Myocyte-specific enhancer factor 2A

Overview
NameMyocyte-specific enhancer factor 2A
Smed IDSMED30014114
Length (bp)1898
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Myocyte-specific enhancer factor 2A (SMED30014114) t-SNE clustered cells

Violin plots show distribution of expression levels for Myocyte-specific enhancer factor 2A (SMED30014114) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Myocyte-specific enhancer factor 2A (SMED30014114) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Myocyte-specific enhancer factor 2A (SMED30014114) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014114

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30014114SMESG000006802.1 dd_Smed_v4_5317_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30014114SMESG000006802.1 dd_Smed_v4_5317_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Human
Match: MEF2C (myocyte enhancer factor 2C [Source:HGNC Symbol;Acc:HGNC:6996])

HSP 1 Score: 162.925 bits (411), Expect = 4.171e-47
Identity = 78/94 (82.98%), Postives = 84/94 (89.36%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETK 391
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNS+ KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E LNKKE K
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKENK 94          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Human
Match: MEF2C (myocyte enhancer factor 2C [Source:HGNC Symbol;Acc:HGNC:6996])

HSP 1 Score: 166.777 bits (421), Expect = 4.356e-47
Identity = 78/94 (82.98%), Postives = 84/94 (89.36%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETK 391
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNS+ KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E LNKKE K
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKENK 94          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Human
Match: MEF2C (myocyte enhancer factor 2C [Source:HGNC Symbol;Acc:HGNC:6996])

HSP 1 Score: 167.548 bits (423), Expect = 4.396e-47
Identity = 78/94 (82.98%), Postives = 84/94 (89.36%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETK 391
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNS+ KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E LNKKE K
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKENK 94          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Human
Match: MEF2C (myocyte enhancer factor 2C [Source:HGNC Symbol;Acc:HGNC:6996])

HSP 1 Score: 165.622 bits (418), Expect = 5.850e-47
Identity = 78/94 (82.98%), Postives = 84/94 (89.36%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETK 391
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNS+ KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E LNKKE K
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKENK 94          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Human
Match: MEF2B (myocyte enhancer factor 2B [Source:HGNC Symbol;Acc:HGNC:6995])

HSP 1 Score: 167.933 bits (424), Expect = 8.848e-46
Identity = 78/127 (61.42%), Postives = 92/127 (72.44%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETKIYGNEMSVDYDSEDNLRSEYDCRNEESMPVLDR 490
            MGRKKIQI RI D+RNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNS+ +LFQYAS+DMD+VLL+YTE +EP ES+TN DI+E L ++   + G E+  D   E+          E   P L R
Sbjct:    1 MGRKKIQISRILDQRNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSANRLFQYASTDMDRVLLKYTEYSEPHESRTNTDILETLKRRGIGLDGPELEPDEGPEEPGEKFRRLAGEGGDPALPR 127          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Celegans
Match: mef-2 (Related to vertebrate MEF2 transcription factor [Source:UniProtKB/TrEMBL;Acc:Q9U325])

HSP 1 Score: 166.777 bits (421), Expect = 3.590e-46
Identity = 79/107 (73.83%), Postives = 90/107 (84.11%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETKIYGNEMSVDYDSE 430
            MGRKKIQI RI+DERNRQVTF KRK GLMKKAYELSVLCDCEIALI+FNS+ KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E LN+KE    GN+   + D E
Sbjct:    1 MGRKKIQITRIQDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIVFNSTNKLFQYASTDMDKVLLKYTEYNEPHESRTNNDIMEALNRKE----GNQGGGNSDDE 103          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Celegans
Match: unc-120 (pep chromosome:WBcel235:I:8460225:8463015:1 gene:WBGene00006844.1 transcript:D1081.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-120)

HSP 1 Score: 55.8398 bits (133), Expect = 3.718e-8
Identity = 23/65 (35.38%), Postives = 43/65 (66.15%), Query Frame = 2
Query:  113 GRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVL 307
            GR KI+++ I ++  R  TF+KRK G+MKKA+ELS L   ++ L++ + +  ++ YA+  +  ++
Sbjct:   46 GRVKIKMEYINNKLRRYTTFSKRKTGIMKKAFELSTLTGTQVMLLVASETGHVYTYATPKLQPMI 110          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Fly
Match: Mef2 (gene:FBgn0011656 transcript:FBtr0088446)

HSP 1 Score: 160.229 bits (404), Expect = 3.806e-42
Identity = 83/137 (60.58%), Postives = 98/137 (71.53%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETKIYGN-EMSVDYDSEDNLRSEYDCRNEESMPVLDRCPTAIPNFG 517
            MGRKKIQI RI DERNRQVTFNKRK G+MKKAYELSVLCDCEIALIIF+SS KL+QYAS+DMD+VLL+YTE NEP ES TN++IIE  NK       + E   DY       ++Y+  +EE   ++ R   AI   G
Sbjct:    1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDRVLLKYTEYNEPHESLTNKNIIEKENKNGVMSPDSPEAETDYTLTPRTEAKYNKIDEEFQNMMQRNQMAIGGAG 137          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Fly
Match: Mef2 (gene:FBgn0011656 transcript:FBtr0088444)

HSP 1 Score: 159.844 bits (403), Expect = 4.964e-42
Identity = 83/137 (60.58%), Postives = 98/137 (71.53%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETKIYGN-EMSVDYDSEDNLRSEYDCRNEESMPVLDRCPTAIPNFG 517
            MGRKKIQI RI DERNRQVTFNKRK G+MKKAYELSVLCDCEIALIIF+SS KL+QYAS+DMD+VLL+YTE NEP ES TN++IIE  NK       + E   DY       ++Y+  +EE   ++ R   AI   G
Sbjct:    1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDRVLLKYTEYNEPHESLTNKNIIEKENKNGVMSPDSPEAETDYTLTPRTEAKYNKIDEEFQNMMQRNQMAIGGAG 137          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Fly
Match: Mef2 (gene:FBgn0011656 transcript:FBtr0088445)

HSP 1 Score: 159.844 bits (403), Expect = 5.496e-42
Identity = 83/137 (60.58%), Postives = 98/137 (71.53%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETKIYGN-EMSVDYDSEDNLRSEYDCRNEESMPVLDRCPTAIPNFG 517
            MGRKKIQI RI DERNRQVTFNKRK G+MKKAYELSVLCDCEIALIIF+SS KL+QYAS+DMD+VLL+YTE NEP ES TN++IIE  NK       + E   DY       ++Y+  +EE   ++ R   AI   G
Sbjct:    1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDRVLLKYTEYNEPHESLTNKNIIEKENKNGVMSPDSPEAETDYTLTPRTEAKYNKIDEEFQNMMQRNQMAIGGAG 137          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Fly
Match: Mef2 (gene:FBgn0011656 transcript:FBtr0088447)

HSP 1 Score: 159.458 bits (402), Expect = 5.520e-42
Identity = 83/137 (60.58%), Postives = 98/137 (71.53%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETKIYGN-EMSVDYDSEDNLRSEYDCRNEESMPVLDRCPTAIPNFG 517
            MGRKKIQI RI DERNRQVTFNKRK G+MKKAYELSVLCDCEIALIIF+SS KL+QYAS+DMD+VLL+YTE NEP ES TN++IIE  NK       + E   DY       ++Y+  +EE   ++ R   AI   G
Sbjct:    1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDRVLLKYTEYNEPHESLTNKNIIEKENKNGVMSPDSPEAETDYTLTPRTEAKYNKIDEEFQNMMQRNQMAIGGAG 137          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Fly
Match: Mef2 (gene:FBgn0011656 transcript:FBtr0330707)

HSP 1 Score: 159.458 bits (402), Expect = 8.017e-42
Identity = 83/137 (60.58%), Postives = 98/137 (71.53%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETKIYGN-EMSVDYDSEDNLRSEYDCRNEESMPVLDRCPTAIPNFG 517
            MGRKKIQI RI DERNRQVTFNKRK G+MKKAYELSVLCDCEIALIIF+SS KL+QYAS+DMD+VLL+YTE NEP ES TN++IIE  NK       + E   DY       ++Y+  +EE   ++ R   AI   G
Sbjct:    1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDRVLLKYTEYNEPHESLTNKNIIEKENKNGVMSPDSPEAETDYTLTPRTEAKYNKIDEEFQNMMQRNQMAIGGAG 137          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Zebrafish
Match: mef2ab (myocyte enhancer factor 2ab [Source:ZFIN;Acc:ZDB-GENE-120614-2])

HSP 1 Score: 167.162 bits (422), Expect = 2.001e-46
Identity = 78/92 (84.78%), Postives = 84/92 (91.30%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKE 385
            MGRKKIQI RI +ERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNSS KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+EVLNKKE
Sbjct:    1 MGRKKIQITRIMEERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEVLNKKE 92          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Zebrafish
Match: mef2aa (myocyte enhancer factor 2aa [Source:ZFIN;Acc:ZDB-GENE-990415-163])

HSP 1 Score: 169.474 bits (428), Expect = 1.146e-45
Identity = 78/92 (84.78%), Postives = 83/92 (90.22%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKE 385
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNSS KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E LNKKE
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKE 92          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Zebrafish
Match: mef2aa (myocyte enhancer factor 2aa [Source:ZFIN;Acc:ZDB-GENE-990415-163])

HSP 1 Score: 169.088 bits (427), Expect = 1.254e-45
Identity = 78/92 (84.78%), Postives = 83/92 (90.22%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKE 385
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNSS KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E LNKKE
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKE 92          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Zebrafish
Match: mef2aa (myocyte enhancer factor 2aa [Source:ZFIN;Acc:ZDB-GENE-990415-163])

HSP 1 Score: 169.474 bits (428), Expect = 1.771e-45
Identity = 78/92 (84.78%), Postives = 83/92 (90.22%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKE 385
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNSS KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E LNKKE
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKE 92          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Zebrafish
Match: mef2d (myocyte enhancer factor 2d [Source:ZFIN;Acc:ZDB-GENE-990415-164])

HSP 1 Score: 169.859 bits (429), Expect = 2.411e-45
Identity = 78/92 (84.78%), Postives = 83/92 (90.22%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKE 385
            MGRKKIQI+RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFN S KLFQYAS+DMD+VLL+YTE NEP ES+TN DIIE LNKKE
Sbjct:    1 MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYASTDMDKVLLKYTEYNEPHESRTNADIIEALNKKE 92          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Xenopus
Match: mef2c (MADS box transcription enhancer factor 2, polypeptide C (myocyte enhancer factor 2C) [Source:NCBI gene;Acc:100127198])

HSP 1 Score: 169.088 bits (427), Expect = 1.945e-45
Identity = 91/124 (73.39%), Postives = 98/124 (79.03%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETKIYGNEMSVDYDSEDNL--RSE--YDCRNEE 469
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNS+ KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E LNKKE K  G E S D DS   L  R+E  Y   NEE
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKENK--GCE-SPDPDSSYALTPRTEEKYKKINEE 121          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Xenopus
Match: mef2a (myocyte enhancer factor 2A [Source:NCBI gene;Acc:100216045])

HSP 1 Score: 167.933 bits (424), Expect = 3.642e-45
Identity = 77/94 (81.91%), Postives = 83/94 (88.30%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETK 391
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFN S KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E LNKKE +
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNGSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKENR 94          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Xenopus
Match: mef2a (myocyte enhancer factor 2A [Source:NCBI gene;Acc:100216045])

HSP 1 Score: 168.318 bits (425), Expect = 6.091e-45
Identity = 77/94 (81.91%), Postives = 83/94 (88.30%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETK 391
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFN S KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E LNKKE +
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNGSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKENR 94          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Xenopus
Match: mef2a (myocyte enhancer factor 2A [Source:NCBI gene;Acc:100216045])

HSP 1 Score: 157.532 bits (397), Expect = 9.729e-45
Identity = 75/91 (82.42%), Postives = 80/91 (87.91%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKK 382
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFN S KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E L KK
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNGSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVETLKKK 91          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Xenopus
Match: mef2a (myocyte enhancer factor 2A [Source:NCBI gene;Acc:100216045])

HSP 1 Score: 159.458 bits (402), Expect = 1.654e-44
Identity = 75/91 (82.42%), Postives = 80/91 (87.91%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKK 382
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFN S KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E L KK
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNGSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVETLKKK 91          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Mouse
Match: Mef2c (myocyte enhancer factor 2C [Source:MGI Symbol;Acc:MGI:99458])

HSP 1 Score: 164.466 bits (415), Expect = 5.674e-48
Identity = 78/94 (82.98%), Postives = 84/94 (89.36%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETK 391
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNS+ KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E LNKKE K
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKENK 94          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Mouse
Match: Mef2c (myocyte enhancer factor 2C [Source:MGI Symbol;Acc:MGI:99458])

HSP 1 Score: 168.703 bits (426), Expect = 7.137e-48
Identity = 91/124 (73.39%), Postives = 99/124 (79.84%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETKIYGNEMSVDYDSEDNL--RSE--YDCRNEE 469
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNS+ KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E LNKKE K  G+E S D DS   L  R+E  Y   NEE
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKENK--GSE-SPDPDSSYALTPRTEEKYKKINEE 121          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Mouse
Match: Mef2c (myocyte enhancer factor 2C [Source:MGI Symbol;Acc:MGI:99458])

HSP 1 Score: 169.088 bits (427), Expect = 7.667e-48
Identity = 91/124 (73.39%), Postives = 99/124 (79.84%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETKIYGNEMSVDYDSEDNL--RSE--YDCRNEE 469
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNS+ KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E LNKKE K  G+E S D DS   L  R+E  Y   NEE
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKENK--GSE-SPDPDSSYALTPRTEEKYKKINEE 121          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Mouse
Match: Mef2c (myocyte enhancer factor 2C [Source:MGI Symbol;Acc:MGI:99458])

HSP 1 Score: 164.466 bits (415), Expect = 9.747e-48
Identity = 78/94 (82.98%), Postives = 84/94 (89.36%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETK 391
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNS+ KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E LNKKE K
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKENK 94          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Mouse
Match: Mef2c (myocyte enhancer factor 2C [Source:MGI Symbol;Acc:MGI:99458])

HSP 1 Score: 167.162 bits (422), Expect = 1.140e-47
Identity = 91/124 (73.39%), Postives = 99/124 (79.84%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETKIYGNEMSVDYDSEDNL--RSE--YDCRNEE 469
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNS+ KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E LNKKE K  G+E S D DS   L  R+E  Y   NEE
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKENK--GSE-SPDPDSSYALTPRTEEKYKKINEE 121          
BLAST of Myocyte-specific enhancer factor 2A vs. UniProt/SwissProt
Match: sp|A4UTP7|MEF2C_PIG (Myocyte-specific enhancer factor 2C OS=Sus scrofa OX=9823 GN=MEF2C PE=2 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 6.274e-45
Identity = 91/124 (73.39%), Postives = 98/124 (79.03%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETKIYGNEMSVDYDSEDNL--RSE--YDCRNEE 469
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNS+ KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E LNKKE K  G E S D DS   L  R+E  Y   NEE
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKENK--GCE-SPDPDSSYALTPRTEEKYKKINEE 121          
BLAST of Myocyte-specific enhancer factor 2A vs. UniProt/SwissProt
Match: sp|Q02080|MEF2B_HUMAN (Myocyte-specific enhancer factor 2B OS=Homo sapiens OX=9606 GN=MEF2B PE=1 SV=2)

HSP 1 Score: 167.162 bits (422), Expect = 6.556e-45
Identity = 78/127 (61.42%), Postives = 92/127 (72.44%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETKIYGNEMSVDYDSEDNLRSEYDCRNEESMPVLDR 490
            MGRKKIQI RI D+RNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNS+ +LFQYAS+DMD+VLL+YTE +EP ES+TN DI+E L ++   + G E+  D   E+          E   P L R
Sbjct:    1 MGRKKIQISRILDQRNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSANRLFQYASTDMDRVLLKYTEYSEPHESRTNTDILETLKRRGIGLDGPELEPDEGPEEPGEKFRRLAGEGGDPALPR 127          
BLAST of Myocyte-specific enhancer factor 2A vs. UniProt/SwissProt
Match: sp|A2VDZ3|MEF2A_BOVIN (Myocyte-specific enhancer factor 2A OS=Bos taurus OX=9913 GN=MEF2A PE=2 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 8.573e-45
Identity = 78/92 (84.78%), Postives = 83/92 (90.22%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKE 385
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNSS KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E LNKKE
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKE 92          
BLAST of Myocyte-specific enhancer factor 2A vs. UniProt/SwissProt
Match: sp|Q2MJT0|MEF2A_RAT (Myocyte-specific enhancer factor 2A OS=Rattus norvegicus OX=10116 GN=Mef2a PE=1 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.040e-44
Identity = 78/92 (84.78%), Postives = 83/92 (90.22%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKE 385
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNSS KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E LNKKE
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKE 92          
BLAST of Myocyte-specific enhancer factor 2A vs. UniProt/SwissProt
Match: sp|Q02078|MEF2A_HUMAN (Myocyte-specific enhancer factor 2A OS=Homo sapiens OX=9606 GN=MEF2A PE=1 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.209e-44
Identity = 78/92 (84.78%), Postives = 83/92 (90.22%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKE 385
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNSS KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E LNKKE
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKE 92          
BLAST of Myocyte-specific enhancer factor 2A vs. TrEMBL
Match: C3Y268 (MADS-box domain-containing protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_59582 PE=4 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 4.334e-45
Identity = 101/208 (48.56%), Postives = 124/208 (59.62%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETKIYGNEMSVDYDSEDN-------LRSEYDCRNEESMPVLDRCPTA---IPNFGNEVKHQLNVITEQTENMKSFHNSIM---------NKSSGEHHQQMAHNSMPGQLFDRNQTHS 676
            MGRKKIQI RI+DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNS+ KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E LNKKE K  G E   D D E           ++Y   NEE     DR       + N   ++   + V  +Q  N+  +   ++         N S G   Q+   N +PG +   + T +
Sbjct:    1 MGRKKIQIARIDDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSANKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKEHK--GGESPDDQDVEPGYNLLTPRTEAKYQKINEE----FDRMMQMNMRVTNMPPQMPVAVPVTQQQQNNILGYGAGLLQPPQQIPARNVSPGVQPQRPPSNGVPGAMLGADLTGT 202          
BLAST of Myocyte-specific enhancer factor 2A vs. TrEMBL
Match: A0A0R3Q5I5 (MADS-box domain-containing protein OS=Brugia timori OX=42155 GN=BTMF_LOCUS919 PE=4 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 4.540e-45
Identity = 78/99 (78.79%), Postives = 87/99 (87.88%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETKIYGNE 406
            MGRKKIQI RI+DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNS+ KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E L +KE+K  G E
Sbjct:    1 MGRKKIQITRIQDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVLLKYTEYNEPHESRTNADIMEALQRKESKSGGVE 99          
BLAST of Myocyte-specific enhancer factor 2A vs. TrEMBL
Match: A0A0G2JFS4 (Myocyte-specific enhancer factor 2C (Fragment) OS=Mus musculus OX=10090 GN=Mef2c PE=4 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 1.176e-44
Identity = 78/94 (82.98%), Postives = 84/94 (89.36%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETK 391
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNS+ KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E LNKKE K
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKENK 94          
BLAST of Myocyte-specific enhancer factor 2A vs. TrEMBL
Match: A0A0G2JES4 (Myocyte-specific enhancer factor 2C (Fragment) OS=Mus musculus OX=10090 GN=Mef2c PE=1 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 1.480e-44
Identity = 91/124 (73.39%), Postives = 99/124 (79.84%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETKIYGNEMSVDYDSEDNL--RSE--YDCRNEE 469
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNS+ KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E LNKKE K  G+E S D DS   L  R+E  Y   NEE
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKENK--GSE-SPDPDSSYALTPRTEEKYKKINEE 121          
BLAST of Myocyte-specific enhancer factor 2A vs. TrEMBL
Match: A0A0G2JFI7 (Myocyte-specific enhancer factor 2C (Fragment) OS=Mus musculus OX=10090 GN=Mef2c PE=1 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 1.589e-44
Identity = 91/124 (73.39%), Postives = 99/124 (79.84%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETKIYGNEMSVDYDSEDNL--RSE--YDCRNEE 469
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNS+ KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E LNKKE K  G+E S D DS   L  R+E  Y   NEE
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKENK--GSE-SPDPDSSYALTPRTEEKYKKINEE 121          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Cavefish
Match: mef2ab (myocyte-specific enhancer factor 2A-like [Source:NCBI gene;Acc:103043805])

HSP 1 Score: 169.859 bits (429), Expect = 7.959e-46
Identity = 78/92 (84.78%), Postives = 83/92 (90.22%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKE 385
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNSS KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E LNKKE
Sbjct:    1 MGRKKIQITRIVDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKE 92          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Cavefish
Match: mef2aa (myocyte enhancer factor 2A [Source:NCBI gene;Acc:103026245])

HSP 1 Score: 169.859 bits (429), Expect = 9.140e-46
Identity = 78/92 (84.78%), Postives = 83/92 (90.22%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKE 385
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNSS KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E LNKKE
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKE 92          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Cavefish
Match: mef2aa (myocyte enhancer factor 2A [Source:NCBI gene;Acc:103026245])

HSP 1 Score: 164.081 bits (414), Expect = 9.086e-44
Identity = 88/138 (63.77%), Postives = 99/138 (71.74%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETKIYGNEMSVDYDS----EDNLRSEYDCRNEESMPVLDR-CPTAIP 508
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNSS KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E   K  TK + +  S D D        +   +   NEES  +  R  PTA+P
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVE---KLRTKGHSDCASPDPDDCFGHSPLMDDRFSKLNEESDLIYKRSAPTALP 135          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Cavefish
Match: mef2ca (myocyte enhancer factor 2ca [Source:ZFIN;Acc:ZDB-GENE-980526-253])

HSP 1 Score: 161.77 bits (408), Expect = 1.280e-43
Identity = 81/117 (69.23%), Postives = 90/117 (76.92%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKK------ETKIYGNEMSVDYDSEDNLR 442
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNS+ KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E L KK         I G++     +SED  R
Sbjct:    1 MGRKKIQIARIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCDSPDIDGDDSGHSPESEDKYR 117          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Cavefish
Match: mef2aa (myocyte enhancer factor 2A [Source:NCBI gene;Acc:103026245])

HSP 1 Score: 163.696 bits (413), Expect = 1.295e-43
Identity = 88/138 (63.77%), Postives = 99/138 (71.74%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETKIYGNEMSVDYDS----EDNLRSEYDCRNEESMPVLDR-CPTAIP 508
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNSS KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E   K  TK + +  S D D        +   +   NEES  +  R  PTA+P
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVE---KLRTKGHSDCASPDPDDCFGHSPLMDDRFSKLNEESDLIYKRSAPTALP 135          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Yeast
Match: RLM1 (MADS-box transcription factor; component of the protein kinase C-mediated MAP kinase pathway involved in the maintenance of cell integrity; phosphorylated and activated by the MAP-kinase Slt2p; RLM1 has a paralog, SMP1, that arose from the whole genome duplication [Source:SGD;Acc:S000006010])

HSP 1 Score: 88.9669 bits (219), Expect = 6.293e-19
Identity = 37/69 (53.62%), Postives = 52/69 (75.36%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRY 316
            MGR+KI+I+RI D+RNR VTF KRK GL KKA+ELSVLC  +IA+II  S+   ++++S D + ++  Y
Sbjct:    1 MGRRKIEIQRISDDRNRAVTFIKRKAGLFKKAHELSVLCQVDIAVIILGSNNTFYEFSSVDTNDLIYHY 69          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Yeast
Match: SMP1 (MADS-box transcription factor involved in osmotic stress response; SMP1 has a paralog, RLM1, that arose from the whole genome duplication [Source:SGD;Acc:S000000386])

HSP 1 Score: 85.8853 bits (211), Expect = 2.603e-18
Identity = 38/66 (57.58%), Postives = 51/66 (77.27%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVL 307
            MGR+KI+I+ I+D+RNR VTF KRK GL KKA+ELSVLC  +IA+II  S+   ++Y+S DM  +L
Sbjct:    1 MGRRKIEIEPIKDDRNRTVTFIKRKAGLFKKAHELSVLCQVDIAVIILGSNNTFYEYSSVDMSNLL 66          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Yeast
Match: ARG80 (Transcription factor involved in regulating arginine-responsive genes; acts with Arg81p and Arg82p [Source:SGD;Acc:S000004645])

HSP 1 Score: 60.4622 bits (145), Expect = 4.254e-11
Identity = 27/66 (40.91%), Postives = 44/66 (66.67%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVL 307
            + R+K  I+ IE++  R VTF+KR+ G+MKKAYELSVL    I L+I  +S  ++ + +  ++ V+
Sbjct:   78 VTRRKQPIRYIENKTRRHVTFSKRRHGIMKKAYELSVLTGANILLLILANSGLVYTFTTPKLEPVV 143          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Yeast
Match: MCM1 (Transcription factor; involved in cell-type-specific transcription and pheromone response; plays a central role in the formation of both repressor and activator complexes; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000004646])

HSP 1 Score: 62.003 bits (149), Expect = 4.678e-11
Identity = 25/64 (39.06%), Postives = 46/64 (71.88%), Query Frame = 2
Query:  116 RKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVL 307
            R+KI+IK IE++  R VTF+KRK G+MKKA+ELSVL   ++ L++ + +  ++ +++   + ++
Sbjct:   18 RRKIEIKFIENKTRRHVTFSKRKHGIMKKAFELSVLTGTQVLLLVVSETGLVYTFSTPKFEPIV 81          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Nematostella
Match: MEF2 (MADS-box transcription factor; Myocyte enhancer factor 2 splice variant IV; Predicted protein [Source:UniProtKB/TrEMBL;Acc:Q6S5H1])

HSP 1 Score: 162.54 bits (410), Expect = 2.389e-46
Identity = 74/94 (78.72%), Postives = 84/94 (89.36%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETK 391
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELS+LCDCEIALIIFNS+ KLFQYAS+DMD++LL+YTE NEP ES+TN DI+E ++KKE K
Sbjct:    1 MGRKKIQISRIGDERNRQVTFTKRKFGLMKKAYELSILCDCEIALIIFNSANKLFQYASTDMDKILLKYTEYNEPHESRTNTDIVETISKKENK 94          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Nematostella
Match: EDO35636 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKX3])

HSP 1 Score: 108.227 bits (269), Expect = 1.046e-28
Identity = 49/60 (81.67%), Postives = 55/60 (91.67%), Query Frame = 2
Query:  164 VTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFES 343
            VTF KRK GLMKKAYELS+LCDCEIALIIFNS+ KLFQYAS+DMD++LL+YTE NEP ES
Sbjct:    1 VTFTKRKFGLMKKAYELSILCDCEIALIIFNSANKLFQYASTDMDKILLKYTEYNEPHES 60          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Nematostella
Match: EDO43028 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZP6])

HSP 1 Score: 56.9954 bits (136), Expect = 8.204e-10
Identity = 24/65 (36.92%), Postives = 43/65 (66.15%), Query Frame = 2
Query:  113 GRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVL 307
            GR KI++K I ++  R  TF+KRK G+MKKAYELS L   ++ L++ + +  ++ +A+  +  ++
Sbjct:   34 GRVKIEMKFISNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVMLLVASETGHVYTFATRKLQPMI 98          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Medaka
Match: mef2aa (myocyte enhancer factor 2A [Source:NCBI gene;Acc:101173054])

HSP 1 Score: 169.474 bits (428), Expect = 1.715e-45
Identity = 78/92 (84.78%), Postives = 83/92 (90.22%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKE 385
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNSS KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E LNKKE
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKE 92          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Medaka
Match: mef2cb (myocyte enhancer factor 2C [Source:NCBI gene;Acc:101160563])

HSP 1 Score: 169.088 bits (427), Expect = 1.806e-45
Identity = 78/94 (82.98%), Postives = 84/94 (89.36%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETK 391
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFNS+ KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E LNKKE K
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKENK 94          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Medaka
Match: ENSORLT00000018766.2 (myocyte-specific enhancer factor 2A-like [Source:NCBI gene;Acc:101165294])

HSP 1 Score: 166.392 bits (420), Expect = 5.713e-45
Identity = 77/92 (83.70%), Postives = 82/92 (89.13%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKE 385
            MGRKKIQI RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFN S KLFQYAS+DMD+VLL+YTE NEP ES+TN DI+E LNKKE
Sbjct:    1 MGRKKIQITRIVDERNRQVTFMKRKFGLMKKAYELSVLCDCEIALIIFNGSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKE 92          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Medaka
Match: mef2d (myocyte-specific enhancer factor 2D homolog [Source:NCBI gene;Acc:101174373])

HSP 1 Score: 164.466 bits (415), Expect = 1.032e-43
Identity = 76/91 (83.52%), Postives = 81/91 (89.01%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKK 382
            MGRKKIQI+RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFN S KLFQYAS+DMD+VLL+YTE NEP ES+TN DIIE L KK
Sbjct:    1 MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYASTDMDKVLLKYTEYNEPHESRTNADIIETLRKK 91          
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Medaka
Match: mef2d (myocyte-specific enhancer factor 2D homolog [Source:NCBI gene;Acc:101174373])

HSP 1 Score: 164.081 bits (414), Expect = 2.072e-43
Identity = 76/91 (83.52%), Postives = 81/91 (89.01%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKK 382
            MGRKKIQI+RI DERNRQVTF KRK GLMKKAYELSVLCDCEIALIIFN S KLFQYAS+DMD+VLL+YTE NEP ES+TN DIIE L KK
Sbjct:    1 MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYASTDMDKVLLKYTEYNEPHESRTNADIIETLRKK 91          
BLAST of Myocyte-specific enhancer factor 2A vs. Planmine SMEST
Match: SMESG000006802.1 (SMESG000006802.1)

HSP 1 Score: 1085.48 bits (2806), Expect = 0.000e+0
Identity = 546/548 (99.64%), Postives = 546/548 (99.64%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETKIYGNEMSVDYDSEDNLRSEYDCRNEESMPVLDRCPTAIPNFGNEVKHQLNVITEQTENMKSFHNSIMNKSSGEHHQQMAHNSMPGQLFDRNQTHSPIPTKIQIESLNRPNSAQQPLYINTDDHLPRQALYDRQAHSNYSGRSSRPASHENFSSHSFYNSSAPANVNSDNDLKIHHDISPNNTSMYNSSQNHIKPDLTRINPSNGMAYHVSPKSRSSHLDSNSPGPPSLGFYGNADRIYLHGSDNGENNFKIEREVLHPSNWPTVECKGSSPLITINQNDEIVGSTTIHNASVTTLSNNGNHLGSSYQSPRPLSNMISQPPRQIKKCMLNGSPDLGVXXXXXXXXXXXXXXXXCDEFNDSNKNLCFNPAILLNLGSLEAQSNVISKSSNQIHPEMNPISSPNSQLQTESSSPMPSNFRLSPLTSISNLPRRNMSQMNNHLPNKRLCPDLHHWNNQ 1753
            MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETKIYGNEMSVDYDSEDNLRSEYDCRNEESMPVLDRCPTAIPNFGNEVKHQLNVITEQTENMKS HNSIMNKSSGEHHQQMAHNSMPGQLFDRNQTHSPIPTKIQIESLNRPNSAQQPLYINTDDHLPRQALYDRQ HSNYSGRSSRPASHENFSSHSFYNSSAPANVNSDNDLKIHHDISPNNTSMYNSSQNHIKPDLTRINPSNGMAYHVSPKSRSSHLDSNSPGPPSLGFYGNADRIYLHGSDNGENNFKIEREVLHPSNWPTVECKGSSPLITINQNDEIVGSTTIHNASVTTLSNNGNHLGSSYQSPRPLSNMISQPPRQIKKCMLNGSPDLGVSNNLNFNINSNILANSCDEFNDSNKNLCFNPAILLNLGSLEAQSNVISKSSNQIHPEMNPISSPNSQLQTESSSPMPSNFRLSPLTSISNLPRRNMSQMNNHLPNKRLCPDLHHWNNQ
Sbjct:    1 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETKIYGNEMSVDYDSEDNLRSEYDCRNEESMPVLDRCPTAIPNFGNEVKHQLNVITEQTENMKSLHNSIMNKSSGEHHQQMAHNSMPGQLFDRNQTHSPIPTKIQIESLNRPNSAQQPLYINTDDHLPRQALYDRQVHSNYSGRSSRPASHENFSSHSFYNSSAPANVNSDNDLKIHHDISPNNTSMYNSSQNHIKPDLTRINPSNGMAYHVSPKSRSSHLDSNSPGPPSLGFYGNADRIYLHGSDNGENNFKIEREVLHPSNWPTVECKGSSPLITINQNDEIVGSTTIHNASVTTLSNNGNHLGSSYQSPRPLSNMISQPPRQIKKCMLNGSPDLGVSNNLNFNINSNILANSCDEFNDSNKNLCFNPAILLNLGSLEAQSNVISKSSNQIHPEMNPISSPNSQLQTESSSPMPSNFRLSPLTSISNLPRRNMSQMNNHLPNKRLCPDLHHWNNQ 548          
BLAST of Myocyte-specific enhancer factor 2A vs. Planmine SMEST
Match: SMESG000040479.1 (SMESG000040479.1)

HSP 1 Score: 142.124 bits (357), Expect = 3.385e-39
Identity = 67/91 (73.63%), Postives = 81/91 (89.01%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKK 382
            MGRKKI+I++I+DER RQVTF KRK GLMKKAYELSVLCDCEIALIIFN++ KL+QYASSDMD +LLRYT+  EP ESKTN+++ +V +KK
Sbjct:    1 MGRKKIEIQKIKDERTRQVTFAKRKSGLMKKAYELSVLCDCEIALIIFNNNNKLYQYASSDMDTILLRYTQYEEPHESKTNKELHDVASKK 91          
BLAST of Myocyte-specific enhancer factor 2A vs. Planmine SMEST
Match: SMESG000011575.1 (SMESG000011575.1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.560e-10
Identity = 42/98 (42.86%), Postives = 55/98 (56.12%), Query Frame = 2
Query:  110 MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECN---EPFESKTNQD-IIEVLNKKETK 391
            MGRKKI +  IED+R R  TF+KR++GL KKA EL+ LC   I++II N   K   Y  SD       Y + N   E  E   N D +++ +NKK  K
Sbjct:    1 MGRKKISMNFIEDDRKRASTFDKRRIGLFKKASELNRLCGVSISVIIVN---KDLVYKFSDPPHSF--YKKINNKPEKIEEDFNNDTLLDFINKKAQK 93          
BLAST of Myocyte-specific enhancer factor 2A vs. Planmine SMEST
Match: SMESG000074732.1 (SMESG000074732.1)

HSP 1 Score: 60.8474 bits (146), Expect = 5.187e-10
Identity = 33/86 (38.37%), Postives = 49/86 (56.98%), Query Frame = 2
Query:  113 GRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEV 370
            G+ KI I+ I  +  RQ TF+KRK GLMKKAYEL+ L   E+ L+I + +  ++ Y ++ M  V          FES+  + +IE 
Sbjct:   57 GKNKIDIEFITKKSRRQSTFSKRKTGLMKKAYELAELTGAEVLLMIASDTNHVYTYGTTKMKPV----------FESEQGKLLIEA 132          
BLAST of Myocyte-specific enhancer factor 2A vs. Planmine SMEST
Match: SMESG000011575.1 (SMESG000011575.1)

HSP 1 Score: 51.2174 bits (121), Expect = 1.038e-6
Identity = 36/88 (40.91%), Postives = 48/88 (54.55%), Query Frame = 2
Query:  140 IEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNSSQKLFQYASSDMDQVLLRYTECN---EPFESKTNQD-IIEVLNKKETK 391
            IED+R R  TF+KR++GL KKA EL+ LC   I++II N   K   Y  SD       Y + N   E  E   N D +++ +NKK  K
Sbjct:    4 IEDDRKRASTFDKRRIGLFKKASELNRLCGVSISVIIVN---KDLVYKFSDPPHSF--YKKINNKPEKIEEDFNNDTLLDFINKKAQK 86          
The following BLAST results are available for this feature:
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MEF2C4.171e-4782.98myocyte enhancer factor 2C [Source:HGNC Symbol;Acc... [more]
MEF2C4.356e-4782.98myocyte enhancer factor 2C [Source:HGNC Symbol;Acc... [more]
MEF2C4.396e-4782.98myocyte enhancer factor 2C [Source:HGNC Symbol;Acc... [more]
MEF2C5.850e-4782.98myocyte enhancer factor 2C [Source:HGNC Symbol;Acc... [more]
MEF2B8.848e-4661.42myocyte enhancer factor 2B [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mef-23.590e-4673.83Related to vertebrate MEF2 transcription factor [... [more]
unc-1203.718e-835.38pep chromosome:WBcel235:I:8460225:8463015:1 gene:W... [more]
back to top
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mef23.806e-4260.58gene:FBgn0011656 transcript:FBtr0088446[more]
Mef24.964e-4260.58gene:FBgn0011656 transcript:FBtr0088444[more]
Mef25.496e-4260.58gene:FBgn0011656 transcript:FBtr0088445[more]
Mef25.520e-4260.58gene:FBgn0011656 transcript:FBtr0088447[more]
Mef28.017e-4260.58gene:FBgn0011656 transcript:FBtr0330707[more]
back to top
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mef2ab2.001e-4684.78myocyte enhancer factor 2ab [Source:ZFIN;Acc:ZDB-G... [more]
mef2aa1.146e-4584.78myocyte enhancer factor 2aa [Source:ZFIN;Acc:ZDB-G... [more]
mef2aa1.254e-4584.78myocyte enhancer factor 2aa [Source:ZFIN;Acc:ZDB-G... [more]
mef2aa1.771e-4584.78myocyte enhancer factor 2aa [Source:ZFIN;Acc:ZDB-G... [more]
mef2d2.411e-4584.78myocyte enhancer factor 2d [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mef2c1.945e-4573.39MADS box transcription enhancer factor 2, polypept... [more]
mef2a3.642e-4581.91myocyte enhancer factor 2A [Source:NCBI gene;Acc:1... [more]
mef2a6.091e-4581.91myocyte enhancer factor 2A [Source:NCBI gene;Acc:1... [more]
mef2a9.729e-4582.42myocyte enhancer factor 2A [Source:NCBI gene;Acc:1... [more]
mef2a1.654e-4482.42myocyte enhancer factor 2A [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mef2c5.674e-4882.98myocyte enhancer factor 2C [Source:MGI Symbol;Acc:... [more]
Mef2c7.137e-4873.39myocyte enhancer factor 2C [Source:MGI Symbol;Acc:... [more]
Mef2c7.667e-4873.39myocyte enhancer factor 2C [Source:MGI Symbol;Acc:... [more]
Mef2c9.747e-4882.98myocyte enhancer factor 2C [Source:MGI Symbol;Acc:... [more]
Mef2c1.140e-4773.39myocyte enhancer factor 2C [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Myocyte-specific enhancer factor 2A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A4UTP7|MEF2C_PIG6.274e-4573.39Myocyte-specific enhancer factor 2C OS=Sus scrofa ... [more]
sp|Q02080|MEF2B_HUMAN6.556e-4561.42Myocyte-specific enhancer factor 2B OS=Homo sapien... [more]
sp|A2VDZ3|MEF2A_BOVIN8.573e-4584.78Myocyte-specific enhancer factor 2A OS=Bos taurus ... [more]
sp|Q2MJT0|MEF2A_RAT1.040e-4484.78Myocyte-specific enhancer factor 2A OS=Rattus norv... [more]
sp|Q02078|MEF2A_HUMAN1.209e-4484.78Myocyte-specific enhancer factor 2A OS=Homo sapien... [more]
back to top
BLAST of Myocyte-specific enhancer factor 2A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C3Y2684.334e-4548.56MADS-box domain-containing protein OS=Branchiostom... [more]
A0A0R3Q5I54.540e-4578.79MADS-box domain-containing protein OS=Brugia timor... [more]
A0A0G2JFS41.176e-4482.98Myocyte-specific enhancer factor 2C (Fragment) OS=... [more]
A0A0G2JES41.480e-4473.39Myocyte-specific enhancer factor 2C (Fragment) OS=... [more]
A0A0G2JFI71.589e-4473.39Myocyte-specific enhancer factor 2C (Fragment) OS=... [more]
back to top
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mef2ab7.959e-4684.78myocyte-specific enhancer factor 2A-like [Source:N... [more]
mef2aa9.140e-4684.78myocyte enhancer factor 2A [Source:NCBI gene;Acc:1... [more]
mef2aa9.086e-4463.77myocyte enhancer factor 2A [Source:NCBI gene;Acc:1... [more]
mef2ca1.280e-4369.23myocyte enhancer factor 2ca [Source:ZFIN;Acc:ZDB-G... [more]
mef2aa1.295e-4363.77myocyte enhancer factor 2A [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
RLM16.293e-1953.62MADS-box transcription factor; component of the pr... [more]
SMP12.603e-1857.58MADS-box transcription factor involved in osmotic ... [more]
ARG804.254e-1140.91Transcription factor involved in regulating argini... [more]
MCM14.678e-1139.06Transcription factor; involved in cell-type-specif... [more]
back to top
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
MEF22.389e-4678.72MADS-box transcription factor; Myocyte enhancer fa... [more]
EDO356361.046e-2881.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430288.204e-1036.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Myocyte-specific enhancer factor 2A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mef2aa1.715e-4584.78myocyte enhancer factor 2A [Source:NCBI gene;Acc:1... [more]
mef2cb1.806e-4582.98myocyte enhancer factor 2C [Source:NCBI gene;Acc:1... [more]
ENSORLT00000018766.25.713e-4583.70myocyte-specific enhancer factor 2A-like [Source:N... [more]
mef2d1.032e-4383.52myocyte-specific enhancer factor 2D homolog [Sourc... [more]
mef2d2.072e-4383.52myocyte-specific enhancer factor 2D homolog [Sourc... [more]
back to top
BLAST of Myocyte-specific enhancer factor 2A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006802.10.000e+099.64SMESG000006802.1[more]
SMESG000040479.13.385e-3973.63SMESG000040479.1[more]
SMESG000011575.11.560e-1042.86SMESG000011575.1[more]
SMESG000074732.15.187e-1038.37SMESG000074732.1[more]
SMESG000011575.11.038e-640.91SMESG000011575.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014114 ID=SMED30014114|Name=Myocyte-specific enhancer factor 2A|organism=Schmidtea mediterranea sexual|type=transcript|length=1898bp
AATTTAATTTCACAATATTTTATATAATCAACTTAAATGATTTAGTAAGT
GTCTCAATTTACTCAATAGTCAGAAAATTTTATATTCAATAAGTAAATTT
TTAAACATTATGGGACGAAAAAAAATACAAATTAAACGAATAGAAGATGA
AAGGAACAGACAGGTTACTTTTAATAAACGAAAAATGGGTTTAATGAAAA
AAGCTTATGAATTGAGTGTTTTATGCGACTGCGAAATAGCTCTTATTATT
TTTAACAGTTCTCAAAAGCTATTTCAATACGCTAGTTCAGACATGGATCA
AGTTTTGTTACGTTATACCGAATGTAATGAACCATTTGAATCGAAAACAA
ATCAGGATATCATAGAAGTTCTCAATAAAAAGGAAACGAAAATTTATGGT
AACGAAATGAGCGTGGATTATGATTCGGAAGACAATTTGAGATCGGAATA
CGATTGTCGAAATGAGGAGTCAATGCCTGTCTTAGACAGGTGTCCCACTG
CAATTCCAAACTTCGGAAATGAAGTGAAGCATCAGTTGAATGTCATTACC
GAACAAACAGAAAACATGAAATCATTTCATAACTCAATCATGAATAAAAG
TTCTGGTGAACATCATCAGCAAATGGCACACAATTCAATGCCTGGTCAAC
TATTTGACAGGAATCAAACTCATTCTCCGATACCCACAAAGATTCAAATA
GAATCCTTAAATCGTCCCAATAGTGCTCAACAACCACTTTATATTAACAC
CGATGATCATTTACCTAGACAGGCTCTCTATGATAGACAAGCTCATTCTA
ATTATTCCGGAAGATCTTCTAGACCTGCATCTCATGAAAATTTTTCCAGT
CATTCATTCTATAATTCATCTGCACCAGCCAATGTCAACAGTGACAATGA
TTTGAAGATTCATCATGATATTTCCCCAAACAATACTTCCATGTATAATT
CTTCCCAGAATCACATTAAACCAGATCTGACAAGAATTAACCCATCAAAT
GGAATGGCATATCATGTTTCTCCAAAATCTAGATCTTCACATCTTGATTC
AAATTCTCCTGGTCCTCCTTCCCTCGGTTTTTATGGAAATGCCGATCGAA
TATATTTACATGGTTCTGATAATGGTGAAAACAACTTCAAAATCGAACGA
GAGGTACTACATCCTTCTAATTGGCCGACAGTTGAGTGTAAAGGTTCTTC
GCCCTTAATAACTATTAATCAAAACGATGAAATTGTTGGTTCAACAACTA
TTCATAATGCCTCAGTAACTACATTATCTAACAACGGAAATCATCTGGGT
AGTTCCTATCAGTCACCAAGGCCTCTATCAAATATGATCTCTCAACCACC
TCGGCAGATCAAGAAATGTATGCTCAACGGTTCTCCTGACCTCGGAGTCT
CCAACAATCTCAATTTTAATATTAATTCCAACATATTGGCCAATTCTTGC
GACGAATTTAATGACTCGAATAAGAATCTGTGTTTCAATCCAGCTATTCT
GCTCAACTTGGGATCACTTGAGGCTCAGTCAAATGTAATCTCTAAATCCT
CCAATCAAATCCATCCCGAAATGAATCCTATCAGTAGTCCTAATAGTCAG
CTCCAAACAGAATCTTCATCACCAATGCCTTCTAATTTCCGACTTAGTCC
TCTAACGTCAATATCGAATTTGCCTCGTCGTAACATGTCTCAGATGAACA
ATCATCTTCCAAACAAGAGACTGTGTCCAGATCTGCATCATTGGAACAAC
CAATGAATTGTAAATATTTATGATTGAAATAAACCGTTTCATGTCTGTAA
GTTGCGTCATTCTCGACCCAATCAAATTACTGCGCTATTTGATTATGATT
TTATTCAATGAGAAATTATCTAATAAATAATAATAATAATAATAATAA
back to top

protein sequence of SMED30014114-orf-1

>SMED30014114-orf-1 ID=SMED30014114-orf-1|Name=SMED30014114-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=549bp
MGRKKIQIKRIEDERNRQVTFNKRKMGLMKKAYELSVLCDCEIALIIFNS
SQKLFQYASSDMDQVLLRYTECNEPFESKTNQDIIEVLNKKETKIYGNEM
SVDYDSEDNLRSEYDCRNEESMPVLDRCPTAIPNFGNEVKHQLNVITEQT
ENMKSFHNSIMNKSSGEHHQQMAHNSMPGQLFDRNQTHSPIPTKIQIESL
NRPNSAQQPLYINTDDHLPRQALYDRQAHSNYSGRSSRPASHENFSSHSF
YNSSAPANVNSDNDLKIHHDISPNNTSMYNSSQNHIKPDLTRINPSNGMA
YHVSPKSRSSHLDSNSPGPPSLGFYGNADRIYLHGSDNGENNFKIEREVL
HPSNWPTVECKGSSPLITINQNDEIVGSTTIHNASVTTLSNNGNHLGSSY
QSPRPLSNMISQPPRQIKKCMLNGSPDLGVSNNLNFNINSNILANSCDEF
NDSNKNLCFNPAILLNLGSLEAQSNVISKSSNQIHPEMNPISSPNSQLQT
ESSSPMPSNFRLSPLTSISNLPRRNMSQMNNHLPNKRLCPDLHHWNNQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000002mitochondrial genome maintenance
GO:0048311mitochondrion distribution
GO:0055005ventricular cardiac myofibril assembly
GO:0061337cardiac conduction
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0000165MAPK cascade
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006915apoptotic process
GO:0007275multicellular organism development
GO:0007399nervous system development
GO:0030154cell differentiation
GO:0045893positive regulation of transcription, DNA-templated
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0048813dendrite morphogenesis
GO:0070375ERK5 cascade
GO:0071277cellular response to calcium ion
GO:0071333cellular response to glucose stimulus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000103central nervous system
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036879TF_MADSbox_sf
IPR033896MADS_MEF2-like
IPR002100TF_MADSbox
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0003677DNA binding
GO:0000977RNA polymerase II regulatory region sequence-specific DNA binding
GO:0000981RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0003682chromatin binding
GO:0033613activating transcription factor binding
GO:0035035histone acetyltransferase binding
GO:0042826histone deacetylase binding
GO:0043565sequence-specific DNA binding
GO:0046332SMAD binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002100Transcription factor, MADS-boxPRINTSPR00404MADSDOMAINcoord: 38..59
score: 54.04
coord: 3..23
score: 64.7
coord: 23..38
score: 77.12
IPR002100Transcription factor, MADS-boxSMARTSM00432madsneu2coord: 1..60
e-value: 2.5E-37
score: 140.0
IPR002100Transcription factor, MADS-boxPFAMPF00319SRF-TFcoord: 10..57
e-value: 2.0E-24
score: 84.8
IPR002100Transcription factor, MADS-boxPROSITEPS00350MADS_BOX_1coord: 3..57
IPR002100Transcription factor, MADS-boxPROSITEPS50066MADS_BOX_2coord: 1..61
score: 30.109
IPR036879Transcription factor, MADS-box superfamilyGENE3DG3DSA:3.40.1810.10coord: 13..94
e-value: 8.1E-35
score: 120.7
IPR036879Transcription factor, MADS-box superfamilySUPERFAMILYSSF55455SRF-likecoord: 2..91
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 481..511
NoneNo IPR availablePANTHERPTHR11945MADS BOX PROTEINcoord: 2..206
NoneNo IPR availablePANTHERPTHR11945:SF25MYOCYTE-SPECIFIC ENHANCER FACTOR 2Ccoord: 2..206
IPR033896MADS MEF2-likeCDDcd00265MADS_MEF2_likecoord: 2..74
e-value: 6.28053E-39
score: 134.987