protein SEC13 homolog

Overview
Nameprotein SEC13 homolog
Smed IDSMED30014117
Length (bp)1033
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of protein SEC13 homolog (SMED30014117) t-SNE clustered cells

Violin plots show distribution of expression levels for protein SEC13 homolog (SMED30014117) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of protein SEC13 homolog (SMED30014117) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for protein SEC13 homolog (SMED30014117) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014117

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30014117SMESG000013191.1 dd_Smed_v4_836_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014117SMESG000013191.1 dd_Smed_v4_836_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014117SMESG000013191.1 dd_Smed_v4_836_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30014117SMESG000013191.1 dd_Smed_v4_836_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014117SMESG000013191.1 Contig49347uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014117SMESG000013191.1 Contig49347newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of protein SEC13 homolog vs. Ensembl Human
Match: SEC13 (SEC13 homolog, nuclear pore and COPII coat complex component [Source:HGNC Symbol;Acc:HGNC:10697])

HSP 1 Score: 323.168 bits (827), Expect = 2.488e-109
Identity = 175/312 (56.09%), Postives = 221/312 (70.83%), Query Frame = 2
Query:   59 MVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPI----TFSEDAEGEK--VYKRLVSGGCDGEVKIWKEAS-GRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGDMS 973
            MVSV  ++DT HED+IHDAQMD+YG  LA+CSSD SVKIF+V N    L+ADL+ H+GPVWQV+W+HP +GN+LASC YD+KVII+   NG W+K  E+  HDSSVNSVCW+P +YG +LACGSSDG+IS++T  G+G  + KKI +AH IG NAV WAP     +  +   G+K    KR  SGGCD  +K+WKE   G+W EE  L  HSDWVRDVAW P        IASC Q G V IWT C + S+  W    L  F  VVWH+SWS+T +ILAVS G+N ++LWK+S++GQW CIS VN+G+G +S
Sbjct:    1 MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWT-CDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVS 311          
BLAST of protein SEC13 homolog vs. Ensembl Human
Match: SEC13 (SEC13 homolog, nuclear pore and COPII coat complex component [Source:HGNC Symbol;Acc:HGNC:10697])

HSP 1 Score: 323.168 bits (827), Expect = 2.547e-109
Identity = 175/312 (56.09%), Postives = 221/312 (70.83%), Query Frame = 2
Query:   59 MVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPI----TFSEDAEGEK--VYKRLVSGGCDGEVKIWKEAS-GRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGDMS 973
            MVSV  ++DT HED+IHDAQMD+YG  LA+CSSD SVKIF+V N    L+ADL+ H+GPVWQV+W+HP +GN+LASC YD+KVII+   NG W+K  E+  HDSSVNSVCW+P +YG +LACGSSDG+IS++T  G+G  + KKI +AH IG NAV WAP     +  +   G+K    KR  SGGCD  +K+WKE   G+W EE  L  HSDWVRDVAW P        IASC Q G V IWT C + S+  W    L  F  VVWH+SWS+T +ILAVS G+N ++LWK+S++GQW CIS VN+G+G +S
Sbjct:    4 MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWT-CDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVS 314          
BLAST of protein SEC13 homolog vs. Ensembl Human
Match: SEC13 (SEC13 homolog, nuclear pore and COPII coat complex component [Source:HGNC Symbol;Acc:HGNC:10697])

HSP 1 Score: 323.168 bits (827), Expect = 1.387e-108
Identity = 175/312 (56.09%), Postives = 221/312 (70.83%), Query Frame = 2
Query:   59 MVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPI----TFSEDAEGEK--VYKRLVSGGCDGEVKIWKEAS-GRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGDMS 973
            MVSV  ++DT HED+IHDAQMD+YG  LA+CSSD SVKIF+V N    L+ADL+ H+GPVWQV+W+HP +GN+LASC YD+KVII+   NG W+K  E+  HDSSVNSVCW+P +YG +LACGSSDG+IS++T  G+G  + KKI +AH IG NAV WAP     +  +   G+K    KR  SGGCD  +K+WKE   G+W EE  L  HSDWVRDVAW P        IASC Q G V IWT C + S+  W    L  F  VVWH+SWS+T +ILAVS G+N ++LWK+S++GQW CIS VN+G+G +S
Sbjct:   47 MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWT-CDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVS 357          
BLAST of protein SEC13 homolog vs. Ensembl Human
Match: SEC13 (SEC13 homolog, nuclear pore and COPII coat complex component [Source:HGNC Symbol;Acc:HGNC:10697])

HSP 1 Score: 305.834 bits (782), Expect = 1.233e-102
Identity = 166/298 (55.70%), Postives = 210/298 (70.47%), Query Frame = 2
Query:  101 IIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPI----TFSEDAEGEK--VYKRLVSGGCDGEVKIWKEAS-GRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGDMS 973
            +IHDAQMD+YG  LA+CSSD SVKIF+V N    L+ADL+ H+GPVWQV+W+HP +GN+LASC YD+KVII+   NG W+K  E+  HDSSVNSVCW+P +YG +LACGSSDG+IS++T  G+G  + KKI +AH IG NAV WAP     +  +   G+K    KR  SGGCD  +K+WKE   G+W EE  L  HSDWVRDVAW P        IASC Q G V IWT C + S+  W    L  F  VVWH+SWS+T +ILAVS G+N ++LWK+S++GQW CIS VN+G+G +S
Sbjct:    1 MIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWT-CDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVS 297          
BLAST of protein SEC13 homolog vs. Ensembl Human
Match: SEC13 (SEC13 homolog, nuclear pore and COPII coat complex component [Source:HGNC Symbol;Acc:HGNC:10697])

HSP 1 Score: 271.552 bits (693), Expect = 1.263e-89
Identity = 153/278 (55.04%), Postives = 189/278 (67.99%), Query Frame = 2
Query:  101 IIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPI----TFSEDAEGEK--VYKRLVSGGCDGEVKIWKEAS-GRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQ 913
            +IHDAQMD+YG  LA+CSSD SVKIF+V N    L+ADL+ H+GPVWQV+W+HP +GN+LASC YD+KVII+   NG W+K  E+  HDSSVNSVCW+P +YG +LACGSSDG+IS++T  G+G  + KKI +AH IG NAV WAP     +  +   G+K    KR  SGGCD  +K+WKE   G+W EE  L  HSDWVRDVAW P        IASC Q G V IWT C + S+  W    L  F  VVWH+SWS+T +ILAVS G+N   L  Q
Sbjct:    1 MIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWT-CDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKEELQMQ 277          
BLAST of protein SEC13 homolog vs. Ensembl Celegans
Match: npp-20 (pep chromosome:WBcel235:IV:1490653:1496022:-1 gene:WBGene00003806.1 transcript:Y77E11A.13a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:npp-20)

HSP 1 Score: 229.18 bits (583), Expect = 4.572e-73
Identity = 130/309 (42.07%), Postives = 187/309 (60.52%), Query Frame = 2
Query:   59 MVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNL-VADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQ-DFKKICDAHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCDGEVKIWK--EASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGDMS 973
            M +V   IDT+H D IHDAQ++ YG  LA+C SD  VKIFEV  +  +  +A+L  H GPVW+VSW+HP++G LLAS  YDKKVII+    G WQK  E+  H++S   V ++P +YG MLA  S+DG I I+      N+    KI   H  G+N+VCWAP +    A+     KRLVS G D  VKIW   +A+  WI E  L GH+D+VR+ AWCP+T++ Q  I SC   G++ ++ + +     +W+   L   P  ++H S+S  G  L+V+  +N I++W+++L+GQW  +   N+    MS
Sbjct:    1 MTTVRQRIDTQHRDAIHDAQLNIYGSRLATCGSDRLVKIFEVRPNGQSYPMAELVGHSGPVWKVSWAHPKYGGLLASASYDKKVIIWNEQQGRWQKAYEWAAHEASTTCVAFAPHQYGLMLASASADGDIGILRYDNSSNEWISSKIQKCHEQGVNSVCWAPGSADPAAK-----KRLVSAGNDKNVKIWAFDDATNEWILEKTLAGHTDFVREAAWCPVTNNGQHTIVSCGMEGNLVLF-RTSNIETEEWKAKLLETAPCALYHSSFSPCGSFLSVAGDDNVITIWRENLQGQWIKVPRDNKEREGMS 303          
BLAST of protein SEC13 homolog vs. Ensembl Celegans
Match: npp-20 (pep chromosome:WBcel235:IV:1490659:1496020:-1 gene:WBGene00003806.1 transcript:Y77E11A.13b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:npp-20)

HSP 1 Score: 156.762 bits (395), Expect = 2.670e-46
Identity = 91/190 (47.89%), Postives = 118/190 (62.11%), Query Frame = 2
Query:   59 MVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNL-VADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQ-DFKKICDAHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCDGEVKIW 622
            M +V   IDT+H D IHDAQ++ YG  LA+C SD  VKIFEV  +  +  +A+L  H GPVW+VSW+HP++G LLAS  YDKKVII+    G WQK  E+  H++S   V ++P +YG MLA  S+DG I I+      N+    KI   H  G+N+VCWAP +    A+     KRLVS G D  VKIW
Sbjct:    1 MTTVRQRIDTQHRDAIHDAQLNIYGSRLATCGSDRLVKIFEVRPNGQSYPMAELVGHSGPVWKVSWAHPKYGGLLASASYDKKVIIWNEQQGRWQKAYEWAAHEASTTCVAFAPHQYGLMLASASADGDIGILRYDNSSNEWISSKIQKCHEQGVNSVCWAPGSADPAAK-----KRLVSAGNDKNVKIW 185          
BLAST of protein SEC13 homolog vs. Ensembl Celegans
Match: npp-18 (Nucleoporin SEH1 [Source:UniProtKB/Swiss-Prot;Acc:O45933])

HSP 1 Score: 76.2554 bits (186), Expect = 2.817e-15
Identity = 73/326 (22.39%), Postives = 132/326 (40.49%), Query Frame = 2
Query:   92 HEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFND-NHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIY-----------GPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLA-CXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVR-------------DVAWCP--MTSSNQQVIASCD-QTGHVNIWTQCAEYSNGQWQQTSLPVFPQV----------VWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVN 952
            H D+IH    D +GR +A+C+SD ++ I++   D N    A  K H G VW+V W+HP+FG ++A+C YD+ ++I+                 W +     ++ S V  +C+SP   G M+A C                   +  I +         C   +T+S      ++++ L++ G D +     E   R +    + G   W R             D+ + P  M  S+Q  +AS D    ++ +        +G      L  +  +           W L +++ G +++ +S +  +  WK     QW  +S +N
Sbjct:   16 HRDLIHCVSFDPHGRRMATCASDMTMAIWDRKPDGNWRRSAHWKCHGGAVWRVIWAHPEFGQIVATCSYDRTIVIWEEQIVRSEKDLKQKESQWIRRTIISDNRSDVTDICFSPRHLGLMMASCNVLGTVRIYEAPDIVDASRWNLIHELQAFHTRCGC---VTWS----LSRMHRPLIAVGSDEKK---AENKKRVVIYENIDGLRKWQRINSLVFDLPCPITDLKFSPISMVDSHQLAVASGDVHVYNIKVARSAILEEDGVENPIQLADYNLIKVALLGDHRKAWRLRYNLMGSVISSTSLDGTLRSWKSLFVNQWVKLSEMN 331          
BLAST of protein SEC13 homolog vs. Ensembl Fly
Match: Sec13 (gene:FBgn0024509 transcript:FBtr0084409)

HSP 1 Score: 289.271 bits (739), Expect = 7.795e-96
Identity = 159/303 (52.48%), Postives = 206/303 (67.99%), Query Frame = 2
Query:   59 MVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGV-WQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQ-DFKKICDAHNIGINAVCWAPITFSEDAEGEKV------YKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCIS 943
            MVS+   IDT HED++H A +DFYG  LA+CSSD SV+IF    +N  L A+LK HQGPVWQV+W+HP+FGN+LASC YD+KVI++  +    W KL EY NHDSSVNSV ++P EYG +LAC SSDGS+S++T   +    D KKI +AH IG+NA+ W P    + A  ++V       KRLVSGGCD  VKIW+E + RW+EE  L  HSDWVRDVAW P     +  IA+  Q  HV +W+  A+ S  +W  T L  F   VW +SWS TG+ILAV+ G+NN++LWK++ EGQW  I+
Sbjct:    1 MVSLLQEIDTEHEDMVHHAALDFYGLLLATCSSDGSVRIFHSRKNNKAL-AELKGHQGPVWQVAWAHPKFGNILASCSYDRKVIVWKSTTPRDWTKLYEYSNHDSSVNSVDFAPSEYGLVLACASSDGSVSVLTCNTEYGVWDAKKIPNAHTIGVNAISWCPAQAPDPAFDQRVTSRSAAVKRLVSGGCDNLVKIWREDNDRWVEEHRLEAHSDWVRDVAWAPSIGLPRSQIATASQDRHVIVWSSNADLS--EWTSTVLHTFDDAVWSISWSTTGNILAVTGGDNNVTLWKENTEGQWIRIN 300          
BLAST of protein SEC13 homolog vs. Ensembl Fly
Match: Sec13 (gene:FBgn0024509 transcript:FBtr0346160)

HSP 1 Score: 289.271 bits (739), Expect = 7.795e-96
Identity = 159/303 (52.48%), Postives = 206/303 (67.99%), Query Frame = 2
Query:   59 MVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGV-WQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQ-DFKKICDAHNIGINAVCWAPITFSEDAEGEKV------YKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCIS 943
            MVS+   IDT HED++H A +DFYG  LA+CSSD SV+IF    +N  L A+LK HQGPVWQV+W+HP+FGN+LASC YD+KVI++  +    W KL EY NHDSSVNSV ++P EYG +LAC SSDGS+S++T   +    D KKI +AH IG+NA+ W P    + A  ++V       KRLVSGGCD  VKIW+E + RW+EE  L  HSDWVRDVAW P     +  IA+  Q  HV +W+  A+ S  +W  T L  F   VW +SWS TG+ILAV+ G+NN++LWK++ EGQW  I+
Sbjct:    1 MVSLLQEIDTEHEDMVHHAALDFYGLLLATCSSDGSVRIFHSRKNNKAL-AELKGHQGPVWQVAWAHPKFGNILASCSYDRKVIVWKSTTPRDWTKLYEYSNHDSSVNSVDFAPSEYGLVLACASSDGSVSVLTCNTEYGVWDAKKIPNAHTIGVNAISWCPAQAPDPAFDQRVTSRSAAVKRLVSGGCDNLVKIWREDNDRWVEEHRLEAHSDWVRDVAWAPSIGLPRSQIATASQDRHVIVWSSNADLS--EWTSTVLHTFDDAVWSISWSTTGNILAVTGGDNNVTLWKENTEGQWIRIN 300          
BLAST of protein SEC13 homolog vs. Ensembl Fly
Match: Nup44A (gene:FBgn0033247 transcript:FBtr0088860)

HSP 1 Score: 95.9005 bits (237), Expect = 5.097e-22
Identity = 86/327 (26.30%), Postives = 150/327 (45.87%), Query Frame = 2
Query:   59 MVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNH-NLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDK-----------KVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICD--AHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCD------GEVKI--WKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGH-VNIW--TQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEG 964
            M  VE  I   H+D+IHD   D+YGR +A+CSSD +VKI++       N+ +  K H G +W+VSW+HP+FG ++A+C +D+           KV         W +     +  +SV  V ++P   G +LA  S+DG I I       N     +    ++ + ++ + W   T+        +  +L++ G D      G+V +  + E S + ++   +   +D V DVA+ P       ++A   +  + VN+   T   + S    Q          VW + W++   +L  +  +  + LW+ +   QW C +AV + EG
Sbjct:    1 MFDVE-PIIADHKDVIHDVVFDYYGRRMATCSSDQTVKIWDEDGQGKWNVTSSWKAHSGSIWRVSWAHPEFGQVVATCSFDRTASVWEEVIGEKVSSTNTPTRRWVRRTTLVDSRTSVTDVEFAPKYLGLLLATASADGIIRIYEAPDIMNLSQWPVQHEISNKLPLSCLSWNTSTY--------MVTQLLAAGSDEAATPTGKVFLFAYSENSRKCVKIDTVNDITDPVTDVAFAPNAGRTFHMLAVASKDLYIVNLRGVTDATDISKLDIQTIKFSEHNCPVWRVCWNMLATMLISTGDDGCVRLWRMNYNRQWRC-AAVLKAEG 317          
BLAST of protein SEC13 homolog vs. Ensembl Fly
Match: Nup44A (gene:FBgn0033247 transcript:FBtr0088862)

HSP 1 Score: 95.9005 bits (237), Expect = 5.097e-22
Identity = 86/327 (26.30%), Postives = 150/327 (45.87%), Query Frame = 2
Query:   59 MVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNH-NLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDK-----------KVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICD--AHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCD------GEVKI--WKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGH-VNIW--TQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEG 964
            M  VE  I   H+D+IHD   D+YGR +A+CSSD +VKI++       N+ +  K H G +W+VSW+HP+FG ++A+C +D+           KV         W +     +  +SV  V ++P   G +LA  S+DG I I       N     +    ++ + ++ + W   T+        +  +L++ G D      G+V +  + E S + ++   +   +D V DVA+ P       ++A   +  + VN+   T   + S    Q          VW + W++   +L  +  +  + LW+ +   QW C +AV + EG
Sbjct:    1 MFDVE-PIIADHKDVIHDVVFDYYGRRMATCSSDQTVKIWDEDGQGKWNVTSSWKAHSGSIWRVSWAHPEFGQVVATCSFDRTASVWEEVIGEKVSSTNTPTRRWVRRTTLVDSRTSVTDVEFAPKYLGLLLATASADGIIRIYEAPDIMNLSQWPVQHEISNKLPLSCLSWNTSTY--------MVTQLLAAGSDEAATPTGKVFLFAYSENSRKCVKIDTVNDITDPVTDVAFAPNAGRTFHMLAVASKDLYIVNLRGVTDATDISKLDIQTIKFSEHNCPVWRVCWNMLATMLISTGDDGCVRLWRMNYNRQWRC-AAVLKAEG 317          
BLAST of protein SEC13 homolog vs. Ensembl Fly
Match: Nup44A (gene:FBgn0033247 transcript:FBtr0088861)

HSP 1 Score: 95.9005 bits (237), Expect = 5.097e-22
Identity = 86/327 (26.30%), Postives = 150/327 (45.87%), Query Frame = 2
Query:   59 MVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNH-NLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDK-----------KVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICD--AHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCD------GEVKI--WKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGH-VNIW--TQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEG 964
            M  VE  I   H+D+IHD   D+YGR +A+CSSD +VKI++       N+ +  K H G +W+VSW+HP+FG ++A+C +D+           KV         W +     +  +SV  V ++P   G +LA  S+DG I I       N     +    ++ + ++ + W   T+        +  +L++ G D      G+V +  + E S + ++   +   +D V DVA+ P       ++A   +  + VN+   T   + S    Q          VW + W++   +L  +  +  + LW+ +   QW C +AV + EG
Sbjct:    1 MFDVE-PIIADHKDVIHDVVFDYYGRRMATCSSDQTVKIWDEDGQGKWNVTSSWKAHSGSIWRVSWAHPEFGQVVATCSFDRTASVWEEVIGEKVSSTNTPTRRWVRRTTLVDSRTSVTDVEFAPKYLGLLLATASADGIIRIYEAPDIMNLSQWPVQHEISNKLPLSCLSWNTSTY--------MVTQLLAAGSDEAATPTGKVFLFAYSENSRKCVKIDTVNDITDPVTDVAFAPNAGRTFHMLAVASKDLYIVNLRGVTDATDISKLDIQTIKFSEHNCPVWRVCWNMLATMLISTGDDGCVRLWRMNYNRQWRC-AAVLKAEG 317          
BLAST of protein SEC13 homolog vs. Ensembl Zebrafish
Match: sec13 (SEC13 homolog, nuclear pore and COPII coat complex component [Source:ZFIN;Acc:ZDB-GENE-040426-2649])

HSP 1 Score: 331.643 bits (849), Expect = 1.256e-112
Identity = 178/319 (55.80%), Postives = 224/319 (70.22%), Query Frame = 2
Query:   47 LLHVMVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPI----TFSEDAEGEK--VYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGDMSNTEE 985
             +H+ VSV  ++DT HED+IHDAQMD+YG  LA+CSSD SVKIF+V N    LVADL+ H+GPVWQV+W+HP +GN+LASC YD+KVII+   N  W K+ EY  HDSSVNSVCW P ++G +LACGSSDG+IS++T  GDG+ D KKI +AH IG NAV WAP     +  E   G+K    KR VSGGCD  VK+WKE  G+W E+  L  HSDWVRDV W P        IASC Q G V IWT C + +   W    L  F  VVWH+SWS+TG+ILAVS G+N ++LWK+S++GQW CIS VN+G+G +S+  +
Sbjct:   13 FMHIKVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVKNGGQILVADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWKEENSTWDKMYEYTGHDSSVNSVCWGPYDFGLILACGSSDGAISVLTCSGDGHWDIKKINNAHTIGCNAVSWAPAVVPGSLIEQPTGQKPNYIKRFVSGGCDNLVKLWKEEDGQWKEDQKLEAHSDWVRDVGWAPSIGLPTSTIASCSQDGRVFIWT-CDDPAGNTWTAKLLHKFNDVVWHVSWSITGNILAVSGGDNKVTLWKESVDGQWACISDVNKGQGAVSSITD 330          
BLAST of protein SEC13 homolog vs. Ensembl Zebrafish
Match: sec13 (SEC13 homolog, nuclear pore and COPII coat complex component [Source:ZFIN;Acc:ZDB-GENE-040426-2649])

HSP 1 Score: 331.643 bits (849), Expect = 1.256e-112
Identity = 178/319 (55.80%), Postives = 224/319 (70.22%), Query Frame = 2
Query:   47 LLHVMVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPI----TFSEDAEGEK--VYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGDMSNTEE 985
             +H+ VSV  ++DT HED+IHDAQMD+YG  LA+CSSD SVKIF+V N    LVADL+ H+GPVWQV+W+HP +GN+LASC YD+KVII+   N  W K+ EY  HDSSVNSVCW P ++G +LACGSSDG+IS++T  GDG+ D KKI +AH IG NAV WAP     +  E   G+K    KR VSGGCD  VK+WKE  G+W E+  L  HSDWVRDV W P        IASC Q G V IWT C + +   W    L  F  VVWH+SWS+TG+ILAVS G+N ++LWK+S++GQW CIS VN+G+G +S+  +
Sbjct:   13 FMHIKVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVKNGGQILVADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWKEENSTWDKMYEYTGHDSSVNSVCWGPYDFGLILACGSSDGAISVLTCSGDGHWDIKKINNAHTIGCNAVSWAPAVVPGSLIEQPTGQKPNYIKRFVSGGCDNLVKLWKEEDGQWKEDQKLEAHSDWVRDVGWAPSIGLPTSTIASCSQDGRVFIWT-CDDPAGNTWTAKLLHKFNDVVWHVSWSITGNILAVSGGDNKVTLWKESVDGQWACISDVNKGQGAVSSITD 330          
BLAST of protein SEC13 homolog vs. Ensembl Zebrafish
Match: sec13 (SEC13 homolog, nuclear pore and COPII coat complex component [Source:ZFIN;Acc:ZDB-GENE-040426-2649])

HSP 1 Score: 328.561 bits (841), Expect = 1.040e-111
Identity = 178/315 (56.51%), Postives = 222/315 (70.48%), Query Frame = 2
Query:   59 MVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPI----TFSEDAEGEK--VYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGDMSNTEE 985
            MVSV  ++DT HED+IHDAQMD+YG  LA+CSSD SVKIF+V N    LVADL+ H+GPVWQV+W+HP +GN+LASC YD+KVII+   N  W K+ EY  HDSSVNSVCW P ++G +LACGSSDG+IS++T  GDG+ D KKI +AH IG NAV WAP     +  E   G+K    KR VSGGCD  VK+WKE  G+W E+  L  HSDWVRDV W P        IASC Q G V IWT C + +   W    L  F  VVWH+SWS+TG+ILAVS G+N ++LWK+S++GQW CIS VN+G+G +S+  +
Sbjct:    1 MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVKNGGQILVADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWKEENSTWDKMYEYTGHDSSVNSVCWGPYDFGLILACGSSDGAISVLTCSGDGHWDIKKINNAHTIGCNAVSWAPAVVPGSLIEQPTGQKPNYIKRFVSGGCDNLVKLWKEEDGQWKEDQKLEAHSDWVRDVGWAPSIGLPTSTIASCSQDGRVFIWT-CDDPAGNTWTAKLLHKFNDVVWHVSWSITGNILAVSGGDNKVTLWKESVDGQWACISDVNKGQGAVSSITD 314          
BLAST of protein SEC13 homolog vs. Ensembl Zebrafish
Match: seh1l (SEH1-like (S. cerevisiae) [Source:NCBI gene;Acc:334749])

HSP 1 Score: 110.923 bits (276), Expect = 2.718e-27
Identity = 94/328 (28.66%), Postives = 145/328 (44.21%), Query Frame = 2
Query:   68 VEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNH-NLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVI----IYGPSNGV------WQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVC----WAPITFSEDAEGEKVYKRLVSGGCDGEVKI--WKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQV--------VWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGDMSN 976
            V  SI   H+D+IHD   DF+GR +A+CSSD SVK+++  +D   +  A  K H G VW+V+W+HP+FG +LASC +D+       I G SN        W K     +  +SV  V ++P   G ML   S+DG + I       N    +    H I     C    W P +         V     +G   G+V+I  + E + ++ +   L   +D V D+A+ P    +  V+A   +   +         S      T   V            VW +SW++T  +LA S  +  + LWK +    W C + + +G+G   N
Sbjct:    3 VAKSIAADHKDLIHDVSYDFHGRRMATCSSDQSVKVWDKGDDGEWHCTASWKTHSGSVWRVTWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKQRGQSHWIKRTTLVDSRTSVTDVKFAPKHMGLMLTTCSADGVVRIYEAPDVMN--LSQWSLQHEISCKLACSCISWNPSSSRAHPPMIAVGGDDSNGAYSGKVQIHEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFHVLAIATKDVRIFKLLPLRRESANSSGPTKFEVQVMAQFDSHNSQVWRVSWNITSTLLASSGDDGCVRLWKANYMDNWKC-TGILRGDGSPVN 327          
BLAST of protein SEC13 homolog vs. Ensembl Zebrafish
Match: snrnp40 (small nuclear ribonucleoprotein 40 (U5) [Source:ZFIN;Acc:ZDB-GENE-040426-978])

HSP 1 Score: 61.2326 bits (147), Expect = 4.756e-10
Identity = 70/280 (25.00%), Postives = 118/280 (42.14%), Query Frame = 2
Query:   92 HEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIW--------TQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLW 907
            HE  ++  +    G  LAS   D  + ++ V+ D  N  A LK H G V ++ ++    G+LL S   DK V ++    G  +++K    H S VNS C+ P   GP LAC  SD     +        D +K    H    N      +TF++ ++      +++SGG D ++K+W     + I    ++GH D V  ++     S++   + S      V +W         +C +   G         F + +   SWS  G  +A  S +  + +W
Sbjct:   55 HEGEVYCCKFHPNGATLASSGYDRLILMWNVYGDCENY-ATLKGHSGAVMELHYNTD--GSLLFSASTDKTVCVWDSETG--ERVKRLKGHTSFVNS-CF-PARRGPQLACTGSDDGTVKLW-------DIRKKASVHTFQ-NTYQVLSVTFNDTSD------QIISGGIDNDIKVWDLRQNKLIYS--MQGHGDSVTGLSL----SADGSYLLSNSMDNSVRVWDIRPFAPKERCVKIFQGNVHN-----FEKNLLRCSWSADGSKIAAGSADRFVYIW 302          
BLAST of protein SEC13 homolog vs. Ensembl Xenopus
Match: sec13 (Fc receptor-like protein 3 [Source:Xenbase;Acc:XB-GENE-5897202])

HSP 1 Score: 322.398 bits (825), Expect = 5.100e-109
Identity = 175/315 (55.56%), Postives = 218/315 (69.21%), Query Frame = 2
Query:   59 MVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAP------ITFSEDAEGEKVYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGDMSNTEE 985
            MVSV  ++DT HED+IHDAQMD+YG  LA+CSSD SVKIF+V N    L+ADL+ H+GPVWQV+W+HP +GN+LASC YD+KVII+   NG W+K  EY  HDSSVNSVCW+P + G +LACGSSDG+ISI+T  GDG  + KKI +AH IG NAV WAP      +     ++     KR VSGGCD  VKIW+E  G+W E+  L  HSDWVRDVAW P        IASC Q G V IWT     +N  W    L  F  VVWH+SWS+T +ILAVS G+N ++LWK+S++GQW CIS VN+G+G +S   +
Sbjct:    1 MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVKNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWKEENGTWEKTYEYTGHDSSVNSVCWAPHDLGLVLACGSSDGAISILTYTGDGPWEVKKISNAHTIGCNAVSWAPSVVPGSLVDQPSSQKPNYIKRFVSGGCDNLVKIWREEDGQWKEDQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVYIWTSDDAATNC-WNPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWACISDVNKGQGAVSTVTD 314          
BLAST of protein SEC13 homolog vs. Ensembl Xenopus
Match: seh1l (SEH1 like nucleoporin [Source:NCBI gene;Acc:496570])

HSP 1 Score: 119.398 bits (298), Expect = 3.531e-30
Identity = 101/334 (30.24%), Postives = 158/334 (47.31%), Query Frame = 2
Query:   68 VEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVF-NDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVI----IYGPSNGV------WQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVC----WAPITFSEDAEGEKVYKRLVSGGCD-------GEVKIWK--EASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWT----QCAEYSNGQWQQTSLPVFPQV------VWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGD 967
            V  SI   H+D+IHD   DF+GR +A+CSSD SVK+++   N + +  A  K H G VW+V+W+HP+FG +LASC +D+       I G SN        W K     +  +SV  V ++P   G MLA  S+DG + I       N    +    H I     C    W P          + +  +++ G D       G+V+I++  E + ++ +   L   SD V D+A+ P    +  ++A    T  V I+T    +    S+G   +  +    Q       VW +SW++TG +LA S  +  + LWK +    W CI  V +G+G+
Sbjct:    3 VARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSENGDWHCTASWKTHSGSVWRVTWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHMGLMLATCSADGVVRIYEAPDVMN--LSQWSLQHEISCKLSCSCISWNP-------SSSRAHSPMIAVGSDDSSPNIMGKVQIYEYNENTRKYAKAETLMSVSDPVHDIAFAPNLGRSFHILAVA--TKDVRIFTMKPLRKELSSSGGVTKFEIHTVAQFDNHNSQVWRVSWNITGTVLASSGDDGTVRLWKANYMDNWKCI-GVLKGDGN 324          
BLAST of protein SEC13 homolog vs. Ensembl Xenopus
Match: seh1l (SEH1 like nucleoporin [Source:NCBI gene;Acc:496570])

HSP 1 Score: 119.013 bits (297), Expect = 4.479e-30
Identity = 101/334 (30.24%), Postives = 158/334 (47.31%), Query Frame = 2
Query:   68 VEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVF-NDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVI----IYGPSNGV------WQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVC----WAPITFSEDAEGEKVYKRLVSGGCD-------GEVKIWK--EASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWT----QCAEYSNGQWQQTSLPVFPQV------VWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGD 967
            V  SI   H+D+IHD   DF+GR +A+CSSD SVK+++   N + +  A  K H G VW+V+W+HP+FG +LASC +D+       I G SN        W K     +  +SV  V ++P   G MLA  S+DG + I       N    +    H I     C    W P          + +  +++ G D       G+V+I++  E + ++ +   L   SD V D+A+ P    +  ++A    T  V I+T    +    S+G   +  +    Q       VW +SW++TG +LA S  +  + LWK +    W CI  V +G+G+
Sbjct:    3 VARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSENGDWHCTASWKTHSGSVWRVTWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHMGLMLATCSADGVVRIYEAPDVMN--LSQWSLQHEISCKLSCSCISWNP-------SSSRAHSPMIAVGSDDSSPNIMGKVQIYEYNENTRKYAKAETLMSVSDPVHDIAFAPNLGRSFHILAVA--TKDVRIFTMKPLRKELSSSGGVTKFEIHTVAQFDNHNSQVWRVSWNITGTVLASSGDDGTVRLWKANYMDNWKCI-GVLKGDGN 324          
BLAST of protein SEC13 homolog vs. Ensembl Xenopus
Match: seh1l (SEH1 like nucleoporin [Source:NCBI gene;Acc:496570])

HSP 1 Score: 119.013 bits (297), Expect = 4.508e-30
Identity = 101/334 (30.24%), Postives = 158/334 (47.31%), Query Frame = 2
Query:   68 VEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVF-NDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVI----IYGPSNGV------WQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVC----WAPITFSEDAEGEKVYKRLVSGGCD-------GEVKIWK--EASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWT----QCAEYSNGQWQQTSLPVFPQV------VWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGD 967
            V  SI   H+D+IHD   DF+GR +A+CSSD SVK+++   N + +  A  K H G VW+V+W+HP+FG +LASC +D+       I G SN        W K     +  +SV  V ++P   G MLA  S+DG + I       N    +    H I     C    W P          + +  +++ G D       G+V+I++  E + ++ +   L   SD V D+A+ P    +  ++A    T  V I+T    +    S+G   +  +    Q       VW +SW++TG +LA S  +  + LWK +    W CI  V +G+G+
Sbjct:    3 VARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSENGDWHCTASWKTHSGSVWRVTWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHMGLMLATCSADGVVRIYEAPDVMN--LSQWSLQHEISCKLSCSCISWNP-------SSSRAHSPMIAVGSDDSSPNIMGKVQIYEYNENTRKYAKAETLMSVSDPVHDIAFAPNLGRSFHILAVA--TKDVRIFTMKPLRKELSSSGGVTKFEIHTVAQFDNHNSQVWRVSWNITGTVLASSGDDGTVRLWKANYMDNWKCI-GVLKGDGN 324          
BLAST of protein SEC13 homolog vs. Ensembl Xenopus
Match: seh1l (SEH1 like nucleoporin [Source:NCBI gene;Acc:496570])

HSP 1 Score: 118.627 bits (296), Expect = 9.360e-30
Identity = 101/334 (30.24%), Postives = 158/334 (47.31%), Query Frame = 2
Query:   68 VEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVF-NDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVI----IYGPSNGV------WQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVC----WAPITFSEDAEGEKVYKRLVSGGCD-------GEVKIWK--EASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWT----QCAEYSNGQWQQTSLPVFPQV------VWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGD 967
            V  SI   H+D+IHD   DF+GR +A+CSSD SVK+++   N + +  A  K H G VW+V+W+HP+FG +LASC +D+       I G SN        W K     +  +SV  V ++P   G MLA  S+DG + I       N    +    H I     C    W P          + +  +++ G D       G+V+I++  E + ++ +   L   SD V D+A+ P    +  ++A    T  V I+T    +    S+G   +  +    Q       VW +SW++TG +LA S  +  + LWK +    W CI  V +G+G+
Sbjct:    3 VARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSENGDWHCTASWKTHSGSVWRVTWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHMGLMLATCSADGVVRIYEAPDVMN--LSQWSLQHEISCKLSCSCISWNP-------SSSRAHSPMIAVGSDDSSPNIMGKVQIYEYNENTRKYAKAETLMSVSDPVHDIAFAPNLGRSFHILAVA--TKDVRIFTMKPLRKELSSSGGVTKFEIHTVAQFDNHNSQVWRVSWNITGTVLASSGDDGTVRLWKANYMDNWKCI-GVLKGDGN 324          
BLAST of protein SEC13 homolog vs. Ensembl Mouse
Match: Sec13 (SEC13 homolog, nuclear pore and COPII coat complex component [Source:MGI Symbol;Acc:MGI:99832])

HSP 1 Score: 322.013 bits (824), Expect = 4.407e-109
Identity = 173/312 (55.45%), Postives = 220/312 (70.51%), Query Frame = 2
Query:   59 MVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPI----TFSEDAEGEK--VYKRLVSGGCDGEVKIWKEAS-GRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGDMS 973
            MVSV  ++DT HED+IHDAQMD+YG  LA+CSSD SVKIF+V N    L+ADL+ H+GPVWQV+W+HP +GN+LASC YD+KVII+   NG W+K  E+  HDSSVNSVCW+P +YG +LACGSSDG+IS++T  G+G  + KKI +AH IG NAV WAP     +  +   G+K    K+  SGGCD  +K+W+E   G+W EE  L  HSDWVRDVAW P        IASC Q G V IWT C + S   W    L  F  VVWH+SWS+T +ILAVS G+N ++LWK+S++GQW CIS VN+G+G +S
Sbjct:    1 MVSVMNTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWKEENGTWEKTHEHSGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDQPSGQKPNYIKKFASGGCDNLIKLWREEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWT-CDDASGNMWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVS 311          
BLAST of protein SEC13 homolog vs. Ensembl Mouse
Match: Seh1l (SEH1-like (S. cerevisiae [Source:MGI Symbol;Acc:MGI:1919374])

HSP 1 Score: 110.538 bits (275), Expect = 4.372e-27
Identity = 95/337 (28.19%), Postives = 155/337 (45.99%), Query Frame = 2
Query:   68 VEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNH-NLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVI----IYGPSNGV------WQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVC----WAPITFSEDAEGEKVYKRLVSGGCD-------GEVKIWK--EASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWT----QCAEYSNGQWQQTSLPVFPQV------VWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGDMSN 976
            V  SI   H+D+IHD   DF+GR +A+CSSD SVK+++       +  A  K H G VW+V+W+HP+FG +LASC +D+       I G SN        W K     +  +SV  V ++P   G MLA  S+DG + +       N    +    H +     C    W P          + +  +++ G D        +V+I++  E + ++ +   L   +D V D+A+ P    +  ++A    T  V I+T    +    S+G   +  + +  Q       VW +SW++TG +LA S  +  + LWK +    W C + + +G G   N
Sbjct:    3 VARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSVWRVTWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHMGLMLATCSADGIVRVYEAPDVMN--LSQWSLQHEVSCKLCCSCISWNP-------SSSRAHPPMIAVGSDDSSPNSMAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFHILAVA--TKDVRIFTLKPLRKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSGDDGCVRLWKANYMDNWKC-TGILKGNGSPVN 327          
BLAST of protein SEC13 homolog vs. Ensembl Mouse
Match: Seh1l (SEH1-like (S. cerevisiae [Source:MGI Symbol;Acc:MGI:1919374])

HSP 1 Score: 110.538 bits (275), Expect = 4.857e-27
Identity = 95/337 (28.19%), Postives = 155/337 (45.99%), Query Frame = 2
Query:   68 VEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNH-NLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVI----IYGPSNGV------WQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVC----WAPITFSEDAEGEKVYKRLVSGGCD-------GEVKIWK--EASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWT----QCAEYSNGQWQQTSLPVFPQV------VWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGDMSN 976
            V  SI   H+D+IHD   DF+GR +A+CSSD SVK+++       +  A  K H G VW+V+W+HP+FG +LASC +D+       I G SN        W K     +  +SV  V ++P   G MLA  S+DG + +       N    +    H +     C    W P          + +  +++ G D        +V+I++  E + ++ +   L   +D V D+A+ P    +  ++A    T  V I+T    +    S+G   +  + +  Q       VW +SW++TG +LA S  +  + LWK +    W C + + +G G   N
Sbjct:    3 VARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSVWRVTWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHMGLMLATCSADGIVRVYEAPDVMN--LSQWSLQHEVSCKLCCSCISWNP-------SSSRAHPPMIAVGSDDSSPNSMAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFHILAVA--TKDVRIFTLKPLRKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSGDDGCVRLWKANYMDNWKC-TGILKGNGSPVN 327          
BLAST of protein SEC13 homolog vs. Ensembl Mouse
Match: Snrnp40 (small nuclear ribonucleoprotein 40 (U5) [Source:MGI Symbol;Acc:MGI:1913835])

HSP 1 Score: 55.8398 bits (133), Expect = 2.781e-8
Identity = 68/280 (24.29%), Postives = 115/280 (41.07%), Query Frame = 2
Query:   92 HEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIW--------TQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLW 907
            HE  ++  +    G  LAS   D  + ++ V+ D  N  A LK H G V ++ ++    G++L S   DK V ++    G  +++K    H S VNS C+ P   GP L C  SD     +        D +K         N      +TF++ ++      +++SGG D ++K+W     +      +RGH+D V  ++     SS    + S      V +W         +C +   G         F + +   SWS  G  +A  S +  + +W
Sbjct:   66 HEGEVYCCKFHPNGSTLASAGFDRLILLWNVYGDCDNY-ATLKGHSGAVMELHYNTD--GSMLFSASTDKTVAVWDSETG--ERVKRLKGHTSFVNS-CY-PARRGPQLVCTGSDDGTVKLW-------DIRKKAAVQTFQ-NTYQVLAVTFNDTSD------QIISGGIDNDIKVWDLRQNKLT--YTMRGHADSVTGLSL----SSEGSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHN-----FEKNLLRCSWSPDGSKIAAGSADRFVYVW 313          
BLAST of protein SEC13 homolog vs. Ensembl Mouse
Match: Snrnp40 (small nuclear ribonucleoprotein 40 (U5) [Source:MGI Symbol;Acc:MGI:1913835])

HSP 1 Score: 55.8398 bits (133), Expect = 2.781e-8
Identity = 68/280 (24.29%), Postives = 115/280 (41.07%), Query Frame = 2
Query:   92 HEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIW--------TQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLW 907
            HE  ++  +    G  LAS   D  + ++ V+ D  N  A LK H G V ++ ++    G++L S   DK V ++    G  +++K    H S VNS C+ P   GP L C  SD     +        D +K         N      +TF++ ++      +++SGG D ++K+W     +      +RGH+D V  ++     SS    + S      V +W         +C +   G         F + +   SWS  G  +A  S +  + +W
Sbjct:   66 HEGEVYCCKFHPNGSTLASAGFDRLILLWNVYGDCDNY-ATLKGHSGAVMELHYNTD--GSMLFSASTDKTVAVWDSETG--ERVKRLKGHTSFVNS-CY-PARRGPQLVCTGSDDGTVKLW-------DIRKKAAVQTFQ-NTYQVLAVTFNDTSD------QIISGGIDNDIKVWDLRQNKLT--YTMRGHADSVTGLSL----SSEGSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHN-----FEKNLLRCSWSPDGSKIAAGSADRFVYVW 313          
BLAST of protein SEC13 homolog vs. UniProt/SwissProt
Match: sp|P55735|SEC13_HUMAN (Protein SEC13 homolog OS=Homo sapiens OX=9606 GN=SEC13 PE=1 SV=3)

HSP 1 Score: 323.168 bits (827), Expect = 1.195e-108
Identity = 175/312 (56.09%), Postives = 221/312 (70.83%), Query Frame = 2
Query:   59 MVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPI----TFSEDAEGEK--VYKRLVSGGCDGEVKIWKEAS-GRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGDMS 973
            MVSV  ++DT HED+IHDAQMD+YG  LA+CSSD SVKIF+V N    L+ADL+ H+GPVWQV+W+HP +GN+LASC YD+KVII+   NG W+K  E+  HDSSVNSVCW+P +YG +LACGSSDG+IS++T  G+G  + KKI +AH IG NAV WAP     +  +   G+K    KR  SGGCD  +K+WKE   G+W EE  L  HSDWVRDVAW P        IASC Q G V IWT C + S+  W    L  F  VVWH+SWS+T +ILAVS G+N ++LWK+S++GQW CIS VN+G+G +S
Sbjct:    1 MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWT-CDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVS 311          
BLAST of protein SEC13 homolog vs. UniProt/SwissProt
Match: sp|Q3ZCC9|SEC13_BOVIN (Protein SEC13 homolog OS=Bos taurus OX=9913 GN=SEC13 PE=2 SV=1)

HSP 1 Score: 322.398 bits (825), Expect = 2.647e-108
Identity = 174/314 (55.41%), Postives = 220/314 (70.06%), Query Frame = 2
Query:   59 MVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPI----TFSEDAEGEK--VYKRLVSGGCDGEVKIWKEAS-GRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGDMSNT 979
            MVSV  ++DT HED+IHDAQMD+YG  LA+CSSD SVKIF+V N    LVADL+ H+GPVWQV+W+HP +GN+LASC YD+KVII+   NG W+K  E+  HDSSVNSVCW+P +YG +LACGSSDG+IS++T  G G  + KKI +AH IG NAV WAP     +  +   G+K    K+  SGGCD  +K+WKE   G+W EE  L  HSDWVRDVAW P        IASC Q G V +WT C + S   W    L  F  VVWH+SWS+T +ILAVS G+N ++LWK+S++GQW CIS VN+G+G +S +
Sbjct:    1 MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILVADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWKEENGTWEKTHEHTGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGLGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDQPSGQKPNYIKKFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFVWT-CDDASGNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGPVSTS 313          
BLAST of protein SEC13 homolog vs. UniProt/SwissProt
Match: sp|Q9D1M0|SEC13_MOUSE (Protein SEC13 homolog OS=Mus musculus OX=10090 GN=Sec13 PE=1 SV=3)

HSP 1 Score: 322.013 bits (824), Expect = 3.083e-108
Identity = 173/312 (55.45%), Postives = 220/312 (70.51%), Query Frame = 2
Query:   59 MVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPI----TFSEDAEGEK--VYKRLVSGGCDGEVKIWKEAS-GRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGDMS 973
            MVSV  ++DT HED+IHDAQMD+YG  LA+CSSD SVKIF+V N    L+ADL+ H+GPVWQV+W+HP +GN+LASC YD+KVII+   NG W+K  E+  HDSSVNSVCW+P +YG +LACGSSDG+IS++T  G+G  + KKI +AH IG NAV WAP     +  +   G+K    K+  SGGCD  +K+W+E   G+W EE  L  HSDWVRDVAW P        IASC Q G V IWT C + S   W    L  F  VVWH+SWS+T +ILAVS G+N ++LWK+S++GQW CIS VN+G+G +S
Sbjct:    1 MVSVMNTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWKEENGTWEKTHEHSGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDQPSGQKPNYIKKFASGGCDNLIKLWREEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWT-CDDASGNMWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVS 311          
BLAST of protein SEC13 homolog vs. UniProt/SwissProt
Match: sp|Q5XFW8|SEC13_RAT (Protein SEC13 homolog OS=Rattus norvegicus OX=10116 GN=Sec13 PE=1 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 6.057e-108
Identity = 173/312 (55.45%), Postives = 220/312 (70.51%), Query Frame = 2
Query:   59 MVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPI----TFSEDAEGEK--VYKRLVSGGCDGEVKIWKEAS-GRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGDMS 973
            MVSV  ++DT HED+IHDAQMD+YG  LA+CSSD SVKIF+V N    L+ADL+ H+GPVWQV+W+HP +GN+LASC YD+KVII+   NG W+K  E+  HDSSVNSVCW+P +YG +LACGSSDG+IS++T  G+G  + KKI +AH IG NAV WAP     +  +   G+K    K+  SGGCD  +K+W+E   G+W EE  L  HSDWVRDVAW P        IASC Q G V IWT C + S   W    L  F  VVWH+SWS+T +ILAVS G+N ++LWK+S++GQW CIS VN+G+G +S
Sbjct:    1 MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWKEENGTWEKTHEHSGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDQPSGQKPNYIKKFASGGCDNLIKLWREEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWT-CDDASGNMWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVS 311          
BLAST of protein SEC13 homolog vs. UniProt/SwissProt
Match: sp|Q9V3J4|SEC13_DROME (Protein SEC13 homolog OS=Drosophila melanogaster OX=7227 GN=Sec13 PE=1 SV=1)

HSP 1 Score: 289.271 bits (739), Expect = 7.814e-95
Identity = 159/303 (52.48%), Postives = 206/303 (67.99%), Query Frame = 2
Query:   59 MVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGV-WQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQ-DFKKICDAHNIGINAVCWAPITFSEDAEGEKV------YKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCIS 943
            MVS+   IDT HED++H A +DFYG  LA+CSSD SV+IF    +N  L A+LK HQGPVWQV+W+HP+FGN+LASC YD+KVI++  +    W KL EY NHDSSVNSV ++P EYG +LAC SSDGS+S++T   +    D KKI +AH IG+NA+ W P    + A  ++V       KRLVSGGCD  VKIW+E + RW+EE  L  HSDWVRDVAW P     +  IA+  Q  HV +W+  A+ S  +W  T L  F   VW +SWS TG+ILAV+ G+NN++LWK++ EGQW  I+
Sbjct:    1 MVSLLQEIDTEHEDMVHHAALDFYGLLLATCSSDGSVRIFHSRKNNKAL-AELKGHQGPVWQVAWAHPKFGNILASCSYDRKVIVWKSTTPRDWTKLYEYSNHDSSVNSVDFAPSEYGLVLACASSDGSVSVLTCNTEYGVWDAKKIPNAHTIGVNAISWCPAQAPDPAFDQRVTSRSAAVKRLVSGGCDNLVKIWREDNDRWVEEHRLEAHSDWVRDVAWAPSIGLPRSQIATASQDRHVIVWSSNADLS--EWTSTVLHTFDDAVWSISWSTTGNILAVTGGDNNVTLWKENTEGQWIRIN 300          
BLAST of protein SEC13 homolog vs. TrEMBL
Match: A0A1S3JCE9 (protein SEC13 homolog OS=Lingula unguis OX=7574 GN=LOC106172041 PE=3 SV=1)

HSP 1 Score: 345.125 bits (884), Expect = 7.213e-115
Identity = 185/314 (58.92%), Postives = 229/314 (72.93%), Query Frame = 2
Query:   59 MVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPI----TFSEDAEGEK--VYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGDMSNTE 982
            MVSV  ++DT HED+IHDAQMD+YG  LA+CSSD SVKIF+V +    L+ADL+ H+GPVWQ++W+HP FGNLLASCGYD+KVII+  +NG W KL EY NHDSSVNSVCW+P E+G + ACGSSDG IS+I+  GDG  D KKI +AH IG NAV WAP     +  E + G+K  + KR VSGGCD  VKIWKE   +W+EE  L GHSDWVRDVAW P     + VIASC Q   V IWT   + ++  W   +L  F  V+WH+SWS+TG+ILAVS G+N +SLWK+SLEGQW CIS VN+G+G ++  E
Sbjct:    1 MVSVINTVDTAHEDMIHDAQMDYYGTKLATCSSDRSVKIFDVKSGQQTLIADLRGHEGPVWQIAWAHPMFGNLLASCGYDRKVIIWKETNGTWGKLYEYTNHDSSVNSVCWAPHEFGLLFACGSSDGCISVISSTGDGVWDSKKITNAHTIGCNAVSWAPAVVPGSLIEQSGGQKPQLVKRFVSGGCDNLVKIWKEEDDQWVEEQKLEGHSDWVRDVAWAPSIGLPKSVIASCSQDCRVIIWTN--DGTSSAWSSKTLHKFNDVIWHVSWSITGNILAVSGGDNKVSLWKESLEGQWACISDVNKGQGQVTEAE 312          
BLAST of protein SEC13 homolog vs. TrEMBL
Match: A0A3Q3LU54 (SEC13 homolog, nuclear pore and COPII coat complex component OS=Mastacembelus armatus OX=205130 PE=3 SV=1)

HSP 1 Score: 333.569 bits (854), Expect = 2.469e-110
Identity = 177/315 (56.19%), Postives = 222/315 (70.48%), Query Frame = 2
Query:   59 MVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPI----TFSEDAEGEK--VYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGDMSNTEE 985
            MVSV  ++DT HED+IHDAQMD+YG  LA+CSSD +VKIF+V N    LVADL+ H+GPVWQV+W+HP FGN+LASC YD+KVII+   NG W K+ EY  H+SSVNSVCW P E+GP+LACGSSDG+IS++T+ GD   D KKI +AH IG NAV WAP     +  +   G+K    KR VSGGCD  VK+WKE  G+W E+  L  HSDWVRDV W P        IASC Q G V IWT C + +   W    L  F  VVWH+SWS+TG+ILAVS G+N ++LWK+S++GQW CIS V++G+G +S   +
Sbjct:    1 MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRTVKIFDVRNGGQILVADLRGHEGPVWQVAWAHPMFGNILASCSYDRKVIIWKEENGAWDKMYEYTGHESSVNSVCWGPYEFGPILACGSSDGAISLLTLTGDQQWDVKKISNAHTIGCNAVSWAPAVVPGSLIDQPSGQKPNYVKRFVSGGCDNLVKLWKEEDGQWKEDQKLEAHSDWVRDVGWAPSIGLPTSTIASCSQDGRVFIWT-CDDPAGNTWTAKLLHKFNDVVWHVSWSITGNILAVSGGDNKVTLWKESMDGQWACISDVSKGQGAVSTITD 314          
BLAST of protein SEC13 homolog vs. TrEMBL
Match: T1JDY6 (WD_REPEATS_REGION domain-containing protein OS=Strigamia maritima OX=126957 PE=3 SV=1)

HSP 1 Score: 333.569 bits (854), Expect = 3.032e-110
Identity = 179/317 (56.47%), Postives = 218/317 (68.77%), Query Frame = 2
Query:   59 MVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPITFSED------AEGEKVYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGDMSNTEE*R 991
            MVSV   +DT HED+IHDAQMD+YG  LA+CSSD SVKIF+V N + +LVA+LKEH+GPVWQV+W+HP FGNLLASC YD+ VII+  +   W K+ +Y  HDSSVNSV W+P EYG +LAC SSDG++SII+  GDG  D KKI +AH IG NAV WAP   +        ++     KR V+GGCD  VKIWKE   RW+EE  L  HSDWVRDVAW P       +IASC Q   V IWT   +  N  W    L  F  VVWH+SWSVTG+ILAVS G+N +SLWK+S+EGQW CIS V +G+G ++   E R
Sbjct:    1 MVSVVNMVDTLHEDMIHDAQMDYYGTKLATCSSDRSVKIFDVKNGSQSLVANLKEHEGPVWQVAWAHPMFGNLLASCSYDRSVIIWKETKTTWTKIYQYTMHDSSVNSVAWAPHEYGLILACASSDGAVSIISSSGDGTWDTKKINNAHTIGCNAVSWAPSMVANSTLEKSGSQRSSTSKRFVTGGCDNLVKIWKEEDDRWVEEQKLEAHSDWVRDVAWAPSIGLPHNIIASCSQDRRVIIWTNDGDIGN-NWTSKVLHTFEDVVWHVSWSVTGNILAVSGGDNKVSLWKESIEGQWKCISDVTKGQGQVAAQSEQR 316          
BLAST of protein SEC13 homolog vs. TrEMBL
Match: A0A401NJJ2 (WD_REPEATS_REGION domain-containing protein OS=Scyliorhinus torazame OX=75743 GN=scyTo_0012841 PE=3 SV=1)

HSP 1 Score: 333.183 bits (853), Expect = 4.213e-110
Identity = 178/315 (56.51%), Postives = 223/315 (70.79%), Query Frame = 2
Query:   59 MVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPI----TFSEDAEGEK--VYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGDMSNTEE 985
            MVSV  ++DT HED+IHDAQMD+YG  LA+CSSD SVKIF+V N    LVADL+ H+GPVWQV+W+HP +GN+LASC YD+K+II+   NG W K+ EY  HDSSVNS+CW+P E+G +LACGSSDG+IS+++  GDG  + KKI +AH IG NAV WAP     +  +   G+K    KR VSGGCD  VKIWKE  G+W E+  L  HSDWVRDVAW P        IASC Q G V IW  C + +   W    L  F  VVWH+SWS+TG+ILAVS G+N +SLWK+S+EGQW CIS VN+G+G +++  E
Sbjct:    1 MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVKNGGQILVADLRGHEGPVWQVAWAHPMYGNILASCSYDRKIIIWKEENGTWDKMYEYTGHDSSVNSLCWAPHEFGLILACGSSDGAISVLSYPGDGQWEMKKISNAHTIGCNAVSWAPAVIPGSLVDQPSGQKPNYVKRFVSGGCDNLVKIWKEEEGQWKEDQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWI-CDDPAGNAWTHKLLHKFNDVVWHVSWSITGNILAVSGGDNKVSLWKESVEGQWVCISDVNKGQGSVTSITE 314          
BLAST of protein SEC13 homolog vs. TrEMBL
Match: A0A0B7BAV5 (WD_REPEATS_REGION domain-containing protein OS=Arion vulgaris OX=1028688 GN=ORF175144 PE=3 SV=1)

HSP 1 Score: 332.798 bits (852), Expect = 4.621e-110
Identity = 182/311 (58.52%), Postives = 224/311 (72.03%), Query Frame = 2
Query:   59 MVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPIT-----FSEDAEGEKVYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGDMSN 976
            MVSV  SIDT HED+IHDAQ+D+YG  LA+CSSD S+K+F+V N    L+  L+ H+GPVWQ++W+HP FGN+LASCGYD+KVII+  +NG W KL EY +HDSSVNSV ++P +YG ML CGSSDGSIS+I+  GDG  D KKI +AH IG NAV WAP T     F   +  ++  KR VSGGCD  VKIW E +G+WIEE  L GHSDWVRDVAW P     + VIASC Q   V IWT   +  +  W   +L  F  VVWHLSWS TG+ILAVS G+N ++LWK+SLEGQW CIS VN+G+G +S+
Sbjct:    1 MVSVINSIDTAHEDMIHDAQLDYYGTKLATCSSDRSIKLFDVSNGQQTLITHLRGHEGPVWQLAWAHPMFGNMLASCGYDRKVIIWKETNGTWGKLYEYSHHDSSVNSVSFAPHQYGLMLVCGSSDGSISVISSTGDGLWDTKKINNAHTIGCNAVSWAPATAPNALFDLQSGQQQTMKRFVSGGCDFLVKIWVEDNGQWIEEQKLEGHSDWVRDVAWAPSVGLPKSVIASCSQDCRVIIWTN--DGVSNTWNPKTLHKFDDVVWHLSWSTTGNILAVSGGDNKVTLWKESLEGQWVCISDVNKGQGQISD 309          
BLAST of protein SEC13 homolog vs. Ensembl Cavefish
Match: sec13 (SEC13 homolog, nuclear pore and COPII coat complex component [Source:NCBI gene;Acc:103043631])

HSP 1 Score: 328.561 bits (841), Expect = 1.004e-111
Identity = 177/315 (56.19%), Postives = 222/315 (70.48%), Query Frame = 2
Query:   59 MVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPI----TFSEDAEGEK--VYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGDMSNTEE 985
            MVSV  ++DT HED+IHDAQMD+YG  LA+CSSD SVKIF+V N    LVADL+ H+GPVWQV+W+HP +GN+LASC YD+KVII+   NG W K+ +Y  H+SSVNS+CW P E+G +LACGSSDG+ISI+T  GDG  D KKI +AH IG NAV WAP     +  +   G+K    KR VSGGCD  VK+WKE  G+W E+  L  HSDWVRDV W P        IASC Q G V IWT C + S   W    L  F  VVWH+SWS+TG+ILAVS G+N ++LWK+S++GQW+CIS VN+ +G +S+  +
Sbjct:    1 MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVKNGGQILVADLRGHEGPVWQVAWAHPTYGNILASCSYDRKVIIWKEENGTWDKMYKYTGHNSSVNSICWGPYEFGLILACGSSDGAISILTYTGDGQWDIKKINNAHTIGCNAVSWAPAVVPGSLIDQPTGQKPLYIKRFVSGGCDNLVKLWKEEDGQWKEDQKLEAHSDWVRDVGWAPSIGLTTSTIASCSQDGRVFIWT-CDDPSGNTWTAKLLHKFNDVVWHVSWSITGNILAVSGGDNKVTLWKESVDGQWSCISDVNKSQGGLSSITD 314          
BLAST of protein SEC13 homolog vs. Ensembl Cavefish
Match: seh1l (SEH1 like nucleoporin [Source:NCBI gene;Acc:103047511])

HSP 1 Score: 110.153 bits (274), Expect = 5.920e-27
Identity = 94/335 (28.06%), Postives = 150/335 (44.78%), Query Frame = 2
Query:   68 VEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNH-NLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVI----IYGPSNGV------WQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVC----WAPITFSEDAEGEKVYKRLVSGGCD-------GEVKIWK--EASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQV--------VWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGDMSN 976
            V  SI   H+D+IHD   DF+GR +A+CSSD SVK+++  +D   +  A  K H G VW+V+W+HP+FG +LASC +D+       I G SN        W K     +  +SV  V ++P   G +LA  S+DG + I       N    +    H I     C    W P          + +  +++ G D       G+V+I++  E + ++ +   L   +D V D+A+ P    +  V+A   +   +         S      T   V            VW +SW++T  +LA S  +  + LWK +    W C + + +G+G   N
Sbjct:    3 VARSIAADHKDLIHDVSYDFHGRRMATCSSDQSVKVWDKSDDGEWHCTASWKTHSGSVWRVTWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKQRGLSHWIKRTTLVDSRTSVTDVKFAPKHMGLVLATCSADGVVRIYEAPDVMN--LSQWSLQHEISCKLSCSCISWNP-------SSSRAHPPMIAVGSDDNNVTYSGKVQIYEYNENTRKYTKAETLMTVTDPVHDIAFAPNLGRSFHVLAIATKDVRIFKLIPLRRESTTSSGPTKFEVQVMAQFDSHNSQVWRVSWNITSTLLASSGDDGCVRLWKANYMDNWKC-TGILRGDGSPVN 327          
BLAST of protein SEC13 homolog vs. Ensembl Cavefish
Match: seh1l (SEH1 like nucleoporin [Source:NCBI gene;Acc:103047511])

HSP 1 Score: 91.6633 bits (226), Expect = 9.844e-21
Identity = 51/129 (39.53%), Postives = 73/129 (56.59%), Query Frame = 2
Query:   68 VEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNH-NLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVI----IYGPSNGV------WQKLKEYCNHDSSVNSVCWSPPEYGPMLA 421
            V  SI   H+D+IHD   DF+GR +A+CSSD SVK+++  +D   +  A  K H G VW+V+W+HP+FG +LASC +D+       I G SN        W K     +  +SV  V ++P   G +LA
Sbjct:    3 VARSIAADHKDLIHDVSYDFHGRRMATCSSDQSVKVWDKSDDGEWHCTASWKTHSGSVWRVTWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKQRGLSHWIKRTTLVDSRTSVTDVKFAPKHMGLVLA 131          
BLAST of protein SEC13 homolog vs. Ensembl Cavefish
Match: ciao1 (cytosolic iron-sulfur assembly component 1 [Source:NCBI gene;Acc:103047369])

HSP 1 Score: 68.9366 bits (167), Expect = 8.699e-13
Identity = 73/270 (27.04%), Postives = 118/270 (43.70%), Query Frame = 2
Query:  131 GRFLASCSSDSSVKIFEVFNDNHNLVADLKE-HQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQC------AEYSNGQWQ-QTSLPVF-PQVVWHLSWSVTGDILAVSSGENNISLWKQ 913
            G  LASC  D +V+I+    D+    + L + HQ  V +V+WS    GN LAS  +D    I+   N  ++ L     H++ V  V W+P   G MLA  S D S+ I  +  +   +   + ++H   +  V W P             + L S   D +V I+KE    W     L GH+  V  +++ P        +ASC     V IW +C       + S   W+   +L  F  + V+ ++W      LA + G++ I ++K+
Sbjct:   28 GSLLASCGGDRAVRIWGKEGDSWECKSVLSDGHQRTVRKVAWS--PCGNYLASASFDATTCIWKKKNDDFECLTVLEGHENEVKCVAWAPS--GNMLATCSRDKSVWIWEVDEEDEYECVSVVNSHTQDVKHVVWHP-----------TQELLASASYDNKVCIYKEEDDDWECRATLEGHTSTVWSLSFDP----EGHRLASCSDDRTVKIWKECTPGDGEGDGSTDTWKCACTLSGFHSRTVYDVAWDRLTGALATACGDDGIRVFKE 278          

HSP 2 Score: 58.151 bits (139), Expect = 3.548e-9
Identity = 75/270 (27.78%), Postives = 110/270 (40.74%), Query Frame = 2
Query:  185 FNDNHNLVADLKEH-QGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQ-KLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFK--KICDAHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCDGEVKIWK-EASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQ-QTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGDMSN 976
              D   LV  L  H     W V+W +P+ G+LLASCG D+ V I+G     W+ K      H  +V  V WSP   G  LA   S    +   I    N DF+   + + H   +  V WAP               L +   D  V IW+ +    +   +V+  H+  V+ V W P     Q+++AS      V I+ +     +  W+ + +L      VW LS+   G  LA  S +  + +WK+   G          GEGD S 
Sbjct:    1 MKDTVELVQRLSAHPDSRCWYVAW-NPK-GSLLASCGGDRAVRIWGKEGDSWECKSVLSDGHQRTVRKVAWSP--CGNYLA---SASFDATTCIWKKKNDDFECLTVLEGHENEVKCVAWAPSG-----------NMLATCSRDKSVWIWEVDEEDEYECVSVVNSHTQDVKHVVWHP----TQELLASASYDNKVCIYKE----EDDDWECRATLEGHTSTVWSLSFDPEGHRLASCSDDRTVKIWKECTPG---------DGEGDGST 235          

HSP 3 Score: 49.2914 bits (116), Expect = 3.075e-6
Identity = 61/220 (27.73%), Postives = 92/220 (41.82%), Query Frame = 2
Query:   92 HEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYG-PSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCDGEVKIWKE----------ASGRWIEETVLRG-HSDWVRDVAWCPMTSS 715
            H+  +        G +LAS S D++  I++  ND+   +  L+ H+  V  V+W+    GN+LA+C  DK V I+       ++ +    +H   V  V W P +   +LA      +     +     +D    C A   G  +  W   + S D EG     RL S   D  VKIWKE          ++  W     L G HS  V DVAW  +T +
Sbjct:   60 HQRTVRKVAWSPCGNYLASASFDATTCIWKKKNDDFECLTVLEGHENEVKCVAWA--PSGNMLATCSRDKSVWIWEVDEEDEYECVSVVNSHTQDVKHVVWHPTQ--ELLA-----SASYDNKVCIYKEEDDDWECRATLEGHTSTVW---SLSFDPEGH----RLASCSDDRTVKIWKECTPGDGEGDGSTDTWKCACTLSGFHSRTVYDVAWDRLTGA 263          
BLAST of protein SEC13 homolog vs. Ensembl Cavefish
Match: snrnp40 (small nuclear ribonucleoprotein U5 subunit 40 [Source:NCBI gene;Acc:103032740])

HSP 1 Score: 62.7734 bits (151), Expect = 1.176e-10
Identity = 71/280 (25.36%), Postives = 117/280 (41.79%), Query Frame = 2
Query:   92 HEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIW--------TQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLW 907
            HE  ++  +    G  LAS   D  + ++ V+ D  N  A LK H G V ++ ++    G+LL S   DK V ++    G  +++K    H S VNS C+ P   GP LAC  SD     +        D +K    H    N      +TF++ ++      +++SGG D ++K+W     + I    ++GH D V  ++     SS    + S      V +W         +C +   G         F + +   SWS  G  +A  S +  + +W
Sbjct:   55 HEGEVYCCKFHPNGAMLASAGYDRLILLWSVYGDCENF-ATLKGHSGAVMELHYNTD--GSLLYSASTDKTVCVWDSETG--ERVKRLKGHTSFVNS-CF-PARRGPQLACTGSDDGTVKLW-------DIRKKASVHTFQ-NTYQVLSVTFNDTSD------QIISGGIDNDIKVWDLRQNKLIYS--MQGHGDSVTGLSL----SSEGSYLLSNSMDNSVRVWDIRPFAPKERCVKIFQGNVHN-----FEKNLLRCSWSSDGSKIAAGSADRFVYVW 302          
BLAST of protein SEC13 homolog vs. Ensembl Sea Lamprey
Match: sec13 (SEC13 homolog, nuclear pore and COPII coat complex component [Source:ZFIN;Acc:ZDB-GENE-040426-2649])

HSP 1 Score: 145.976 bits (367), Expect = 2.974e-43
Identity = 75/155 (48.39%), Postives = 95/155 (61.29%), Query Frame = 2
Query:  509 IGINAVCWAPITFSEDAE------GEKVYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQ 955
            IG NAV W P+             G+K  +R VSGGCD  VKIW+E  G+W+EE  L  HSDWVRDVAW P        IASC Q G V +W +C + S   W    L  F  VVWH+SWS+TG ILAVS G+N ++LW++S +GQW C+S V++
Sbjct:    1 IGCNAVSWGPVMAPMGGGTPQGPCGQKPIRRFVSGGCDNLVKIWREKDGQWVEEQKLEAHSDWVRDVAWAPSIGLPISTIASCAQDGRVYVW-RCEDPSGSSWVAKLLHKFGDVVWHVSWSITGSILAVSGGDNRVTLWQESQQGQWVCVSDVDK 154          
BLAST of protein SEC13 homolog vs. Ensembl Sea Lamprey
Match: sec13 (SEC13 homolog, nuclear pore and COPII coat complex component [Source:ZFIN;Acc:ZDB-GENE-040426-2649])

HSP 1 Score: 139.428 bits (350), Expect = 1.993e-41
Identity = 62/111 (55.86%), Postives = 83/111 (74.77%), Query Frame = 2
Query:   62 VSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWS 394
            V+V  S++T H D+IHDAQMD+YG  LA+CSSD +VKIF++ N    LVADL+ H+GPVWQV+W+H  +GN+LASC YD+KVII+      W+++ EY  H+SSV   CWS
Sbjct:    2 VTVVNSVETAHLDMIHDAQMDYYGNRLATCSSDRTVKIFDIRNGEQILVADLRGHEGPVWQVAWAHAMYGNVLASCAYDRKVIIWREEGDAWERIYEYAGHESSVLGRCWS 112          
BLAST of protein SEC13 homolog vs. Ensembl Sea Lamprey
Match: seh1l (SEH1-like (S. cerevisiae) [Source:NCBI gene;Acc:334749])

HSP 1 Score: 89.7373 bits (221), Expect = 1.933e-21
Identity = 49/126 (38.89%), Postives = 71/126 (56.35%), Query Frame = 2
Query:   77 SIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNH-NLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIY----GPSNGV------WQKLKEYCNHDSSVNSVCWSPPEYGPMLA 421
            SI   H+D+IHD   DF+G+ LA+CSSD SVK+++          A  K H G VW+V+W+HP+FG LLASC +D+  +++    G SN        W K     +  +SV  V ++P   G +LA
Sbjct:    6 SIAAEHKDLIHDVSYDFHGQRLATCSSDQSVKVWDRNESGEWKCTASWKTHSGSVWRVTWAHPEFGQLLASCSFDRTAVVWEEIVGESNDRQRSQSHWVKRTTLVDSRTSVTDVKFAPKHLGLVLA 131          
BLAST of protein SEC13 homolog vs. Ensembl Sea Lamprey
Match: pafah1b1b (platelet-activating factor acetylhydrolase 1b, regulatory subunit 1b [Source:NCBI gene;Acc:394247])

HSP 1 Score: 60.077 bits (144), Expect = 1.602e-10
Identity = 74/288 (25.69%), Postives = 119/288 (41.32%), Query Frame = 2
Query:   92 HEDIIHDAQMDFYGRFLASCSSDSSVKI-----FEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLA-CXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAP---------ITFSEDAEGEKVYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWK 910
            H D + D   D  G+ LASCS+D +VK+     FE     H        H   V  V++  P  G+ L S   DK + ++    G    +K +  H   V  V   P + G ++A C +       +T   +   + ++    H   +  V WAP          T +E  +G K    L+SG  D  +K+W  ++G  I    L GH +WVR V + P      + I SC     + +W    +Y N + Q+ SL      V  L +  T   +   S + ++ +W+
Sbjct:   88 HTDSVQDISFDLSGKMLASCSADMTVKLWDFQSFECLRTMHG-------HDHNVSSVAFM-PN-GDHLVSASRDKTMKMWEVQTGYC--VKTFTGHREWVRMV--RPNQDGSLIASCSNDQTVRVWVTATKECKAELRE----HEHVVECVSWAPDAASPVILEATGAEAKKGGKPGPYLLSGSRDKTIKMWDISTG--ICVITLVGHDNWVRGVLFHP----GGKFILSCADDKTLRVW----DYKNKRCQK-SLAAHEHFVTSLDFHKTAPYVITGSVDQSVKVWE 347          
BLAST of protein SEC13 homolog vs. Ensembl Sea Lamprey
Match: ciao1 (cytosolic iron-sulfur assembly component 1 [Source:NCBI gene;Acc:795104])

HSP 1 Score: 58.5362 bits (140), Expect = 5.038e-10
Identity = 67/292 (22.95%), Postives = 123/292 (42.12%), Query Frame = 2
Query:  131 GRFLASCSSDSSVKIFEVFNDN---HNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNG---------QWQ--QTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEG 964
            G  +ASC  D +V+++    D     +++AD   HQ  V  V+WS    G  LAS  +D    ++   +G ++       H++ V  V W+P   G +LA  S D S+ I  +  + + +   + ++H   +  V W P +           + L S   D  +++++E    W     L GH   V    W     +  + + SC     + IW + A  S+G          W+   T      +V++ +SW      +A +SG++ I ++++          AV +G+G
Sbjct:   27 GALIASCGGDKTVRVWGREGDGWVCRSVLADA--HQRTVRNVAWS--PCGTRLASASFDATTCVWSRRDGDFEVTATLEGHENEVKGVAWAPS--GNLLATCSRDKSVWIWEVDEEEDYECASVLNSHTQDVKHVVWHPNS-----------EVLASASYDNSIRLYREDGDDWSSFATLEGHESTV----WSIDFDATGRRLVSCGDDKTIRIWQEGAATSSGGCICVAVGATWECVCTLSGHHTRVIYDVSWCKLTGAIATASGDDTIRVFEE---------EAVPEGDG 288          

HSP 2 Score: 53.5286 bits (127), Expect = 2.119e-8
Identity = 59/240 (24.58%), Postives = 85/240 (35.42%), Query Frame = 2
Query:  215 LKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWT-------QCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQ 913
            L  HQ   W V+WS    G L+ASCG DK V ++G     W               VC S                                + DAH   +  V W+P              RL S   D    +W    G +     L GH + V+ VAW P    +  ++A+C +   V IW        +CA   N   Q          V H+ W    ++LA +S +N+I L+++
Sbjct:   11 LAGHQDRAWSVAWSPS--GALIASCGGDKTVRVWGREGDGW---------------VCRSV-------------------------------LADAHQRTVRNVAWSPCG-----------TRLASASFDATTCVWSRRDGDFEVTATLEGHENEVKGVAWAP----SGNLLATCSRDKSVWIWEVDEEEDYECASVLNSHTQD---------VKHVVWHPNSEVLASASYDNSIRLYRE 178          
BLAST of protein SEC13 homolog vs. Ensembl Yeast
Match: SEC13 (Structural component of 3 complexes; subunit of the Nup84p nuclear pore subcomplex that contributes to nucleocytoplasmic transport and NPC biogenesis; subunit of the COPII vesicle coat required for ER-to-Golgi transport; subunit of SEACAT, a subcomplex of the coatomer-related, vacuolar-associated SEA complex, that inhibits the TORC1 inhibitory role of SEACIT (Iml1p-Npr2p-Npr3p), a GAP for Gtr1p, thereby resulting in activation of TORC1 signaling; human SEC13 homolog [Source:SGD;Acc:S000004198])

HSP 1 Score: 256.529 bits (654), Expect = 1.011e-84
Identity = 141/300 (47.00%), Postives = 193/300 (64.33%), Query Frame = 2
Query:   74 VSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPITFSEDAE--GEKVYKRLVSGGCDGEVKIWKEASG--RWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLP--VFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQ 955
            V I   H ++IHDA +D+YG+ LA+CSSD ++KIFEV  + H L+  L  H+GPVW+V W+HP+FG +LASC YD KV+I+   NG W ++  +  H +SVNSV W+P EYGP+L   SSDG +S++    +G      I DAH IG+N+  WAP T  ED E  G K  ++ V+GG D  VKIWK  S    ++ E+ L GHSDWVRDVAW P T   +  +AS  Q     IWTQ  E   G W++T L    FP V+W  SWS++G++LA+S G+N ++LWK++LEG+W     V+Q
Sbjct:    2 VVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLVASSDGKVSVVEFKENGTTS-PIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSP-TVLLRSYLASVSQDRTCIIWTQDNE--QGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ 297          
BLAST of protein SEC13 homolog vs. Ensembl Yeast
Match: SEH1 (Subunit of the Nup84 nuclear pore and SEACAT subcomplexes; involved in nucleocytoplasmic transport and NPC biogenesis in the nuclear pore subcomplex; subunit of SEACAT, a subcomplex of the SEA complex that inhibits the TORC1 inhibitory role of SEACIT (Iml1p-Npr2p-Npr3p), a GAP for Gtr1p in response to amino acid limitation, thereby resulting in activation of TORC1 signaling; SEA is a coatomer-related complex that associates dynamically with the vacuole; human SEH1 homolog [Source:SGD;Acc:S000003068])

HSP 1 Score: 94.3597 bits (233), Expect = 2.688e-22
Identity = 84/357 (23.53%), Postives = 147/357 (41.18%), Query Frame = 2
Query:   80 IDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHN--LVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGP-------SNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXX---------XXXXNQDFKKICDAHNIGIN-AVCWAPITFSEDA------EGEKVYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYS-----------------------------NGQWQQTSLPVFPQV------------VWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVN 952
             D+ H+D++HD   DFYGR +A+CSSD  +K+F++  D  N  L    + H   +  + W+ P++G ++AS  YDK V ++         S   W KL    +   S+ SV ++P   G  LAC  +DG + +                      I  A+++  +  + W P  FS +       E   +Y+R    G DG++ +  +          L GH   +R ++W P      Q+IA+  + G + I+    + S                             +   ++  L    QV            VW +SW++TG IL+ +  +  + LWK +   ++ C+S + 
Sbjct:    4 FDSGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASPEYGRIIASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAHLGLKLACLGNDGILRLYDALEPSDLRSWTLTSEMKVLSIPPANHLQSDFCLSWCPSRFSPEKLAVSALEQAIIYQR----GKDGKLHVAAK----------LPGHKSLIRSISWAPSIGRWYQLIATGCKDGRIRIFKITEKLSPLASEESLTNSNMFDNSADVDMDAQGRSDSNTEEKAELQSNLQVELLSEHDDHNGEVWSVSWNLTGTILSSAGDDGKVRLWKATYSNEFKCMSVIT 346          
BLAST of protein SEC13 homolog vs. Ensembl Yeast
Match: CIA1 (Component of cytosolic iron-sulfur protein assembly (CIA) machinery; acts at late step of Fe-S cluster assembly; forms CIA targeting complex with Cia2p and Met18p that directs Fe-S cluster incorporation into subset of proteins involved in methionine biosynthesis, DNA replication and repair, transcription, telomere maintenance; contains WD40 repeats; human homolog CIAO1 can complement yeast cia1 null mutant [Source:SGD;Acc:S000002675])

HSP 1 Score: 50.8322 bits (120), Expect = 1.137e-7
Identity = 66/288 (22.92%), Postives = 106/288 (36.81%), Query Frame = 2
Query:  119 MDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKE--HQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGV-----WQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQT--GHVNIWTQCAEYSNGQWQQTSLPVFPQV----VWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCIS 943
             DF    LA+ S+D  +K+  V  D+  L+  L E  H+  +  V+W  P   +LLA+  +D  V I+              L     H++ V  V WS   Y  +  C          T       +   +   H+  +  V W P   SE          L S   D  V+IWK+    W    VL GH   V    W       + V   C  +    V +W    +  + Q +     + P V    V++++W   G  L  S G + +    + ++G+W   +
Sbjct:   20 FDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAW-RPH-TSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY-YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP---SE--------ALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTV----WSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNG--LIASVGADGVLAVYEEVDGEWKVFA 287          
BLAST of protein SEC13 homolog vs. Ensembl Nematostella
Match: EDO39456 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9W6])

HSP 1 Score: 332.028 bits (850), Expect = 1.031e-113
Identity = 176/308 (57.14%), Postives = 218/308 (70.78%), Query Frame = 2
Query:   59 MVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAP------ITFSEDAEGEKVYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEG 964
            MV++  ++DT HED++HDAQMD+YG+ LA+CSSD +++IFE       LVA L+ H GPVWQVSWSHP FGNLLASC YD+KVII+  S+  W KL+E+CNHDSSVNS+CW+P EYG MLACG+SDGS+SII+  GDG  + KKI +AH IG NAV WAP      I     ++   + KR V+GGCD  VKIW+E  G+W+EE  L  HSDWVRDVAW P        IASC Q   V IW++  E   G W    L  F  VVWH+SWSVTG+ILAVS G+N +SLWK+SLEGQW C+S V++G G
Sbjct:    1 MVTILNTVDTSHEDMVHDAQMDYYGKKLATCSSDKTIRIFETTGQQQTLVATLRGHDGPVWQVSWSHPMFGNLLASCSYDRKVIIWKESSSGWVKLQEFCNHDSSVNSICWAPHEYGLMLACGASDGSVSIISSPGDGTWETKKISNAHTIGCNAVSWAPAVTPGSILEHPASKSSNLEKRFVTGGCDNLVKIWRETGGQWVEEQKLEAHSDWVRDVAWAPNVGLPTSTIASCSQDCRVIIWSRNEEEGEG-WSSKVLKKFNDVVWHVSWSVTGNILAVSGGDNKVSLWKESLEGQWVCVSDVDKGHG 307          
BLAST of protein SEC13 homolog vs. Ensembl Nematostella
Match: EDO31822 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWT9])

HSP 1 Score: 90.5077 bits (223), Expect = 1.019e-21
Identity = 48/133 (36.09%), Postives = 77/133 (57.89%), Query Frame = 2
Query:   56 VMVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNH-NLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPS----------NGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLA 421
            + V+ E+S D  H+D+IHD   DF+GR +A+CSSD SVK++++  D      A+ K H G VW+V+W+HP+FG +LASC +D+ V ++             + ++ K     +  +SV  V ++P   G  LA
Sbjct:    1 MFVAREISAD--HKDLIHDVSYDFHGRRMATCSSDQSVKVWDLGEDGEWRCTANWKTHSGSVWKVTWAHPEFGQVLASCSFDRTVAVWEEQGKTCSSSYMLDRLFVKRTSLVDSRTSVTDVKFAPRHLGLQLA 131          
BLAST of protein SEC13 homolog vs. Ensembl Nematostella
Match: EDO41896 (Lissencephaly-1 homolog [Source:UniProtKB/Swiss-Prot;Acc:A7S338])

HSP 1 Score: 52.373 bits (124), Expect = 1.366e-7
Identity = 70/284 (24.65%), Postives = 115/284 (40.49%), Query Frame = 2
Query:   92 HEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLA-CXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAP------ITFSEDAEGEKVYKR----LVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWK 910
            H D + D   D  G+FLAS S+D ++K+++        +  L  H   V  +S+     G+ L S   DK + ++  + G    +K +  H   V  V   P   G ++A C +       +    +   D +     H+  I  + WAP      I  +   EG K        LVS   D  +KIW  ++G  +    L GH +WVR V + P      + I SC     + IW    +Y N +  +T L      V  L +  +   +A  S +  + +W+
Sbjct:  147 HTDAVQDLAFDHTGKFLASSSADMTIKLWDF--QGFECIRTLHGHDHNVSSISFL--PSGDHLVSASRDKTIKMWEIATGYC--VKTFQGHGEWVRRV--RPNADGSLIASCSNDQTIRVWVVASRECKCDLRD----HDHVIEDLNWAPESATPVINEAAGVEGGKKAMSPGPFLVSASRDKSIKIWDVSAGVCL--VTLVGHDNWVRAVMFHP----GGKFIVSCSDDKTLRIW----DYKNKRCAKT-LVAHEHFVTTLDFHKSAPFVATGSVDLTLKVWE 407          
BLAST of protein SEC13 homolog vs. Ensembl Nematostella
Match: EDO29288 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T426])

HSP 1 Score: 50.0618 bits (118), Expect = 2.918e-7
Identity = 54/227 (23.79%), Postives = 96/227 (42.29%), Query Frame = 2
Query:   92 HEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFK--KICDAHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIW 766
            H   +    +D   +FL SCS D +++++ +F     LVA  + H  PVW V +  P+ G+  AS  +D+   ++   +   Q L+ +  H S VN V + P        C       S  T+     Q     ++   H   + +     + FS +       + L+S G D  + +W  A G  + E  L+GH+D V  + +    S +  ++AS      + +W
Sbjct:   20 HSGPVFAVSIDHDNKFLLSCSEDKTIRLWSLFTFT-TLVA-YRGHNYPVWDVQFC-PR-GHYFASTSHDRTARLWSTDHQ--QPLRIFAGHVSDVNKVAFHPN-------CNYIATGSSDRTVRLWDIQTGSSVRLFTGHKAAVQS-----LAFSRNG------RHLISSGVDTRLLVWDLAEGTLVAE--LKGHTDTVYSLCF----SRDGTILASAGLDNCIKLW 216          
BLAST of protein SEC13 homolog vs. Ensembl Nematostella
Match: EDO44295 (Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog [Source:UniProtKB/Swiss-Prot;Acc:A7RWD2])

HSP 1 Score: 50.0618 bits (118), Expect = 5.499e-7
Identity = 66/288 (22.92%), Postives = 110/288 (38.19%), Query Frame = 2
Query:   86 TRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKE-HQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQ---------CAEYSNGQWQQTSL--PVFPQVVWHLSWSVTGDILAVSSGENNISLWKQ 913
            T HED +        G  LASC  D +++I+    D       L++ HQ  +  + WS    G  LAS  +D    I+   +G ++       H++ V SV WS    G +LA    D S+ I  +  D   +   +  +H   +  V W P             + L S   D  +K++KE    W     L GH        W      +   I SC     V IW                + +W+   +      + ++ + WS    ++A +SG++ I ++K+
Sbjct:    2 TGHEDRVWSVAWSPNGFVLASCGGDKTIRIWGKEGDKWICKTILEDGHQRTIRSLGWS--PCGTFLASASFDATTCIWDQKSGEFECNATLEGHENEVKSVDWSVS--GSLLATCGRDKSVWIWEVQEDDEYECASVIHSHTQDVKKVVWHP-----------TKEILASCSYDDTIKLYKEDEDDWSCCDTLEGH----ESTVWSISFDGSGDRIVSCSDDKTVRIWKSYPPGNQEGVVVSGKHTKWKCVCVLSGYHDRTIYDVHWSKVSGLIATASGDDCIRIFKE 270          

HSP 2 Score: 47.3654 bits (111), Expect = 3.660e-6
Identity = 52/182 (28.57%), Postives = 77/182 (42.31%), Query Frame = 2
Query:  134 RFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVII---YGPSN-------GVWQKLKEYC----NHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQ-DFKKIC---DAHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCDGEVKIWK 625
              LASCS D ++K+++   D+ +    L+ H+  VW +S+     G+ + SC  DK V I   Y P N       G   K K  C     HD ++  V WS        A G     I       D NQ  F+ +     AH++ +N++CW P          K    L +   DG VK+W+
Sbjct:  152 EILASCSYDDTIKLYKEDEDDWSCCDTLEGHESTVWSISFDGS--GDRIVSCSDDKTVRIWKSYPPGNQEGVVVSGKHTKWKCVCVLSGYHDRTIYDVHWSKVSGLIATASGDDCIRIFKEDTNSDRNQPSFQLVATQRKAHSMDVNSICWHP----------KDENILATCSDDGTVKLWR 321          

HSP 3 Score: 46.595 bits (109), Expect = 7.298e-6
Identity = 38/159 (23.90%), Postives = 70/159 (44.03%), Query Frame = 2
Query:  500 AHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCDGEVKIWKEASGRWIEETVLR-GHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQ-QTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGDM 970
             H   + +V W+P  F            L S G D  ++IW +   +WI +T+L  GH   +R + W P  +     +AS        IW Q     +G+++   +L      V  + WSV+G +LA    + ++ +W+   + ++ C S ++    D+
Sbjct:    3 GHEDRVWSVAWSPNGFV-----------LASCGGDKTIRIWGKEGDKWICKTILEDGHQRTIRSLGWSPCGT----FLASASFDATTCIWDQ----KSGEFECNATLEGHENEVKSVDWSVSGSLLATCGRDKSVWIWEVQEDDEYECASVIHSHTQDV 142          
BLAST of protein SEC13 homolog vs. Ensembl Medaka
Match: sec13 (SEC13 homolog, nuclear pore and COPII coat complex component [Source:NCBI gene;Acc:101160872])

HSP 1 Score: 330.872 bits (847), Expect = 1.034e-112
Identity = 176/315 (55.87%), Postives = 221/315 (70.16%), Query Frame = 2
Query:   59 MVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPI----TFSEDAEGEK--VYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGDMSNTEE 985
            MVSV  ++DT HED+IHDAQMD+YG  LA+CSSD +VKIF+V N    LVADL+ H+GPVWQV+W+HP FGN+LASC YD+KVI++   NG W K+ EY  H+SSVNSVCW P E+G +LACGSSDG+IS++T+ GD   D KKI +AH IG NAV WAP     +  +   G+K    KR VSGGCD  VK+WKE  G+W E+  L  HSDWVRDV W P        IASC Q G V IWT C + +   W    L  F  VVWH+SWS+TG+ILAVS G+N ++LWK+S+EGQW CIS V++G+G +S   +
Sbjct:    1 MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRTVKIFDVRNGGQILVADLRGHEGPVWQVAWAHPMFGNILASCSYDRKVIVWKEENGAWDKMYEYTGHESSVNSVCWGPYEFGLILACGSSDGAISLLTLTGDQQWDVKKISNAHTIGCNAVSWAPAVVPGSLIDQPSGQKPNYVKRFVSGGCDNLVKLWKEEDGQWKEDQKLEAHSDWVRDVGWAPSIGLPTSTIASCSQDGRVFIWT-CDDPAGNTWTAKLLHKFNDVVWHVSWSITGNILAVSGGDNKVTLWKESMEGQWACISDVSKGQGAVSTITD 314          
BLAST of protein SEC13 homolog vs. Ensembl Medaka
Match: seh1l (SEH1 like nucleoporin [Source:NCBI gene;Acc:101167897])

HSP 1 Score: 100.138 bits (248), Expect = 1.592e-23
Identity = 89/312 (28.53%), Postives = 141/312 (45.19%), Query Frame = 2
Query:   68 VEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNL-VADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVI----IYGPSNGV------WQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVC----WAPITFSEDAEGEKVYKRLVSGGCD-------GEVKIWK--EASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHV-NIWTQCAEYSNGQWQQTSLPVFPQV------VWHLSWSVTGDILAVSSGENNISLWK 910
            V  SI   H+D+IHD   DF+GR +A+CSSD SVK+++       L  A  K H G VW+V+W+HP+FG +LASC +D+       I G SN        W K     +  +SV  V ++P   G ML   S+DG + I       N    +    H I     C    W P          + +  + + G D       G+V+I++  E + ++ +   L   +D V D+A+ P    +  V+A   +   +  +     E S+    +  + +  Q       VW +SW++T  +LA S  +  + LWK
Sbjct:    3 VARSIAADHKDLIHDVSYDFHGRRMATCSSDQSVKVWDKSESGEWLCTASWKTHSGSVWRVTWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKQRGLSHWIKRTTLVDSRTSVTDVKFAPKHMGLMLTTCSADGVVRIYEAPDVMN--LSQWSLQHEISCKLSCSCISWNP-------SSSRAHPSMFAVGSDDSNIASGGKVQIYEYNENTRKYGKVETLMTVTDAVHDIAFAPNLGRSFHVLAIATKDVRIFKLAPMRKESSSTGPSKFEVQIVAQFDNHNSQVWRVSWNITSTLLASSGDDGCVRLWK 305          
BLAST of protein SEC13 homolog vs. Ensembl Medaka
Match: ciao1 (cytosolic iron-sulfur assembly component 1 [Source:NCBI gene;Acc:101175410])

HSP 1 Score: 65.4698 bits (158), Expect = 1.276e-11
Identity = 69/269 (25.65%), Postives = 116/269 (43.12%), Query Frame = 2
Query:  131 GRFLASCSSDSSVKIFEVFNDN---HNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQC-AEYSNGQWQ--QTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSL 919
            G  LASC  D +++I+    D+    N++ D   HQ  V +V+WS    GN LAS  +D    I+   N  ++ L     H++ V  V W+P   G +LA  S D S+ +  +  +   +   + ++H   +  V W P             + L S   D  + I+KE    W     L+GH+  V    W        Q +ASC     V IW +  +E  +  W+   T      + V+ ++W      LA + G++ I ++++ L
Sbjct:   28 GALLASCGGDKAIRIWGQEGDSWVCKNVLQD--GHQRTVRKVAWS--PCGNYLASASFDATTCIWKKKNDDFESLTVLEGHENEVKCVAWAPS--GTLLATCSRDKSVWVWEVDEEDEYECVTVVNSHTQDVKHVVWHP-----------TQELLASASYDNNICIYKEEDDDWECRATLQGHTSTV----WSLCFDVTGQRLASCSDDRTVKIWKEYPSESGDLSWKCVCTLSGYHGRTVYDIAWCRLTGALATACGDDAIRVFREDL 275          

HSP 2 Score: 51.6026 bits (122), Expect = 5.068e-7
Identity = 63/252 (25.00%), Postives = 95/252 (37.70%), Query Frame = 2
Query:  200 NLVADLKEH-QGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVN 952
            +LV  L  H     W VSWS    G LLASCG DK + I+G     W               VC +  +                               D H   +  V W+P               L S   D    IWK+ +  +   TVL GH + V+ VAW P  +    ++A+C +   V +W    +  +     T +    Q V H+ W  T ++LA +S +NNI ++K+  +  W C + + 
Sbjct:    6 SLVQKLSAHPDSRCWFVSWSPS--GALLASCGGDKAIRIWGQEGDSW---------------VCKNVLQ-------------------------------DGHQRTVRKVAWSPCG-----------NYLASASFDATTCIWKKKNDDFESLTVLEGHENEVKCVAWAPSGT----LLATCSRDKSVWVWE--VDEEDEYECVTVVNSHTQDVKHVVWHPTQELLASASYDNNICIYKEE-DDDWECRATLQ 191          
BLAST of protein SEC13 homolog vs. Ensembl Medaka
Match: ciao1 (cytosolic iron-sulfur assembly component 1 [Source:NCBI gene;Acc:101175410])

HSP 1 Score: 65.0846 bits (157), Expect = 2.297e-11
Identity = 69/269 (25.65%), Postives = 116/269 (43.12%), Query Frame = 2
Query:  131 GRFLASCSSDSSVKIFEVFNDN---HNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQC-AEYSNGQWQ--QTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSL 919
            G  LASC  D +++I+    D+    N++ D   HQ  V +V+WS    GN LAS  +D    I+   N  ++ L     H++ V  V W+P   G +LA  S D S+ +  +  +   +   + ++H   +  V W P             + L S   D  + I+KE    W     L+GH+  V    W        Q +ASC     V IW +  +E  +  W+   T      + V+ ++W      LA + G++ I ++++ L
Sbjct:  106 GALLASCGGDKAIRIWGQEGDSWVCKNVLQD--GHQRTVRKVAWS--PCGNYLASASFDATTCIWKKKNDDFESLTVLEGHENEVKCVAWAPS--GTLLATCSRDKSVWVWEVDEEDEYECVTVVNSHTQDVKHVVWHP-----------TQELLASASYDNNICIYKEEDDDWECRATLQGHTSTV----WSLCFDVTGQRLASCSDDRTVKIWKEYPSESGDLSWKCVCTLSGYHGRTVYDIAWCRLTGALATACGDDAIRVFREDL 353          

HSP 2 Score: 51.2174 bits (121), Expect = 7.984e-7
Identity = 63/252 (25.00%), Postives = 95/252 (37.70%), Query Frame = 2
Query:  200 NLVADLKEH-QGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVN 952
            +LV  L  H     W VSWS    G LLASCG DK + I+G     W               VC +  +                               D H   +  V W+P               L S   D    IWK+ +  +   TVL GH + V+ VAW P    +  ++A+C +   V +W    +  +     T +    Q V H+ W  T ++LA +S +NNI ++K+  +  W C + + 
Sbjct:   84 SLVQKLSAHPDSRCWFVSWSPS--GALLASCGGDKAIRIWGQEGDSW---------------VCKNVLQ-------------------------------DGHQRTVRKVAWSPCG-----------NYLASASFDATTCIWKKKNDDFESLTVLEGHENEVKCVAWAP----SGTLLATCSRDKSVWVWE--VDEEDEYECVTVVNSHTQDVKHVVWHPTQELLASASYDNNICIYKEE-DDDWECRATLQ 269          
BLAST of protein SEC13 homolog vs. Ensembl Medaka
Match: snrnp40 (small nuclear ribonucleoprotein U5 subunit 40 [Source:NCBI gene;Acc:101156339])

HSP 1 Score: 59.3066 bits (142), Expect = 1.381e-9
Identity = 72/280 (25.71%), Postives = 116/280 (41.43%), Query Frame = 2
Query:   92 HEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIW--------TQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLW 907
            HE  ++  +    G  LAS   D  + ++ VF +  N  A LK H G V ++ ++    G+LL S   DK V I+    G  +++K    H S VN+ C+ P   GP L C  SD     +        D +K    H    N      +TF++ ++      +++SGG D ++K+W     + I    + GHSD V  ++     SS    + S      V IW         +C +   G         F + +   SWS  G  +A  S +  + +W
Sbjct:   55 HEGEVYCCKFHPNGATLASSGFDRLIFLWNVFGECENY-ATLKGHSGAVMELHYNTD--GSLLFSASTDKTVGIWDSETG--ERIKRLKGHTSFVNT-CY-PARRGPQLVCTGSDDGTIKLW-------DIRKKAAIHTFQ-NTYQVLAVTFNDTSD------QILSGGIDNDIKVWDLRQNKLIYN--MHGHSDSVTGLSL----SSEGSYLLSNSMDNTVRIWDVRPFAPKERCVKIFQGNVHN-----FEKNLLRCSWSTDGSKIAAGSADRFVYIW 302          
BLAST of protein SEC13 homolog vs. Planmine SMEST
Match: SMESG000013191.1 (SMESG000013191.1)

HSP 1 Score: 598.201 bits (1541), Expect = 0.000e+0
Identity = 308/309 (99.68%), Postives = 309/309 (100.00%), Query Frame = 2
Query:   59 MVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGDMSNTEE 985
            MVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPS+GVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACGSSDGSISIITILGDGNQDFKKICDAHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGDMSNTEE
Sbjct:    1 MVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSSGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACGSSDGSISIITILGDGNQDFKKICDAHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQGEGDMSNTEE 309          
BLAST of protein SEC13 homolog vs. Planmine SMEST
Match: SMESG000065681.1 (SMESG000065681.1)

HSP 1 Score: 104.375 bits (259), Expect = 5.613e-25
Identity = 84/310 (27.10%), Postives = 140/310 (45.16%), Query Frame = 2
Query:   77 SIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNH-NLVADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIY-----------GPSNGVWQKLKEYCNHDSSVNSVCWSPPEYGPMLACXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCDGEVKIWKEASGRWIEETV--LRGHSDWVRDVAWCPMTSSNQQVIASC----------DQTGHVNIWTQCAEYSNGQWQQT-SLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQW 931
            SID++H D+IHD Q DFYGR +A+CSSD  +K++E+ +DN  +  A L+ H G VW+V+W+HP+FG ++ASCG+D+ + I+            P    W +  +  +  +SV  + ++P   G  LA  S+DG I +       +     +       + A C +  T   D+    +     +G     V I++   G+ I E +  L      V DVA+ P    +    A            ++T  V       + S  + +    L      +W + W+VTG  L+ S  +  I  W ++    W
Sbjct:    6 SIDSQHADLIHDVQYDFYGRRMATCSSDQFIKVWELMDDNEWHCTARLQGHVGSVWRVAWAHPEFGQVIASCGFDRIIAIWEEINNSQNGQSTPGASNWVRRTQLVDPRTSVTDIKFAPKHLGMQLASCSTDGMIRLYEAQDVMDLSQWTLQYDFPTTVTASCLSWSTSPVDSPMLAIGNCKPNGENAPPVLIYELGEGQRIWEHIESLTNIEGAVHDVAFAPYMGQSYHTFAVAADRLYVFYIKEKTAEVTQLAPADKLSKYKIEMAIGLDGCGDKIWRVCWNVTGTTLSSSGEDGTIRFWTRNYLCNW 315          
BLAST of protein SEC13 homolog vs. Planmine SMEST
Match: SMESG000050897.1 (SMESG000050897.1)

HSP 1 Score: 72.0182 bits (175), Expect = 6.382e-14
Identity = 81/282 (28.72%), Postives = 117/282 (41.49%), Query Frame = 2
Query:   92 HEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNL----VADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVII--YGPSNGVWQKLKEY-CNHDSSVNSVCWSPPEYGPMLA-CXXXXXXXXXXXXXXXXNQDFKKICDAHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQC-AEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWK 910
            H D + D   +F G  LASCS D +V+I+   N   N     V D K H   +  VSWS    GN LAS G+D  V I      N +  +  E+  +H   + SV WS    G  LA C              +     + I   H   + +V W PIT             LVS   D  +KI KE    W+EE  L GH   V    W    + +  ++ASC     + +W     EY+             +V++ LSW    ++LA +S +N+I +++
Sbjct:   10 HTDRVWDLSWNFNGSLLASCSGDKTVRIWSFSNSTQNWKCINVLDGK-HTRTIRCVSWS--PCGNYLASAGFDGVVYIEEIVSRNPLEFESTEFPTDHLHEIKSVSWSAS--GNYLASCARDKSVRIFDIEDINSPYCLETI--LHTQDVKSVKWHPIT-----------DILVSSSYDNTIKILKEDGEDWVEEASLTGHLSTV----WTAEFNYDGSILASCSDDKTIRLWVPMNTEYTKWICASVLDGYHERVIFDLSWHDCTNLLATASSDNSICIFR 269          
BLAST of protein SEC13 homolog vs. Planmine SMEST
Match: SMESG000035997.1 (SMESG000035997.1)

HSP 1 Score: 48.521 bits (114), Expect = 3.725e-6
Identity = 39/148 (26.35%), Postives = 64/148 (43.24%), Query Frame = 2
Query:  485 KKICDAHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWT----QCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQS 916
            + +   H   I  V + P+           Y   VSG  D  +KIW   SG +  E  LRGH++ V+D+A+ P    + +++ASC     + +W      C +  +G     S          +S+  +GD L  +S +  I LW+ S
Sbjct:  102 RHVLKGHRASITCVRFHPL-----------YNVFVSGSEDATIKIWDYESGDY--ERTLRGHTNHVQDLAFDP----SGKLLASCSADMQIKLWDFVEFTCVKTLSGHDHNVS---------GVSFMPSGDHLLSASRDKTIKLWEVS 223          
BLAST of protein SEC13 homolog vs. Planmine SMEST
Match: SMESG000054739.1 (SMESG000054739.1)

HSP 1 Score: 48.1358 bits (113), Expect = 5.242e-6
Identity = 39/148 (26.35%), Postives = 64/148 (43.24%), Query Frame = 2
Query:  485 KKICDAHNIGINAVCWAPITFSEDAEGEKVYKRLVSGGCDGEVKIWKEASGRWIEETVLRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWT----QCAEYSNGQWQQTSLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQS 916
            + +   H   I  V + P+           Y   VSG  D  +KIW   SG +  E  LRGH++ V+D+A+ P    + +++ASC     + +W      C +  +G     S          +S+  +GD L  +S +  I LW+ S
Sbjct:   68 RHVLKGHRASITCVRFHPL-----------YNVFVSGSEDATIKIWDYESGDY--ERTLRGHTNHVQDLAFDP----SGKLLASCSADMQIKLWDFVEFTCVKTLSGHDHNVS---------GVSFMPSGDHLLSASRDKTIKLWEVS 189          
The following BLAST results are available for this feature:
BLAST of protein SEC13 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SEC132.488e-10956.09SEC13 homolog, nuclear pore and COPII coat complex... [more]
SEC132.547e-10956.09SEC13 homolog, nuclear pore and COPII coat complex... [more]
SEC131.387e-10856.09SEC13 homolog, nuclear pore and COPII coat complex... [more]
SEC131.233e-10255.70SEC13 homolog, nuclear pore and COPII coat complex... [more]
SEC131.263e-8955.04SEC13 homolog, nuclear pore and COPII coat complex... [more]
back to top
BLAST of protein SEC13 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
npp-204.572e-7342.07pep chromosome:WBcel235:IV:1490653:1496022:-1 gene... [more]
npp-202.670e-4647.89pep chromosome:WBcel235:IV:1490659:1496020:-1 gene... [more]
npp-182.817e-1522.39Nucleoporin SEH1 [Source:UniProtKB/Swiss-Prot;Acc... [more]
back to top
BLAST of protein SEC13 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sec137.795e-9652.48gene:FBgn0024509 transcript:FBtr0084409[more]
Sec137.795e-9652.48gene:FBgn0024509 transcript:FBtr0346160[more]
Nup44A5.097e-2226.30gene:FBgn0033247 transcript:FBtr0088860[more]
Nup44A5.097e-2226.30gene:FBgn0033247 transcript:FBtr0088862[more]
Nup44A5.097e-2226.30gene:FBgn0033247 transcript:FBtr0088861[more]
back to top
BLAST of protein SEC13 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sec131.256e-11255.80SEC13 homolog, nuclear pore and COPII coat complex... [more]
sec131.256e-11255.80SEC13 homolog, nuclear pore and COPII coat complex... [more]
sec131.040e-11156.51SEC13 homolog, nuclear pore and COPII coat complex... [more]
seh1l2.718e-2728.66SEH1-like (S. cerevisiae) [Source:NCBI gene;Acc:33... [more]
snrnp404.756e-1025.00small nuclear ribonucleoprotein 40 (U5) [Source:ZF... [more]
back to top
BLAST of protein SEC13 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sec135.100e-10955.56Fc receptor-like protein 3 [Source:Xenbase;Acc:XB-... [more]
seh1l3.531e-3030.24SEH1 like nucleoporin [Source:NCBI gene;Acc:496570... [more]
seh1l4.479e-3030.24SEH1 like nucleoporin [Source:NCBI gene;Acc:496570... [more]
seh1l4.508e-3030.24SEH1 like nucleoporin [Source:NCBI gene;Acc:496570... [more]
seh1l9.360e-3030.24SEH1 like nucleoporin [Source:NCBI gene;Acc:496570... [more]
back to top
BLAST of protein SEC13 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sec134.407e-10955.45SEC13 homolog, nuclear pore and COPII coat complex... [more]
Seh1l4.372e-2728.19SEH1-like (S. cerevisiae [Source:MGI Symbol;Acc:MG... [more]
Seh1l4.857e-2728.19SEH1-like (S. cerevisiae [Source:MGI Symbol;Acc:MG... [more]
Snrnp402.781e-824.29small nuclear ribonucleoprotein 40 (U5) [Source:MG... [more]
Snrnp402.781e-824.29small nuclear ribonucleoprotein 40 (U5) [Source:MG... [more]
back to top
BLAST of protein SEC13 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P55735|SEC13_HUMAN1.195e-10856.09Protein SEC13 homolog OS=Homo sapiens OX=9606 GN=S... [more]
sp|Q3ZCC9|SEC13_BOVIN2.647e-10855.41Protein SEC13 homolog OS=Bos taurus OX=9913 GN=SEC... [more]
sp|Q9D1M0|SEC13_MOUSE3.083e-10855.45Protein SEC13 homolog OS=Mus musculus OX=10090 GN=... [more]
sp|Q5XFW8|SEC13_RAT6.057e-10855.45Protein SEC13 homolog OS=Rattus norvegicus OX=1011... [more]
sp|Q9V3J4|SEC13_DROME7.814e-9552.48Protein SEC13 homolog OS=Drosophila melanogaster O... [more]
back to top
BLAST of protein SEC13 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JCE97.213e-11558.92protein SEC13 homolog OS=Lingula unguis OX=7574 GN... [more]
A0A3Q3LU542.469e-11056.19SEC13 homolog, nuclear pore and COPII coat complex... [more]
T1JDY63.032e-11056.47WD_REPEATS_REGION domain-containing protein OS=Str... [more]
A0A401NJJ24.213e-11056.51WD_REPEATS_REGION domain-containing protein OS=Scy... [more]
A0A0B7BAV54.621e-11058.52WD_REPEATS_REGION domain-containing protein OS=Ari... [more]
back to top
BLAST of protein SEC13 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sec131.004e-11156.19SEC13 homolog, nuclear pore and COPII coat complex... [more]
seh1l5.920e-2728.06SEH1 like nucleoporin [Source:NCBI gene;Acc:103047... [more]
seh1l9.844e-2139.53SEH1 like nucleoporin [Source:NCBI gene;Acc:103047... [more]
ciao18.699e-1327.04cytosolic iron-sulfur assembly component 1 [Source... [more]
snrnp401.176e-1025.36small nuclear ribonucleoprotein U5 subunit 40 [Sou... [more]
back to top
BLAST of protein SEC13 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sec132.974e-4348.39SEC13 homolog, nuclear pore and COPII coat complex... [more]
sec131.993e-4155.86SEC13 homolog, nuclear pore and COPII coat complex... [more]
seh1l1.933e-2138.89SEH1-like (S. cerevisiae) [Source:NCBI gene;Acc:33... [more]
pafah1b1b1.602e-1025.69platelet-activating factor acetylhydrolase 1b, reg... [more]
ciao15.038e-1022.95cytosolic iron-sulfur assembly component 1 [Source... [more]
back to top
BLAST of protein SEC13 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
SEC131.011e-8447.00Structural component of 3 complexes; subunit of th... [more]
SEH12.688e-2223.53Subunit of the Nup84 nuclear pore and SEACAT subco... [more]
CIA11.137e-722.92Component of cytosolic iron-sulfur protein assembl... [more]
back to top
BLAST of protein SEC13 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO394561.031e-11357.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318221.019e-2136.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418961.366e-724.65Lissencephaly-1 homolog [Source:UniProtKB/Swiss-P... [more]
EDO292882.918e-723.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO442955.499e-722.92Probable cytosolic iron-sulfur protein assembly pr... [more]
back to top
BLAST of protein SEC13 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sec131.034e-11255.87SEC13 homolog, nuclear pore and COPII coat complex... [more]
seh1l1.592e-2328.53SEH1 like nucleoporin [Source:NCBI gene;Acc:101167... [more]
ciao11.276e-1125.65cytosolic iron-sulfur assembly component 1 [Source... [more]
ciao12.297e-1125.65cytosolic iron-sulfur assembly component 1 [Source... [more]
snrnp401.381e-925.71small nuclear ribonucleoprotein U5 subunit 40 [Sou... [more]
back to top
BLAST of protein SEC13 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013191.10.000e+099.68SMESG000013191.1[more]
SMESG000065681.15.613e-2527.10SMESG000065681.1[more]
SMESG000050897.16.382e-1428.72SMESG000050897.1[more]
SMESG000035997.13.725e-626.35SMESG000035997.1[more]
SMESG000054739.15.242e-626.35SMESG000054739.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014117 ID=SMED30014117|Name=protein SEC13 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1033bp
GTTTAAATAATGATTTATTTATTTTGTCATTATTAAATTTTAATAATTAT
TACACGTCATGGTTTCAGTTGAAGTGTCAATTGATACACGACATGAAGAT
ATAATTCATGATGCTCAAATGGATTTTTACGGCCGATTTTTAGCATCCTG
TTCTTCGGATTCATCTGTCAAAATATTTGAAGTTTTCAATGATAATCACA
ATCTTGTTGCCGATTTGAAAGAACACCAGGGTCCAGTTTGGCAAGTTAGT
TGGAGTCATCCACAATTCGGCAATTTATTGGCATCATGTGGTTACGATAA
AAAAGTTATAATATACGGTCCATCGAATGGAGTATGGCAAAAATTAAAGG
AATATTGCAATCATGACAGTTCAGTCAATAGTGTCTGTTGGTCACCGCCA
GAGTATGGGCCGATGCTGGCTTGTGGCAGTTCGGACGGCAGCATATCGAT
CATCACGATATTGGGAGATGGAAATCAAGATTTCAAGAAGATTTGTGATG
CACACAATATTGGAATCAATGCTGTATGCTGGGCTCCGATTACCTTTAGT
GAAGATGCCGAAGGTGAAAAGGTTTATAAACGCCTTGTTTCTGGCGGTTG
CGATGGAGAAGTGAAAATCTGGAAAGAAGCGAGTGGAAGATGGATTGAAG
AAACGGTACTCAGGGGCCACAGTGATTGGGTGCGTGATGTAGCTTGGTGT
CCAATGACGAGCTCCAATCAGCAAGTAATCGCCAGCTGTGACCAAACTGG
CCATGTGAACATTTGGACACAATGTGCTGAGTATAGCAATGGTCAATGGC
AACAGACTTCTCTACCGGTGTTTCCTCAAGTAGTTTGGCATCTTTCCTGG
TCGGTCACCGGGGATATTCTAGCTGTGTCTAGTGGGGAAAATAACATATC
GCTATGGAAACAAAGCCTTGAAGGCCAATGGACATGTATTAGTGCTGTCA
ATCAAGGTGAAGGTGACATGAGCAATACCGAAGAATGAAGAATTATTAAA
TAAATGATTTATCGTTGAAAAAAAAAGATCGGA
back to top

protein sequence of SMED30014117-orf-1

>SMED30014117-orf-1 ID=SMED30014117-orf-1|Name=SMED30014117-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=310bp
MVSVEVSIDTRHEDIIHDAQMDFYGRFLASCSSDSSVKIFEVFNDNHNLV
ADLKEHQGPVWQVSWSHPQFGNLLASCGYDKKVIIYGPSNGVWQKLKEYC
NHDSSVNSVCWSPPEYGPMLACGSSDGSISIITILGDGNQDFKKICDAHN
IGINAVCWAPITFSEDAEGEKVYKRLVSGGCDGEVKIWKEASGRWIEETV
LRGHSDWVRDVAWCPMTSSNQQVIASCDQTGHVNIWTQCAEYSNGQWQQT
SLPVFPQVVWHLSWSVTGDILAVSSGENNISLWKQSLEGQWTCISAVNQG
EGDMSNTEE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005198structural molecule activity
GO:0005515protein binding
GO:0042802identical protein binding
Vocabulary: cellular component
TermDefinition
GO:0030127COPII vesicle coat
GO:0000139Golgi membrane
GO:0005634nucleus
GO:0005635nuclear envelope
GO:0005643nuclear pore
GO:0005654nucleoplasm
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0005829cytosol
GO:0012507ER to Golgi transport vesicle membrane
GO:0016020membrane
GO:0031080nuclear pore outer ring
GO:0031410cytoplasmic vesicle
GO:0043231intracellular membrane-bounded organelle
GO:0043234protein complex
GO:0061700GATOR2 complex
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0090114COPII-coated vesicle budding
GO:1904263positive regulation of TORC1 signaling
GO:0002474antigen processing and presentation of peptide antigen via MHC class I
GO:0006810transport
GO:0006886intracellular protein transport
GO:0006888ER to Golgi vesicle-mediated transport
GO:0007062sister chromatid cohesion
GO:0015031protein transport
GO:0016192vesicle-mediated transport
GO:0019886antigen processing and presentation of exogenous peptide antigen via MHC class II
GO:0032008positive regulation of TOR signaling
GO:0048208COPII vesicle coating
GO:0051028mRNA transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR037363Sec13/Seh1_fam
IPR037596Sec13
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 2..41
e-value: 0.22
score: 20.6
coord: 194..237
e-value: 6.1E-4
score: 29.1
coord: 245..284
e-value: 0.75
score: 17.8
coord: 92..133
e-value: 1.1E-4
score: 31.6
coord: 139..189
e-value: 0.0016
score: 27.7
coord: 46..87
e-value: 2.5E-5
score: 33.7
IPR001680WD40 repeatPFAMPF00400WD40coord: 50..86
e-value: 0.21
score: 12.5
coord: 12..40
e-value: 0.093
score: 13.6
coord: 199..236
e-value: 0.013
score: 16.3
coord: 93..131
e-value: 0.0018
score: 19.1
coord: 144..189
e-value: 0.059
score: 14.3
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 1..299
e-value: 6.1E-99
score: 333.0
IPR037363Sec13/Seh1 familyPANTHERPTHR11024NUCLEAR PORE COMPLEX PROTEIN SEC13 / SEH1 FAMILY MEMBERcoord: 6..298
IPR037596Protein Sec13PANTHERPTHR11024:SF2PROTEIN SEC13 HOMOLOGcoord: 6..298
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 9..284
score: 19.433
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 14..284