKLRPQCLHLGERGVLLLCRFMSTAKGFKMLSDANFILNEVQKWEKTYNVRY 3568          

HSP 2 Score: 40.0466 bits (92), Expect = 3.341e-59
Identity = 28/109 (25.69%), Postives = 52/109 (47.71%), Query Frame = 1
Query: 2881 RDLILLCHPYGSISEHKAGMDILYKRGDLQECLVVIMDEWNRLRDGDIQNETHTSFLKVDEHELILRSSMLAICHIARSPWGLEFIIEMNIPLIVSRLTQFHPSFNVRG 3207
            +D  +  H YG +++HK G  +L +    QEC+         L       E H+     DE  L +++++ A+ HI  S WG+ ++ E  +   + +L +    F++RG
Sbjct: 3602 KDAYVPVHLYGQLTQHKEGFSLLQQ----QECISEFFQCIKCL-------ELHS-----DEDVLKMKTALWAVGHIGTSTWGVTWLEEERLLPEIIKLAEESGVFSIRG 3694          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. TrEMBL
Match: A0A210PEL5 (Rapamycin-insensitive companion of mTOR OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT08698 PE=4 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 2.083e-58
Identity = 237/932 (25.43%), Postives = 421/932 (45.17%), Query Frame = 2
Query:   74 ENCFETTKINLNDGPVFNFVKIFTALSDNKVPLKSENHVAYLNILVYLSKDLLQEYDNKGLXXXXXXXXXXXXLWSDSKLVRTAALRCLRYYVLNVYHVELFLKMRLDFLIMRSLDLSYENAINNQYRNSDDAERIHAMRLLYRLSLISPKLFPFSLINALTVICLSGSDSSGNVLDIAIRPAXXXXXXXXXXYPDFASKNEILYTLQTVICNQDGKAWRLNF------RIIEAVLLTQLKLITHSYWRSTVPIGY-FNKTLTPFSILSKIQSEPIFESGYFGNYVSTQHEFESTSISILLTLFQSWSGLLYLFGSNNKPILSLTGLLAVGCSGIRGRILDLLFQLFNIYRPPNTCTDFVSSLESITEQSTGKNRPVWNLDDEFLVGQCNDCLPHLSGNRINVIDNYQAILLGIFVQCNIFEALESAVADDNELISSRAGILLANISYKVSILLPAD-----HPLSSKTNASVLFNNPKSQK-----ALLWIHQVHQLLEHHQFEITPFLTYIIQQHPTINVNDYGVQ---SKRFLQPANIDEILDSCYLPYLGSANKPSQPSLSQQTSNKNYRVGALLDQIVRYSNIFESINEKAFYDSWDWDLLMVFGRSLVDSKPTLNIDKESLSRVIQVLMKFFTLKATAANSSYSGKNLSIAKFALLPLTWKHSTNAAFVITDIICYLVXXXXXXXXXXXXXXFLIGMYSNLKDCLLSIADEKYIQEIKDNFGFNKTYEACGIFTEYDLNYKCSSYLILAIGRMSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLY 2809
            E+  E  K++L+  P  N  +I T ++  ++ +     + YLN  V L   L ++  + G     I   ++ SL+ ++K VR A LR LRY++ +   ++L  K+ +D+LI+RS+D+  +N +          ERIHA++L+ R++ ++P     SLI  L  I   G+D +    D  +R  L  +C++  L P+  +K           C   G   R         RI E+++ T L L+ H   R  +       + L PF+     +      S + G     ++ F ++ ++I+ ++ +SW G++     +   + SL G+L +    IR  I+++L+ LF +  P  T  +F ++L S+        R  W L D F+  +    LPH++  R N+++N+ A+LL  ++   I +AL   V    + +  R  ILL  + +  S LLP +     H L +    +   N P+ Q+     A+ ++ ++H + +      + +L ++I+       N  G +   SK F Q  N    L+S Y+      NK S   +  QT   +        Q++   + F          +WDWDL+    +  +D +  L  D++ LSR ++ L+ FF  K T               F+ L +  K +T  A       C L+E   E    +    F + + +++  CL  +  +    E               + +  +    CS +  L +G++SV+  G+ +LEK G        +  +  D+  KL +  L Y++    R++L+ A+ +     R Y TKFL+VLLR +VP FS+WG+  L  QL+D  R +  AA  ++ EA E +  +N+LI    + LH    G ++  R +S    F  L + N V   L+ W+K +N  Y
Sbjct:   22 ESGEEGVKLDLSKDPGENIKEILTVVT-VQLHVHKTKKLGYLNAFVKLLYKLGKQ-KSLGYSKQDILCCLRVSLFHEAKEVRAATLRVLRYFIQDGETLDLLYKLHIDYLIVRSIDMCLDNEV----------ERIHAIKLVRRIAQLAPHKLTCSLIYPLVAI---GNDGASE-RDRMVRVCLSTICEIAFLNPELVAK-----------CGGVGSILRAALDCHQYPRINESLVCTILHLLNHPRTRHLIKFNTDLEQLLAPFTDC-HYRYSGAETSDHSGE--DKENRFSASKMAIV-SIMRSWPGIIRFCRPDGSGLQSLVGILYLPYYEIRQGIVEILYDLFRLQIPEWT-DNFSTALLSVDPSMM---RDSWRLTDGFICEEGRSVLPHMAKIRPNLVENHLALLLSAWIGAGILDALVEVVISSEDQLFVRTTILLGQLMHMASTLLPNECSHHSHCLPTLMAMASAANIPQQQQHRACNAVSYLDRLHSMKKRGIVPCSLYLDHLIK-------NMGGRKSPFSKHFHQNKN---RLNSYYI------NKLSSEDMVMQTIKDS--------QVLYTKDNF----------TWDWDLIASILKWPLDKQKKL--DEQMLSRFMKRLIYFF--KPTN------------HLFSRLEVGHKLATKIAHA----GCLLMEFLMECGQEDVKKHF-VDLINDIGQCLSEVGSQHLAAE--------------AVLSPSNTINTCSQFYFLFLGKISVTAKGDKLLEKCGIYQYLLDIVSVAPQDSFVKLTVSCLSYSQEGNCRAILTKALCASTESARMYCTKFLRVLLRVRVPGFSTWGMELLTTQLYDQSRNISLAALGVMEEACEIDTCLNSLIKLRPSCLHLGEKGRLVTCRFMSTSRGFRNLMDANYVSNELEIWEKTFNIKY 849          

HSP 2 Score: 38.891 bits (89), Expect = 2.083e-58
Identity = 30/108 (27.78%), Postives = 51/108 (47.22%), Query Frame = 1
Query: 2884 DLILLCHPYGSISEHKAGMDILYKRGDLQECLVVIMDEWNRLRDGDIQNETHTSFLKVDEHELILRSSMLAICHIARSPWGLEFIIEMNIPLIVSRLTQFHPSFNVRG 3207
            D  L  H YG +++ K G  +L +    QEC   I + +  +R  +         L  DE    L++++ A+ HI  S WG+ ++ E  +   V RL +    F++RG
Sbjct:  884 DAFLPVHLYGQLTQTKEGFQLLRQ----QEC---IEEYFQCIRCQE---------LMTDEDNTKLKTALWAVGHIGSSTWGVNWLDEERLFSEVIRLAEECGVFSIRG 975          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. TrEMBL
Match: X2A9R0 (Uncharacterized protein OS=Capitella teleta OX=283909 PE=4 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 1.402e-56
Identity = 219/852 (25.70%), Postives = 370/852 (43.43%), Query Frame = 2
Query:  299 SDSKLVRTAALRCLRYYVLNVYHVELFLKMRLDFLIMRSLDLSYENAINNQYRNSDDAERIHAMRLLYRLSLISPKLFPFSLINALTVICLSGSDSSGNVLDIAIRPAXXXXXXXXXXYPDFASKNEILYTLQTVICNQDGKAWRLNFRIIEAVLLTQLKLITHSYWRSTVPIGY-FNKTLTPFSILSKIQSEPIFESGYFGNYVSTQH-EFESTSISILLTLFQSWSGLLYLFGSNNKPILSLTGLLAVGCSGIRGRILDLLFQLFNIYRPPNTCTDFVSSLESITEQSTGKNRPVWNLDDEFLVGQCNDCLPHLSGNRINVIDNYQAILLGIFVQCNIFEALESAVADDNELISSRAGILLANISYKVSILLPADH-----------PLSSKTNASVLFNNPKSQKALLWIHQVHQLLEHHQFEITPFLTYIIQQHPTINVNDYGVQSKRFLQPANIDEILDSCYLPYLGSANKPSQPSLSQQTSNKNYRVGALLDQIVRYSNIFESINEKAFYDS--WDWDLLMVFGRSLVDSKPTLNIDKESLSRVIQVLMKFFTLKATAANSSYSGKNLSIAKFALLPLTWKHSTNAAFVITDIICYLVXXXXXXXXXXXXXXFLIGMYSNLKDCLLSIADEKYIQEIKDNFGFNKTYEACGIFTEYDLNYKCSSYLILAIGRMSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLY 2809
            + +K +R A LR LRYY+     V+  +K+ + FLI RSLD+  +N I          ERIHAMRL+  ++ I P  FP  L+  L  I + G+  S  +L I++     +         +    + IL ++         +  R+N    EA+L T L L+ H   R  + +     + L PF+        P  ++     ++  +   F +  ++I  T  +SW G++ L       + SL G L       +  I+D+L+ +F +  P  T  +F  +L S+   +    R  W L + F+  +    LPHL+  R N++DN+ ++LL  F+   + EAL   +   +E  S RA ILL  +++  + ++PA+             L+S    S    N ++  AL  + ++H L +      + FL +++Q     +  D    S R L+    D +L S                      NK + + A    +  ++++  S       D+  WDW LL    +   +S   L  D + + R I+ L+ FF       N  ++   LS  +  L+  +  H  +      +               ++  +FL    +++  CL  + + +   ++  + GF              L + CS +  L +GR S S  GE +LE  G   +          D   KLIL S+DYTR  L R LL+  + S N   R Y+ ++L VLLRA VPFFSSWG+  L  QL+D  + V   A  +L EA E+E  + +L+    + LH    G +L +R +S+P  +  L +   +   LD W++ +N  Y
Sbjct:   84 TSAKEMRAACLRALRYYIQEAEDVDALIKLNIHFLIARSLDICLDNEI----------ERIHAMRLIRHVAHIVPTAFPPVLLPPLVAIVIDGAKESDKMLSISLATLCELALTCPQTVAEVGGISAILRSIL-----DSSQMPRIN----EALLSTILFLLNHPRTRHFIRVNIDLEQMLAPFT--DNHYHRPEGDASKDQAFLEEREGRFTACKMAIA-TCMRSWPGIIRLCRPEGSGLQSLLGALYQPHMDTKKEIMDILYTVFCLPVPKWT-DNFSEALLSVDASAM---RDSWRLIEGFVAEEGLHILPHLARTRSNLVDNHLSLLLATFINAGLLEALVEVITTSHEKTSVRAIILLGELNHMANSIIPAECNQYNLYLPSLVSLASSFQVSAEKRN-RASLALSCLSRMHALKKRGVVPCSLFLNHLMQSVHQRSSED----SSRPLKVTR-DGLLSSI---------------------NKVFMLPAHYCIVTEHTSMINSPAVLLTKDNINWDWHLLCSLLKWPDESMQRL--DDQLVQRFIRRLIFFFK----PTNKLFAAVELSRLEHTLMGCSGMHLVDFLLECNN---------------DDATKFLTEWLTDIAQCLTEVKECRSSLDVLFSPGF--------------LQHTCSQFYFLFLGRCSASPQGEKLLESTGIYQVMLDLCSAGSQDVYVKLILSSMDYTRDGLSRLLLTKGLTSTNESARLYAVQWLHVLLRAHVPFFSSWGLELLNAQLYDQSKAVALEALSVLSEACEEEVNLMSLVRLQPSLLHLGKKGAMLLARFVSVPQGYKFLMDSGLLQTELDKWRQGFNVQY 847          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Cavefish
Match: rictorb (RPTOR independent companion of MTOR, complex 2b [Source:ZFIN;Acc:ZDB-GENE-070810-5])

HSP 1 Score: 111.309 bits (277), Expect = 8.809e-26
Identity = 68/184 (36.96%), Postives = 95/184 (51.63%), Query Frame = 2
Query: 2258 SSYLILAIGRMSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLY 2809
            S +  L +G +S    G  +LEK                D L KL + +LDY+R  L R +LS  + +     R Y+TK L+VLLRA V FFS+WG+  L+ QLHD ++ +   A +IL EA ED+A ++ LI    A  H    G +L  R LS+P  F  L  +  V   L+ W+K YN  Y
Sbjct:  504 SQHYFLFLGTLSAHPNGVKLLEKCSVFQCLLNLCSLKNQDHLLKLTVSTLDYSRDGLARVILSKILTAATDNCRLYATKHLRVLLRANVEFFSNWGIELLVTQLHDRNKAISMEALDILDEACEDKANLHALIQLKPALTHLGDKGVLLLLRFLSIPKGFSYLNERGYVSKQLEKWQKEYNLKY 687          

HSP 2 Score: 27.7202 bits (60), Expect = 8.809e-26
Identity = 28/111 (25.23%), Postives = 49/111 (44.14%), Query Frame = 1
Query: 2851 RISNKIKCKPRDLILLCHPYGSISEHKAGMDILYKRG---DLQECL-VVIMDEWNRLRDGDIQNETHTSFLKVDEHELILRSSMLAICHIARSPWGLEFIIEMN-IPLIVS 3168
            R SN+   +P ++ L  H YG +   K G ++L  +    DL   +   ++D W  ++                     L++++ A+ +I  S WGL  + E N IP IV+
Sbjct:  713 RRSNQRLQRP-NVYLPVHLYGQLVHDKTGCNLLEAQNVVPDLSYTVRSPVLDTWEGIKQ--------------------LKAALWALGNIGTSNWGLNLLQEENVIPDIVT 802          

HSP 3 Score: 93.2041 bits (230), Expect = 3.026e-18
Identity = 84/294 (28.57%), Postives = 146/294 (49.66%), Query Frame = 2
Query:  515 ISPKLFPFSLINALTVICLSGSDSSGNVLDIAIRPAXXXXXXXXXXYPDFASKNEILYT-LQTVICNQDGKAWRLNFRIIEAVLLTQLKLITHSYWRSTVPIGY-FNKTLTPFSILSKIQSEPIFESGYFGNYVSTQHEFESTSISILLTLFQSWSGLLYLFGSNNKPILSLTGLLAVGCSGIRGRILDLLFQLFNIYRPPNTCTDFVSSLESITEQSTGKNRPVWNLDDEFLVGQCNDCLPHLSGNRINVIDNYQAILLGIFVQCNIFEALESAVADDNELISSRAGILLANI 1390
            ++ +LFP S+ N+L  +   G        D  +R  + I+C+L +  P+  ++   L T L+ VI   D +  R+N    EA++ T L L+ H + R  V       + L P++     +  P    G        +  F ++ +SI+ + F+SWSG++ L  S +  I SLTGLL +    +R  +L++L+ +F +  P  T  DF+ +L S+      + +  W L D F+  +    LPH + +R +++DNY A++L  F+   + E L   V   ++ IS RA ILL  +
Sbjct:    4 VNAQLFPSSITNSLIAVGNDGLQER----DRMVRACIAIICELALKNPEIVARRGGLKTILKNVI---DCQLSRIN----EALMTTILHLLNHPHTRQYVRSDVELEQILAPYTDF-HYRHNPDTAEGQLKE--DREARFLASKMSIVAS-FRSWSGIINLCKSGSSGIQSLTGLLCIPNMEVRRGLLEVLYDIFRLPVPVVT-QDFIEALLSV---DPSRFQDSWRLSDGFVASEAKIILPHRARSRPDLMDNYLALVLSAFINSGLLEGLVEVVTSSDDNISVRATILLGEL 278          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Cavefish
Match: rictora (RPTOR independent companion of MTOR, complex 2 a [Source:ZFIN;Acc:ZDB-GENE-060526-49])

HSP 1 Score: 117.087 bits (292), Expect = 1.660e-25
Identity = 70/184 (38.04%), Postives = 97/184 (52.72%), Query Frame = 2
Query: 2258 SSYLILAIGRMSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLY 2809
            S +  L +G +S   +G   +EK G      +       DAL KL + +LDY+R  L R +LS  + + +   R Y+TK L+VLLRA V FFS+WG+  L  QLHD  +VV   A +IL EA E++A ++ LI    A  H    G +L  R LS+P  F  L  +  V   L+ W K YN  Y
Sbjct:  602 SQHYFLFLGTLSAQPLGVKTMEKCGVFQCLLSLCSLKNQDALLKLTVSTLDYSRDGLARVILSKILTAGSDVCRLYATKHLRVLLRANVEFFSNWGIELLAIQLHDLSKVVSMEALDILDEACEEKANLHALIHMKPALTHLGDKGLLLQLRFLSIPKGFSYLNERGYVSKQLEKWSKEYNLKY 785          

HSP 2 Score: 110.153 bits (274), Expect = 1.917e-23
Identity = 95/346 (27.46%), Postives = 175/346 (50.58%), Query Frame = 2
Query:  293 LWSDSKLVRTAALRCLRYYVLNVYHVELFLKMRLDFLIMRSLDLSYENAINNQYRNSDDAERIHAMRLLYRLSLISPKLFPFSLINALTVICLSGSDS--SGNVLDIAIRPAXXXXXXXXXXYPDFASKNEILYTL-QTVICNQDGKAWRLNFRIIEAVLLTQLKLITHSYWRSTVPIGY-FNKTLTPFSILSKIQSEPIFESGYFGNYVSTQHEFESTSISILLTLFQSWSGLLYLFGSNNKPILSLTGLLAVGCSGIRGRILDLLFQLFNIYRPPNTCTDFVSSLESITEQSTGKNRPVWNLDDEFLVGQCNDCLPHLSGNRINVIDNYQAILLGIFVQCNIFE 1318
            L ++ K VR A LR  RY + +   ++  L++++D+LI R +D+          + S++ ER  A+RLL ++  +   LFP S+ N+L  +   G+D    G+ + +A      I+C+L +  P+  +    L TL + V+ +Q         RI EA++ T L L+ H + R  V       + L P++      +    E+    +    +  F ++ ++I+ + F+SWSG++ L  + N  I SL GLL +    +R  +L++L+++F +  P  T TDF  +L+SI      + +  W L D F+  +    LPH + +R +++DNY A++L   +   + E
Sbjct:   55 LLNEVKEVRAAGLRAFRYLIRDKAVLQKLLQLQVDYLISRCIDI----------QQSNEVERTQALRLLRKIIAVDAALFPGSVTNSLVAV---GNDGLHEGDRMVLA---CNAIICELALRNPEVVAGRGGLSTLLKNVLDSQQS-------RINEALITTVLHLLNHPHTRQYVRSDVELEQILAPYTDFHYRHNPDTTEAQLKKDR---EARFLASKMAIVAS-FRSWSGIINLCKAGNSGIQSLIGLLCIPNMEVRKALLEVLYEIFRLPVPMVT-TDFEEALQSI---DPSRLQDSWRLGDGFVAAEAKVILPHRTRSRPDLMDNYLALILSTLINSGLLE 369          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Nematostella
Match: EDO33699 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRE9])

HSP 1 Score: 123.25 bits (308), Expect = 4.631e-28
Identity = 123/454 (27.09%), Postives = 208/454 (45.81%), Query Frame = 2
Query:  305 SKLVRTAALRCLRYYVLNVYHVELFLKMRLDFLIMRSLDLSYENAINNQYRNSDDAERIHAMRLLYRLSLISPKLFPFSLINALTVICL--SGSDSSGNVLDIAIRPAXXXXXXXXXXYPDFASKNEILYT----LQTVICNQ-DGKAWRLNFRIIEAVLLTQLKLITHS----YWRSTVPIGYFNKTLTPFSIL----SKIQSEPIFESGYFGNYVSTQHEFESTSISILLTLFQSWSGLLYLFGSNNKPILSLTGLLAVGCSGIRGRILDLLFQLFNIYRPPNTCTDFVSSLESITEQSTGKNRPVWNLDDEFLVGQCNDCLPHLSGNRINVIDNYQAILLGIFVQCNIFEALESAVADDNELISSRAGILLANISYKVSILLPAD-----HPLSSKTNASVLFNNPKSQK-----ALLWIHQVHQLLEHHQFEITPFLTYIIQQ----HPT 1579
            +K VR A +R LR+   +    E  LK+R+D  I+RS+D    N I N+       ERI A+R + ++  + PK  P SL      +CL  +GSD+S             +    L    + A KN  L +    +  +I N  D +  RLN    EA+++T L L+ +S    Y RS V +      L PF+ L    +   SE +F+          +    ++ ++I+  +F+SWSG++     + K + SL G+  +  S +R  I+D++ Q+F I +   T  DF  +L S+        +  W L + F+  +  D LPH +  R N++ NY A++L  F+   + E L   +   +  IS +A ILL  + +  + LLP +     H L S  N +  F    +++     A+  + ++HQ+ +      + +L  I  Q    HP 
Sbjct:    9 AKEVRAAGVRALRHLFSDKTTFEKMLKVRMDIFIIRSMD----NTIANE------VERIQALRFIRKVVAVCPKSCPMSL-----AVCLVSTGSDNS--------EEPDRLKTACLATLCELAIKNSALASYSGGINAIIRNVLDCQVPRLN----EALMVTLLFLLNNSDSRPYVRSDVGL---EGVLAPFTDLHYRHNADTSEKLFKE-------DREARLRASEMAII-AVFRSWSGIISFCKPDGKGLQSLLGVFCLKNSEVRRGIMDIISQIFRIKQAVWT-DDFNIALMSVDPSVM---QDTWRLQENFVAQEGKDLLPHRATGRTNLVSNYTALVLAAFMNAGLLECLVEVITSSDCFISVQATILLGELLHLANTLLPPECSRHSHCLPSLVNTATSFEVSAAERGRASAAVNCLDRLHQMKKREPVPCSLYLEQIFNQRVSAHPA 420          

HSP 2 Score: 99.7525 bits (247), Expect = 3.287e-26
Identity = 63/198 (31.82%), Postives = 101/198 (51.01%), Query Frame = 2
Query: 2222 GIFTEYDLNYKCSSYLILAIGRMSVS--DIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLY 2809
            G+ +   L    S   IL +GR+S S       +LEK                + L KLI+ SLDY    + R +LS  + + ++ TR Y+T  ++VLLR+KV FF++WG+ FL+ QL+D +  V   A ++L EA EDEA +  L+      LH    G  L +R +++   F  LQ+   ++  L+ W++ +   Y
Sbjct:  559 GVLSSSSLQNTLSRDYILFLGRISCSKNSTSSKLLEKTDIYQYLLEMCSTPGQENLLKLIIASLDYKDTGISRIILSKLLTASSVSTRLYATSHMRVLLRSKVLFFNNWGMEFLVTQLYDTETQVANEAADVLDEACEDEANLQYLVQLRPVLLHLGERGIRLMTRFVAVERGFTYLQSLGYLHVLLEQWRQKFCREY 756          

HSP 3 Score: 39.2762 bits (90), Expect = 3.287e-26
Identity = 28/133 (21.05%), Postives = 59/133 (44.36%), Query Frame = 1
Query: 2809 LPKVNHNSDDPDENRISNKIKCKPRDLILLCHPYGSISEHKAGMDILYKRGDLQECLVVIMDEWNRLRDGDIQNETHTSFLKVDEHELILRSSMLAICHIARSPWGLEFIIEMNIPLIVSRLTQFHPSFNVRG 3207
            L      +D+    R S + K   +D  L  H YG + + K G  +L K  D++ C+  I           ++ +T    +++       ++++ A+ H   S WG+  ++E ++   + R+ +   +F +RG
Sbjct:  768 LTTYTKATDEESYVRRSTRRK-TVKDCFLPPHLYGKLVQKKNGFKLLQKTNDIELCVRTIQT---------LEPDTREKVIEI-------KAALWALGHCGSSNWGITLLMEEDVIPDIVRMAEESENFAIRG 883          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Medaka
Match: rictora (RPTOR independent companion of MTOR complex 2 [Source:NCBI gene;Acc:101161162])

HSP 1 Score: 127.487 bits (319), Expect = 1.001e-28
Identity = 105/368 (28.53%), Postives = 185/368 (50.27%), Query Frame = 2
Query:  293 LWSDSKLVRTAALRCLRYYVLNVYHVELFLKMRLDFLIMRSLDLSYENAINNQYRNSDDAERIHAMRLLYRLSLISPKLFPFSLINALTVICLSGSDSSGNVLDIAIRPAXXXXXXXXXXYPDFASKNEILYT-LQTVICNQDGKAWRLNFRIIEAVLLTQLKLITHSYWRSTVPIGY-FNKTLTPFSILSKIQSEPIFESGYFGNYVSTQHEFESTSISILLTLFQSWSGLLYLFGSNNKPILSLTGLLAVGCSGIRGRILDLLFQLFNIYRPPNTCTDFVSSLESITEQSTGKNRPVWNLDDEFLVGQCNDCLPHLSGNRINVIDNYQAILLGIFVQCNIFEALESAVADDNELISSRAGILLANI 1390
            L +++K VR A LR LRY + +   ++  L++++D+LI R +D+          + S++ ER  A+RL+ ++  ++  LFP S+ N+L  I   G        D  +R A+ I+C+L +  P+  +K   L T L++VI   D +  R+N    EA++ T L L+ H   R  V       + L PF+      +    E     +    +  F S+ ++I+   F+SWSG++ L    N  I SL GLL +    +R  +L++ +++F +  P  T  DF  +L+S+      + +  W L D F+  +    L H + +R +++DNY A +L  F+   + E L   V   ++ +S RA ILL ++
Sbjct:   39 LLNEAKEVRAAGLRALRYLIRDTCVLQKVLRLQVDYLISRCIDI----------QQSNEGERTQALRLVRKIISVNAMLFPTSITNSLIAIGTDGLQER----DRMVRAAIAIVCELALKNPEVVAKRGGLSTILKSVI---DCQLSRIN----EALITTILHLLNHPCTRQYVRTDVELEQILAPFTDFHYRHNADTAEGQIKEDR---EARFLSSRMAIVAA-FRSWSGIINLCKDENSGIQSLIGLLCIPNMEVRKGLLEVFYEIFRLPIPIAT-QDFAEALQSV---DPARFQDTWRLSDGFVAAEAKVVLLHRARSRPDLMDNYLAFVLSAFISSGLLEGLVEVVTSSDDQLSIRATILLGDL 377          

HSP 2 Score: 119.013 bits (297), Expect = 2.793e-28
Identity = 74/184 (40.22%), Postives = 97/184 (52.72%), Query Frame = 2
Query: 2258 SSYLILAIGRMSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLY 2809
            S +  L +G +S    G  +LEK G              DAL KL + +LDY+R  L R +LS  + +     R Y+TK L+VLLRA V FFSSWG+  L+ QLHD  +VV   A +IL EA ED+A ++ LI    A  H    G +L  R LS+P  F  L  +  V   LD W+K YN  Y
Sbjct:  603 SQHYFLFLGTLSPHPQGVKLLEKCGLFQCLLNLCSIKNQDALLKLAVTTLDYSRDGLARVILSKVLTAATDTCRLYATKHLRVLLRAGVEFFSSWGMELLVTQLHDHSKVVSIEALDILDEACEDKANLHALIQLKPAVSHLGDKGLLLLLRFLSIPKGFSYLNERGYVSKQLDKWQKEYNLKY 786          

HSP 3 Score: 28.8758 bits (63), Expect = 2.793e-28
Identity = 29/123 (23.58%), Postives = 50/123 (40.65%), Query Frame = 1
Query: 2851 RISNKIKCKPRDLILLCHPYGSISEHKAGMDILYKRGDLQECLVVI----MDEWNRLRDGDIQNETHTSFLKVDEHELILRSSMLAICHIARSPWGLEFIIEMNIPLIVSRLTQFHPSFNVRG 3207
            R SN+   +P ++ L  H YG +   K G  +L  +  + +    I    +D W  ++                     L++S+ A+ +I  S WGL  + E N+   +  L Q     +VRG
Sbjct:  812 RRSNQRLQRP-NVYLPVHLYGQLVHDKTGCHLLEAQNVVPDLSYTIRSPMLDTWEGIKQ--------------------LKASLWALGNIGSSNWGLNLLQEENVIPDILVLAQHCEVLSVRG 913          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Medaka
Match: rictora (RPTOR independent companion of MTOR complex 2 [Source:NCBI gene;Acc:101161162])

HSP 1 Score: 112.464 bits (280), Expect = 1.920e-26
Identity = 74/187 (39.57%), Postives = 101/187 (54.01%), Query Frame = 2
Query: 2258 SSYLILAIGRMSVSDIGETILEKIGFVNLFKAFLDY---SRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLY 2809
            S +  L +G +S    G  +LEK   + +  + L+       DAL KL + +LDY+R  L R +LS  + +     R Y+TK L+VLLRA V FFSSWG+  L+ QLHD  +VV   A +IL EA ED+A ++ LI    A  H    G +L  R LS+P  F  L  +  V   LD W+K YN  Y
Sbjct:  633 SQHYFLFLGTLSPHPQGVKLLEKCVCIFVICSLLNLCSIKNQDALLKLAVTTLDYSRDGLARVILSKVLTAATDTCRLYATKHLRVLLRAGVEFFSSWGMELLVTQLHDHSKVVSIEALDILDEACEDKANLHALIQLKPAVSHLGDKGLLLLLRFLSIPKGFSYLNERGYVSKQLDKWQKEYNLKY 819          

HSP 2 Score: 28.8758 bits (63), Expect = 1.920e-26
Identity = 29/123 (23.58%), Postives = 50/123 (40.65%), Query Frame = 1
Query: 2851 RISNKIKCKPRDLILLCHPYGSISEHKAGMDILYKRGDLQECLVVI----MDEWNRLRDGDIQNETHTSFLKVDEHELILRSSMLAICHIARSPWGLEFIIEMNIPLIVSRLTQFHPSFNVRG 3207
            R SN+   +P ++ L  H YG +   K G  +L  +  + +    I    +D W  ++                     L++S+ A+ +I  S WGL  + E N+   +  L Q     +VRG
Sbjct:  845 RRSNQRLQRP-NVYLPVHLYGQLVHDKTGCHLLEAQNVVPDLSYTIRSPMLDTWEGIKQ--------------------LKASLWALGNIGSSNWGLNLLQEENVIPDILVLAQHCEVLSVRG 946          

HSP 3 Score: 116.701 bits (291), Expect = 1.676e-25
Identity = 108/413 (26.15%), Postives = 200/413 (48.43%), Query Frame = 2
Query:   86 ETTKINLNDGPVFNFVKIFTALSDNKVPLKSENHVAYLNILVYLSKDLLQEYDNKGLXXXXXXXXXXXXLWSDSKLVRTAALRCLRYYVLNVYHVELFLKMRLDFLIMRSLDLSYENAINNQYRNSDDAERIHAMRLLYRLSLISPKLFPFSLINALTVICLSGSDSSGNVLDIAIRPAXXXXXXXXXXYPDFASKNEILYT-LQTVICNQDGKAWRLNFRIIEAVLLTQLKLITHSYWRSTVPIGY-FNKTLTPFSILSKIQSEPIFESGYFGNYVSTQHEFESTSISILLTLFQSWSGLLYLFGSNNKPILSLTGLLAVGCSGIRGRILDLLFQLFNIYRPPNTCTDFVSSLESITEQSTGKNRPVWNLDDEFLVGQCNDCLPHLSGNRINVIDNYQAILLGIFVQCNIFE 1318
            E   ++L+  P  NF +I   ++     + +   + +LN  + L   +    +  G  +  I   ++ +L +++K VR A LR LRY + +   ++  L++++D+LI R +D+          + S++ ER  A+RL+ ++  ++  LFP S+ N+L  I   G        D  +R A+ I+C+L +  P+  +K   L T L++VI   D +  R+N    EA++ T L L+ H   R  V       + L PF+      +    E     +    +  F S+ ++I +  F+SWSG++ L    N  I SL GLL +    +R  +L++ +++F +  P  T  DF  +L+S+      + +  W L D F+  +    L H + +R +++DNY A +L  F+   + E
Sbjct:   24 ENVPLDLSREPSENFREILQNVAKPH-GVSNMRKLGHLNNFIKLLCSVGHHEEQFGFTYEEIIICLRLALLNEAKEVRAAGLRALRYLIRDTCVLQKVLRLQVDYLISRCIDI----------QQSNEGERTQALRLVRKIISVNAMLFPTSITNSLIAIGTDGLQER----DRMVRAAIAIVCELALKNPEVVAKRGGLSTILKSVI---DCQLSRIN----EALITTILHLLNHPCTRQYVRTDVELEQILAPFTDFHYRHNADTAEGQIKED---REARFLSSRMAI-VAAFRSWSGIINLCKDENSGIQSLIGLLCIPNMEVRKGLLEVFYEIFRLPIPIAT-QDFAEALQSV---DPARFQDTWRLSDGFVAAEAKVVLLHRARSRPDLMDNYLAFVLSAFISSGLLE 406          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Planmine SMEST
Match: SMESG000033571.1 (SMESG000033571.1)

HSP 1 Score: 1246.88 bits (3225), Expect = 0.000e+0
Identity = 635/636 (99.84%), Postives = 635/636 (99.84%), Query Frame = 2
Query:   20 MSDNLFKNNFVKKYKSIKENCFETTKINLNDGPVFNFVKIFTALSDNKVPLKSENHVAYLNILVYLSKDLLQEYDNKGLXXXXXXXXXXXXLWSDSKLVRTAALRCLRYYVLNVYHVELFLKMRLDFLIMRSLDLSYENAINNQYRNSDDAERIHAMRLLYRLSLISPKLFPFSLINALTVICLSGSDSSGNVLDIAIRPAXXXXXXXXXXYPDFASKNEILYTLQTVICNQDGKAWRLNFRIIEAVLLTQLKLITHSYWRSTVPIGYFNKTLTPFSILSKIQSEPIFESGYFGNYVSTQHEFESTSISILLTLFQSWSGLLYLFGSNNKPILSLTGLLAVGCSGIRGRILDLLFQLFNIYRPPNTCTDFVSSLESITEQSTGKNRPVWNLDDEFLVGQCNDCLPHLSGNRINVIDNYQAILLGIFVQCNIFEALESAVADDNELISSRAGILLANISYKVSILLPADHPLSSKTNASVLFNNPKSQKALLWIHQVHQLLEHHQFEITPFLTYIIQQHPTINVNDYGVQSKRFLQPANIDEILDSCYLPYLGSANKPSQPSLSQQTSNKNYRVGALLDQIVRYSNIFESINEKAFYDSWDWDLLMVFGRSLVDSKPTLNIDKESLSRVIQVLMKFF 1927
            MSDNLFKNNFVKKYKSIKENCFETTKINLNDGPVFNFVKIFTALSDNKVPLKSENHVAYLNILVYLSKDLLQEYDNKGLFFISIYSIIKFSLWSDSKLVRTAALRCLRYYVLNVYHVELFLKMRLDFLIMRSLDLSYENAINNQYRNSDDAERIHAMRLLYRLSLISPKLFPFSLINALTVICLSGSDSSGNVLDIAIRPALLILCQLLILYPDFASKNEILYTLQTVICNQDGKAWRLNFRIIEAVLLTQLKLITHSYWRSTVPIGYFNKTLTPFSILSKIQSEPIFESGYFGNYVSTQHEFESTSISILLTLFQSWSGLLYLFGSNNKPILSLTGLLAVGCSGIRGRILDLLFQLFNIYRPPNTCTDFVSSLESITEQSTGKNRPVWNLDDEFLVGQCNDCLPHLSGNRINVIDNYQAILLGIFVQCNIFEALESAVADDNELISSRAGILLANISYKVSILLPADHPLSSKTNASVLFNNPKSQKALLWIHQVHQLLEHHQFEITPFLTYIIQQHPTINVNDYGVQSKRFLQPANIDEILDSCYLPYLGSANKPSQPSLSQQTSNKNYRVGALLDQIVRYSNIFESINEKAFYDSWDWDLLMVFGRSLVDSKPTLNIDKESLSRVIQVLMKF 
Sbjct:    1 MSDNLFKNNFVKKYKSIKENCFETTKINLNDGPVFNFVKIFTALSDNKVPLKSENHVAYLNILVYLSKDLLQEYDNKGLFFISIYSIIKFSLWSDSKLVRTAALRCLRYYVLNVYHVELFLKMRLDFLIMRSLDLSYENAINNQYRNSDDAERIHAMRLLYRLSLISPKLFPFSLINALTVICLSGSDSSGNVLDIAIRPALLILCQLLILYPDFASKNEILYTLQTVICNQDGKAWRLNFRIIEAVLLTQLKLITHSYWRSTVPIGYFNKTLTPFSILSKIQSEPIFESGYFGNYVSTQHEFESTSISILLTLFQSWSGLLYLFGSNNKPILSLTGLLAVGCSGIRGRILDLLFQLFNIYRPPNTCTDFVSSLESITEQSTGKNRPVWNLDDEFLVGQCNDCLPHLSGNRINVIDNYQAILLGIFVQCNIFEALESAVADDNELISSRAGILLANISYKVSILLPADHPLSSKTNASVLFNNPKSQKALLWIHQVHQLLEHHQFEITPFLTYIIQQHPTINVNDYGVQSKRFLQPANIDEILDSCYLPYLGSANKPSQPSLSQQTSNKNYRVGALLDQIVRYSNIFESINEKAFYDSWDWDLLMVFGRSLVDSKPTLNIDKESLSRVIQVLMKFL 636          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Planmine SMEST
Match: SMESG000033570.1 (SMESG000033570.1)

HSP 1 Score: 1006.51 bits (2601), Expect = 0.000e+0
Identity = 553/554 (99.82%), Postives = 553/554 (99.82%), Query Frame = 2
Query: 4358 TGVLCLGLLGSTRKGADVLLNYDWLTLRSDRFDKWPLLLDAFHNVQQNRSKLRRQFQSTNELGNTLKKKSMFLDEFDKVNINSEQSSAVGYSVFAAPLASDEPIKKTSFALIDDPTFILNMXXXXXXXXXXXXXXXXXRCXXXXXXXXXXHISDGDHQQKLNKFIHHKRDFSGGSASLFNVNTEETSEAFTPHDVLGIATMRKLQTKFRNDLSQKXXXXXXXXXXXXXEPRCCDQMDQSLVGIFSNIRKTXXXXXXXXXXXXXXXFINPRSNLNRYRGLVLPINFNDLIMNIFKTPEERNAERSSYEKVQMWEVSNETGLSLENSIKESSVLEGKESVSLQKSRSITFEESSCVLDIALLGNESTLHYECVDKIKPTRSSSDEQNWAGKEIIFIRPRAITDIKEFEKLPKDNRHSGSIGYHVTHFRDAFLFIGDKLPKRIEQRNGLSYHSQDHCVHVYCQSEQVSEEVIEFRQKILKSVSLMLTISSKTKKTEMNLARLKSGQNQLFWIDPCLFSEICILMSLYSFSRLSRQYIQELFLSVPMNQLQDDMKLCL 6019
            TGVLCLGLLGSTRKGADVLLNYDWLTLRSDRFDKWPLLLDAFHNVQQNRSK RRQFQSTNELGNTLKKKSMFLDEFDKVNINSEQSSAVGYSVFAAPLASDEPIKKTSFALIDDPTFILNMKKFKIYSKSIDDSIIKSRCTTVTSSSSSTHISDGDHQQKLNKFIHHKRDFSGGSASLFNVNTEETSEAFTPHDVLGIATMRKLQTKFRNDLSQKNTSSVSSYYNNYNEPRCCDQMDQSLVGIFSNIRKTSSCVDKKSRKKKFSSFINPRSNLNRYRGLVLPINFNDLIMNIFKTPEERNAERSSYEKVQMWEVSNETGLSLENSIKESSVLEGKESVSLQKSRSITFEESSCVLDIALLGNESTLHYECVDKIKPTRSSSDEQNWAGKEIIFIRPRAITDIKEFEKLPKDNRHSGSIGYHVTHFRDAFLFIGDKLPKRIEQRNGLSYHSQDHCVHVYCQSEQVSEEVIEFRQKILKSVSLMLTISSKTKKTEMNLARLKSGQNQLFWIDPCLFSEICILMSLYSFSRLSRQYIQELFLSVPMNQLQDDMKLCL
Sbjct:  322 TGVLCLGLLGSTRKGADVLLNYDWLTLRSDRFDKWPLLLDAFHNVQQNRSKHRRQFQSTNELGNTLKKKSMFLDEFDKVNINSEQSSAVGYSVFAAPLASDEPIKKTSFALIDDPTFILNMKKFKIYSKSIDDSIIKSRCTTVTSSSSSTHISDGDHQQKLNKFIHHKRDFSGGSASLFNVNTEETSEAFTPHDVLGIATMRKLQTKFRNDLSQKNTSSVSSYYNNYNEPRCCDQMDQSLVGIFSNIRKTSSCVDKKSRKKKFSSFINPRSNLNRYRGLVLPINFNDLIMNIFKTPEERNAERSSYEKVQMWEVSNETGLSLENSIKESSVLEGKESVSLQKSRSITFEESSCVLDIALLGNESTLHYECVDKIKPTRSSSDEQNWAGKEIIFIRPRAITDIKEFEKLPKDNRHSGSIGYHVTHFRDAFLFIGDKLPKRIEQRNGLSYHSQDHCVHVYCQSEQVSEEVIEFRQKILKSVSLMLTISSKTKKTEMNLARLKSGQNQLFWIDPCLFSEICILMSLYSFSRLSRQYIQELFLSVPMNQLQDDMKLCL 875          

HSP 2 Score: 365.925 bits (938), Expect = 4.975e-177
Identity = 176/176 (100.00%), Postives = 176/176 (100.00%), Query Frame = 2
Query: 2288 MSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLYCQ 2815
            MSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLYCQ
Sbjct:    1 MSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLYCQ 176          

HSP 3 Score: 278.1 bits (710), Expect = 4.975e-177
Identity = 130/130 (100.00%), Postives = 130/130 (100.00%), Query Frame = 1
Query: 2818 VNHNSDDPDENRISNKIKCKPRDLILLCHPYGSISEHKAGMDILYKRGDLQECLVVIMDEWNRLRDGDIQNETHTSFLKVDEHELILRSSMLAICHIARSPWGLEFIIEMNIPLIVSRLTQFHPSFNVRG 3207
            VNHNSDDPDENRISNKIKCKPRDLILLCHPYGSISEHKAGMDILYKRGDLQECLVVIMDEWNRLRDGDIQNETHTSFLKVDEHELILRSSMLAICHIARSPWGLEFIIEMNIPLIVSRLTQFHPSFNVRG
Sbjct:  192 VNHNSDDPDENRISNKIKCKPRDLILLCHPYGSISEHKAGMDILYKRGDLQECLVVIMDEWNRLRDGDIQNETHTSFLKVDEHELILRSSMLAICHIARSPWGLEFIIEMNIPLIVSRLTQFHPSFNVRG 321          
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Planmine SMEST
Match: SMESG000033570.1 (SMESG000033570.1)

HSP 1 Score: 1006.13 bits (2600), Expect = 0.000e+0
Identity = 570/571 (99.82%), Postives = 570/571 (99.82%), Query Frame = 2
Query: 4358 TGVLCLGLLGSTRKGADVLLNYDWLTLRSDRFDKWPLLLDAFHNVQQNRSKLRRQFQSTNELGNTLKKKSMFLDEFDKVNINSEQSSAVGYSVFAAPLASDEPIKKTSFALIDDPTFILNMXXXXXXXXXXXXXXXXXRCXXXXXXXXXXHISDGDHQQKLNKFIHHKRDFSGGSASLFNVNTEETSEAFTPHDVLGIATMRKLQTKFRNDLSQKXXXXXXXXXXXXXEPRCCDQMDQSLVGIFSNIRKTXXXXXXXXXXXXXXXFINPRSNLNRYRGLVLPINFNDLIMNIFKTPEERNAERSSYEKVQMWEVSNETGLSLENSIKESSVLEGKESVSLQKSRSITFEESSCVLDIALLGNESTLHYECVDKIKPTRSSSDEQNWAGKEIIFIRPRAITDIKEFEKLPKDNRHSGSIGYHVTHFRDAFLFIGDKLPKRIEQRNGLSYHSQDHCVHVYCQSEQVSEEVIEFRQKILKSVSLMLTISSKTKKTEMNLARLKSGQNQLFWIDPCLFSEICILMSLYSFSRLSRQYIQELFLSVPMNQLQDDMKLCLXXXXXXXXXXXXXXTRL 6070
            TGVLCLGLLGSTRKGADVLLNYDWLTLRSDRFDKWPLLLDAFHNVQQNRSK RRQFQSTNELGNTLKKKSMFLDEFDKVNINSEQSSAVGYSVFAAPLASDEPIKKTSFALIDDPTFILNMKKFKIYSKSIDDSIIKSRCTTVTSSSSSTHISDGDHQQKLNKFIHHKRDFSGGSASLFNVNTEETSEAFTPHDVLGIATMRKLQTKFRNDLSQKNTSSVSSYYNNYNEPRCCDQMDQSLVGIFSNIRKTSSCVDKKSRKKKFSSFINPRSNLNRYRGLVLPINFNDLIMNIFKTPEERNAERSSYEKVQMWEVSNETGLSLENSIKESSVLEGKESVSLQKSRSITFEESSCVLDIALLGNESTLHYECVDKIKPTRSSSDEQNWAGKEIIFIRPRAITDIKEFEKLPKDNRHSGSIGYHVTHFRDAFLFIGDKLPKRIEQRNGLSYHSQDHCVHVYCQSEQVSEEVIEFRQKILKSVSLMLTISSKTKKTEMNLARLKSGQNQLFWIDPCLFSEICILMSLYSFSRLSRQYIQELFLSVPMNQLQDDMKLCLEEFSKENKSKSSFSTRL
Sbjct:  322 TGVLCLGLLGSTRKGADVLLNYDWLTLRSDRFDKWPLLLDAFHNVQQNRSKHRRQFQSTNELGNTLKKKSMFLDEFDKVNINSEQSSAVGYSVFAAPLASDEPIKKTSFALIDDPTFILNMKKFKIYSKSIDDSIIKSRCTTVTSSSSSTHISDGDHQQKLNKFIHHKRDFSGGSASLFNVNTEETSEAFTPHDVLGIATMRKLQTKFRNDLSQKNTSSVSSYYNNYNEPRCCDQMDQSLVGIFSNIRKTSSCVDKKSRKKKFSSFINPRSNLNRYRGLVLPINFNDLIMNIFKTPEERNAERSSYEKVQMWEVSNETGLSLENSIKESSVLEGKESVSLQKSRSITFEESSCVLDIALLGNESTLHYECVDKIKPTRSSSDEQNWAGKEIIFIRPRAITDIKEFEKLPKDNRHSGSIGYHVTHFRDAFLFIGDKLPKRIEQRNGLSYHSQDHCVHVYCQSEQVSEEVIEFRQKILKSVSLMLTISSKTKKTEMNLARLKSGQNQLFWIDPCLFSEICILMSLYSFSRLSRQYIQELFLSVPMNQLQDDMKLCLEEFSKENKSKSSFSTRL 892          

HSP 2 Score: 365.54 bits (937), Expect = 3.202e-177
Identity = 176/176 (100.00%), Postives = 176/176 (100.00%), Query Frame = 2
Query: 2288 MSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLYCQ 2815
            MSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLYCQ
Sbjct:    1 MSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILGSLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVNFLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHILFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLYCQ 176          

HSP 3 Score: 278.87 bits (712), Expect = 3.202e-177
Identity = 130/130 (100.00%), Postives = 130/130 (100.00%), Query Frame = 1
Query: 2818 VNHNSDDPDENRISNKIKCKPRDLILLCHPYGSISEHKAGMDILYKRGDLQECLVVIMDEWNRLRDGDIQNETHTSFLKVDEHELILRSSMLAICHIARSPWGLEFIIEMNIPLIVSRLTQFHPSFNVRG 3207
            VNHNSDDPDENRISNKIKCKPRDLILLCHPYGSISEHKAGMDILYKRGDLQECLVVIMDEWNRLRDGDIQNETHTSFLKVDEHELILRSSMLAICHIARSPWGLEFIIEMNIPLIVSRLTQFHPSFNVRG
Sbjct:  192 VNHNSDDPDENRISNKIKCKPRDLILLCHPYGSISEHKAGMDILYKRGDLQECLVVIMDEWNRLRDGDIQNETHTSFLKVDEHELILRSSMLAICHIARSPWGLEFIIEMNIPLIVSRLTQFHPSFNVRG 321          
The following BLAST results are available for this feature:
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
RICTOR3.206e-2927.40RPTOR independent companion of MTOR complex 2 [Sou... [more]
RICTOR3.256e-2927.40RPTOR independent companion of MTOR complex 2 [Sou... [more]
RICTOR1.167e-829.35RPTOR independent companion of MTOR complex 2 [Sou... [more]
RICTOR5.607e-829.94RPTOR independent companion of MTOR complex 2 [Sou... [more]
back to top
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rict-11.059e-1029.46pep chromosome:WBcel235:II:13098250:13116806:-1 ge... [more]
rict-11.095e-1029.46pep chromosome:WBcel235:II:13098249:13116806:-1 ge... [more]
rict-11.707e-831.07pep chromosome:WBcel235:II:13098249:13110236:-1 ge... [more]
back to top
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rictor4.667e-1727.78gene:FBgn0031006 transcript:FBtr0343635[more]
rictor4.674e-1727.78gene:FBgn0031006 transcript:FBtr0074689[more]
rictor4.822e-1727.78gene:FBgn0031006 transcript:FBtr0343634[more]
back to top
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rictorb2.510e-2928.80RPTOR independent companion of MTOR, complex 2b [S... [more]
rictorb2.982e-2928.80RPTOR independent companion of MTOR, complex 2b [S... [more]
rictora1.399e-2828.53RPTOR independent companion of MTOR, complex 2 a [... [more]
rictora1.534e-2828.53RPTOR independent companion of MTOR, complex 2 a [... [more]
rictorb1.258e-1027.71RPTOR independent companion of MTOR, complex 2b [S... [more]
back to top
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
smarcc11.030e-2637.97SWI/SNF related, matrix associated, actin dependen... [more]
smarcc11.109e-2637.97SWI/SNF related, matrix associated, actin dependen... [more]
smarcc11.128e-2637.97SWI/SNF related, matrix associated, actin dependen... [more]
smarcc11.287e-2637.97SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Rictor2.395e-2927.40RPTOR independent companion of MTOR, complex 2 [So... [more]
back to top
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q6R327|RICTR_HUMAN1.539e-2827.40Rapamycin-insensitive companion of mTOR OS=Homo sa... [more]
sp|Q6QI06|RICTR_MOUSE1.675e-2827.40Rapamycin-insensitive companion of mTOR OS=Mus mus... [more]
sp|O77203|PIAA_DICDI1.605e-1232.30Protein pianissimo A OS=Dictyostelium discoideum O... [more]
back to top
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H9XVZ87.661e-10188.64Rictor (Fragment) OS=Schmidtea mediterranea OX=793... [more]
C3ZJ412.450e-6027.04Uncharacterized protein OS=Branchiostoma floridae ... [more]
K1PHU13.341e-5925.17Rapamycin-insensitive companion of mTOR OS=Crassos... [more]
A0A210PEL52.083e-5825.43Rapamycin-insensitive companion of mTOR OS=Mizuhop... [more]
X2A9R01.402e-5625.70Uncharacterized protein OS=Capitella teleta OX=283... [more]
back to top
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rictorb8.809e-2636.96RPTOR independent companion of MTOR, complex 2b [S... [more]
rictora1.660e-2538.04RPTOR independent companion of MTOR, complex 2 a [... [more]
back to top
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO336994.631e-2827.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rictora1.001e-2828.53RPTOR independent companion of MTOR complex 2 [Sou... [more]
rictora1.920e-2639.57RPTOR independent companion of MTOR complex 2 [Sou... [more]
back to top
BLAST of RPTOR independent companion of MTOR, complex 2 a vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000033571.10.000e+099.84SMESG000033571.1[more]
SMESG000033570.14.975e-17799.82SMESG000033570.1[more]
SMESG000033570.13.202e-17799.82SMESG000033570.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014131 ID=SMED30014131|Name=RPTOR independent companion of MTOR, complex 2 a|organism=Schmidtea mediterranea sexual|type=transcript|length=6177bp
GAAAAACTTTCAAATTCCAATGTCTGATAATCTATTTAAAAATAATTTTG
TGAAAAAATATAAAAGTATTAAAGAAAACTGCTTTGAAACTACCAAAATC
AATTTAAATGATGGCCCAGTATTTAACTTTGTAAAAATATTTACTGCCCT
ATCTGACAATAAAGTTCCGTTAAAATCGGAAAATCATGTGGCTTATTTAA
ATATATTAGTATATTTAAGTAAGGATTTGTTACAAGAATATGACAACAAA
GGCCTTTTTTTTATATCAATATATTCAATAATCAAATTTAGTCTTTGGAG
TGATTCTAAATTGGTAAGAACAGCAGCATTAAGATGTCTCAGATACTATG
TACTCAACGTCTATCATGTGGAATTATTTTTAAAGATGAGATTAGACTTT
TTAATTATGAGGAGTTTAGATTTATCATATGAAAATGCAATTAATAACCA
ATACCGTAATAGCGATGACGCTGAACGGATTCATGCAATGAGATTGTTGT
ATAGGTTGAGTTTAATTTCGCCAAAACTTTTCCCTTTCAGCTTGATCAAC
GCGCTCACTGTTATTTGCTTATCAGGTTCCGATTCCAGCGGAAATGTTCT
CGACATTGCTATTCGACCGGCCCTGTTGATACTGTGCCAGTTATTAATCC
TCTATCCAGATTTTGCTTCAAAAAATGAAATTTTATATACCCTTCAAACA
GTAATTTGTAATCAAGATGGAAAAGCGTGGCGTCTCAATTTTCGAATTAT
CGAAGCAGTATTACTGACCCAATTAAAACTCATAACCCATTCATATTGGA
GAAGCACAGTACCCATAGGATACTTCAATAAAACATTGACACCATTTTCA
ATCTTATCGAAAATTCAATCAGAACCAATATTTGAATCGGGATATTTTGG
AAATTATGTAAGTACTCAGCATGAATTTGAAAGCACTTCTATTTCAATTC
TGTTAACTCTTTTCCAATCGTGGTCAGGTTTACTGTATTTATTTGGTTCA
AATAACAAGCCTATTCTAAGTTTGACTGGCCTGTTGGCTGTTGGGTGTAG
TGGTATTCGAGGAAGAATACTGGATTTACTGTTCCAGTTATTCAATATCT
ACAGACCTCCAAACACTTGCACTGATTTTGTGAGCTCTCTCGAATCCATC
ACTGAACAGAGCACTGGAAAAAATAGACCAGTTTGGAATTTGGATGATGA
ATTTCTAGTTGGTCAATGTAATGATTGCCTACCTCATTTATCAGGGAATC
GGATTAATGTCATAGATAATTACCAGGCTATATTGTTAGGGATTTTTGTG
CAATGCAATATATTTGAGGCCTTAGAGAGTGCTGTTGCTGATGACAACGA
GTTAATCTCGTCTCGCGCTGGAATATTATTGGCTAATATTTCTTATAAGG
TGTCAATTTTATTGCCGGCTGATCATCCTTTGAGTAGCAAAACCAATGCA
AGCGTTTTATTCAACAATCCAAAATCTCAAAAGGCTTTATTATGGATACA
TCAAGTTCATCAATTACTCGAACATCATCAATTTGAGATAACACCATTTT
TAACTTATATTATTCAGCAGCACCCCACAATTAATGTTAATGATTATGGA
GTTCAATCAAAAAGGTTTCTGCAGCCAGCCAATATTGATGAGATTCTAGA
TAGTTGTTATTTACCTTACTTAGGATCGGCTAATAAACCATCTCAGCCTT
CATTATCTCAGCAAACCTCAAATAAAAATTACAGAGTTGGAGCACTATTA
GATCAAATTGTTCGTTACAGCAATATTTTTGAGTCTATAAATGAGAAAGC
ATTTTATGATTCATGGGATTGGGATTTACTAATGGTATTCGGTCGGTCAT
TAGTTGATTCCAAACCAACTTTAAACATTGATAAAGAATCACTTTCTAGA
GTGATTCAAGTTTTAATGAAATTTTTTACATTAAAAGCAACGGCAGCTAA
TTCATCCTATAGTGGCAAAAATCTGTCCATTGCCAAATTTGCATTATTGC
CACTGACATGGAAACATTCTACAAATGCTGCATTTGTTATTACAGATATT
ATATGCTATTTAGTCGAAAGTTCCAAGGAATCTGAAATCAGCGAAGAACT
GAATGAATTTTTAATTGGTATGTATTCCAATCTGAAAGATTGTCTTCTAT
CTATTGCCGATGAAAAGTATATACAAGAAATAAAAGATAATTTTGGTTTC
AATAAGACTTATGAGGCGTGTGGAATATTCACTGAATATGATCTAAATTA
CAAATGCAGCTCATATTTGATTCTCGCCATTGGAAGGATGAGTGTTTCGG
ATATCGGAGAAACTATACTTGAGAAAATTGGTTTTGTGAATTTATTTAAA
GCGTTTTTGGATTATTCAAGAAGTGATGCATTAACGAAATTAATTCTCGG
AAGTTTGGATTACACTAGACCTTCGCTAGGCAGAAGCCTTCTATCAATTG
CTATTAGATCGGATAATTTGTGGACCAGGCGTTATTCAACAAAATTTCTC
AAAGTTTTACTTAGAGCTAAAGTTCCATTTTTCTCCAGTTGGGGAGTTAA
TTTTCTTATGAAACAATTACACGATTGCGATCGTGTTGTAAAACAAGCAG
CATATGAAATTCTTATGGAAGCCAGTGAGGATGAAGCGGTTGTAAATAAT
CTAATAATTGAATCTATTGCTACATTGCATCAAGATTTTTTTGGGCATAT
ACTATTTTCTCGATTGCTATCACTTCCTTCTCATTTTGATAAATTACAAA
ATAAAAACGGAGTGTATTTCTTTTTAGACAATTGGAAAAAAAATTATAAC
ACATTATATTGCCAAAAGTTAATCATAACTCTGATGATCCTGACGAAAAT
AGAATATCTAATAAAATTAAATGCAAACCGAGAGACCTGATACTTCTTTG
TCATCCTTATGGTTCGATATCGGAACATAAAGCAGGCATGGATATACTTT
ATAAAAGGGGTGATCTTCAAGAATGTTTGGTTGTTATTATGGATGAGTGG
AATAGATTACGTGATGGTGATATTCAAAATGAAACTCATACGAGTTTTCT
CAAAGTTGATGAGCACGAACTTATTTTACGTTCAAGTATGCTGGCAATAT
GTCACATAGCTCGAAGTCCATGGGGTCTAGAGTTCATAATCGAAATGAAT
ATACCTTTGATAGTTTCAAGGTTGACACAGTTTCACCCTAGTTTTAATGT
CAGAGGGTAATTTTTACATTGAACTATTTATAATCTTTATAACATCATGT
TTCTTTAAAATATTATAAATAAATGACACTCAAAACTAACTTCATGTTTA
TAATTTCAAGTAAATGTGCTATCATTATAACTTCTAAATACTCGAAAACT
ATTTCAAGTTTCACTGGATTTGAACCACTGGACGTTGGAATTGGTTACTC
CCATTATTCCATTCAAAATTTTAAACCTTCGCCATTGAAAATGTAATAGT
GGATTTATGTTTTCTTTTGGACATTATCAGTTTTCTATTATAAATATTGG
CAGTTTTTGACCTTCAATTGCAATGGGTTTTCATAGATCGATTGTTTAAG
TTGTAACAGCTCTTTATTTTATATCATTTTCATGTAATTGGTATAAATGT
TCAATAATTTTCTTTGTTAATATATTTCGTTGACATCATTCTAGGAGAAA
TAAATAAAATAAGAACAAAATTGAGATCGAGAATTAGTTTTTTCAAATGG
AGAAATAAAGGTACGAAATATGAAAATATGGCGAGTCTTTAAATAATAAC
TAAATCATCTGTCTAAAATATCATGGAACATGGCCAAAACCAAAACTAAT
AACATTTCATCAAGTTAAAGAAGTGTATTCCAATGATAGAAGGTGTATAT
GCAAACGAATTGACTGCTGGTTGTTATTTGATTTGTGAAGAGGAATGCCA
TGATTGTGGAACCTATGTTGTAGAAACAGCAGTACCCTGCAGAATGAAAA
GACAGTGTCAACCTGTGAAAAGGTATGGTTTGGTTAATCGATTCAAACAA
AATAAATATATTAAAATCACCAGTAAACAACCCGGAAAATGTTATCAAAC
TTAATATATATCAACTCACCAATTAAAAATAGTGATAATAACTCTTTGAC
AAGATAGTTCCGAAAATTCGTGTTAGGTAGAATTTAAAGATAAATTAAAC
TCTAAAAGAAAAAATAAAATCAGATCAAAAGTGAATAAAGATATCAATGA
TCTTACGGATGTCATCATTTTTATTTCCTTATTCTTAACGCTCTGTTAGA
ATTGATTCCTGCAGTTTCAAAACCAATTATTATGTAGCTTAAACACAGCA
GATTCCTCATTGCTGATGCAGACTGATAAAAAAATAAATTGAAAATATGT
GTTTAGAACTGGAGTTTTGTGCTTGGGTCTTCTGGGGTCTACTCGAAAAG
GTGCCGATGTTCTATTAAATTACGATTGGCTTACTCTAAGAAGTGACAGA
TTTGACAAGTGGCCGTTGTTGTTAGATGCCTTTCACAATGTCCAGCAGAA
TCGGTCTAAACTTAGACGTCAATTTCAATCTACAAATGAACTGGGAAACA
CATTAAAAAAGAAGTCCATGTTTTTAGATGAATTCGACAAAGTAAATATT
AATTCAGAACAAAGTTCTGCAGTCGGTTATTCTGTATTTGCTGCTCCGTT
AGCATCAGACGAGCCTATAAAGAAAACTAGTTTCGCATTAATTGATGATC
CAACCTTTATATTAAATATGAAGAAATTCAAGATTTATTCTAAATCTATT
GATGACTCGATAATAAAATCACGGTGTACGACAGTCACCAGTAGCTCCTC
CAGTACACACATTTCAGATGGAGATCATCAACAAAAGTTGAACAAATTTA
TTCACCACAAAAGGGATTTTTCTGGAGGTTCCGCAAGCTTATTTAATGTT
AATACAGAAGAAACATCTGAAGCGTTTACACCTCACGATGTACTTGGAAT
AGCTACGATGAGAAAATTACAAACAAAATTTCGAAATGATTTATCCCAGA
AGAACACTTCTAGTGTTTCTAGTTATTATAACAATTACAATGAACCACGC
TGTTGTGATCAAATGGATCAGAGTTTGGTTGGAATTTTTTCCAATATTAG
GAAAACATCAAGTTGTGTGGATAAGAAAAGCCGAAAAAAGAAGTTCTCCA
GTTTCATTAATCCCAGGAGTAATCTAAATAGATATCGTGGATTGGTTCTA
CCAATTAATTTTAATGATTTAATAATGAACATTTTTAAAACACCTGAAGA
AAGAAACGCTGAACGAAGCAGCTATGAAAAAGTTCAAATGTGGGAAGTTT
CTAACGAAACAGGTTTAAGTCTGGAAAATTCAATAAAGGAAAGTAGTGTG
TTGGAAGGAAAAGAATCAGTATCACTGCAAAAATCTAGATCTATTACCTT
TGAAGAGTCGTCTTGTGTATTAGATATCGCCTTGCTTGGAAATGAATCTA
CTCTTCATTACGAATGTGTCGATAAAATTAAACCGACTCGATCTAGTAGT
GATGAACAAAATTGGGCTGGTAAAGAAATCATATTTATCCGACCTCGAGC
AATTACAGATATAAAGGAATTTGAAAAATTACCAAAGGACAATAGACATT
CAGGATCCATTGGGTATCATGTCACTCATTTCCGTGACGCATTCCTTTTC
ATTGGTGATAAACTACCAAAGCGAATTGAACAACGGAATGGTTTAAGCTA
TCACAGTCAGGATCATTGTGTGCATGTTTACTGTCAGTCTGAACAAGTCA
GTGAAGAAGTTATTGAATTTCGCCAAAAGATTCTGAAATCAGTGAGTCTC
ATGCTTACAATTAGCTCGAAAACAAAAAAAACTGAAATGAATCTTGCAAG
ATTAAAAAGTGGGCAAAATCAATTATTTTGGATAGATCCTTGCTTGTTCT
CTGAAATTTGTATACTTATGAGTTTGTATAGCTTTTCCAGGCTATCTAGA
CAATATATTCAAGAATTATTTCTTTCAGTTCCAATGAACCAACTTCAAGA
TGATATGAAATTATGTTTGGAGGAATTTTCCAAAGAAAATAAGAGTAAAT
CTTCATTCTCTACCAGACTCTAATCTATAACAATTGTTTTGTCACAATAT
TCGTCTTCATGTATAAAATATTGTAGTAACAACGAATGGAGATATTCTTT
GTTTTTTAACACGTGATGATTATTTAC
back to top

protein sequence of SMED30014131-orf-1

>SMED30014131-orf-1 ID=SMED30014131-orf-1|Name=SMED30014131-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=963bp
KNFQIPMSDNLFKNNFVKKYKSIKENCFETTKINLNDGPVFNFVKIFTAL
SDNKVPLKSENHVAYLNILVYLSKDLLQEYDNKGLFFISIYSIIKFSLWS
DSKLVRTAALRCLRYYVLNVYHVELFLKMRLDFLIMRSLDLSYENAINNQ
YRNSDDAERIHAMRLLYRLSLISPKLFPFSLINALTVICLSGSDSSGNVL
DIAIRPALLILCQLLILYPDFASKNEILYTLQTVICNQDGKAWRLNFRII
EAVLLTQLKLITHSYWRSTVPIGYFNKTLTPFSILSKIQSEPIFESGYFG
NYVSTQHEFESTSISILLTLFQSWSGLLYLFGSNNKPILSLTGLLAVGCS
GIRGRILDLLFQLFNIYRPPNTCTDFVSSLESITEQSTGKNRPVWNLDDE
FLVGQCNDCLPHLSGNRINVIDNYQAILLGIFVQCNIFEALESAVADDNE
LISSRAGILLANISYKVSILLPADHPLSSKTNASVLFNNPKSQKALLWIH
QVHQLLEHHQFEITPFLTYIIQQHPTINVNDYGVQSKRFLQPANIDEILD
SCYLPYLGSANKPSQPSLSQQTSNKNYRVGALLDQIVRYSNIFESINEKA
FYDSWDWDLLMVFGRSLVDSKPTLNIDKESLSRVIQVLMKFFTLKATAAN
SSYSGKNLSIAKFALLPLTWKHSTNAAFVITDIICYLVESSKESEISEEL
NEFLIGMYSNLKDCLLSIADEKYIQEIKDNFGFNKTYEACGIFTEYDLNY
KCSSYLILAIGRMSVSDIGETILEKIGFVNLFKAFLDYSRSDALTKLILG
SLDYTRPSLGRSLLSIAIRSDNLWTRRYSTKFLKVLLRAKVPFFSSWGVN
FLMKQLHDCDRVVKQAAYEILMEASEDEAVVNNLIIESIATLHQDFFGHI
LFSRLLSLPSHFDKLQNKNGVYFFLDNWKKNYNTLYCQKLIITLMILTKI
EYLIKLNANRET*
back to top

protein sequence of SMED30014131-orf-2

>SMED30014131-orf-2 ID=SMED30014131-orf-2|Name=SMED30014131-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=502bp
MFLDEFDKVNINSEQSSAVGYSVFAAPLASDEPIKKTSFALIDDPTFILN
MKKFKIYSKSIDDSIIKSRCTTVTSSSSSTHISDGDHQQKLNKFIHHKRD
FSGGSASLFNVNTEETSEAFTPHDVLGIATMRKLQTKFRNDLSQKNTSSV
SSYYNNYNEPRCCDQMDQSLVGIFSNIRKTSSCVDKKSRKKKFSSFINPR
SNLNRYRGLVLPINFNDLIMNIFKTPEERNAERSSYEKVQMWEVSNETGL
SLENSIKESSVLEGKESVSLQKSRSITFEESSCVLDIALLGNESTLHYEC
VDKIKPTRSSSDEQNWAGKEIIFIRPRAITDIKEFEKLPKDNRHSGSIGY
HVTHFRDAFLFIGDKLPKRIEQRNGLSYHSQDHCVHVYCQSEQVSEEVIE
FRQKILKSVSLMLTISSKTKKTEMNLARLKSGQNQLFWIDPCLFSEICIL
MSLYSFSRLSRQYIQELFLSVPMNQLQDDMKLCLEEFSKENKSKSSFSTR
L*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000044cephalic ganglia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000136whole organism
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR028267Pianissimo_N
IPR029451RICTOR_M
IPR029453Rictor_IV
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005488binding
Vocabulary: biological process
TermDefinition
GO:0031929TOR signaling
Vocabulary: cellular component
TermDefinition
GO:0031932TORC2 complex