Protocadherin

Overview
NameProtocadherin
Smed IDSMED30014105
Length (bp)3724
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin (SMED30014105) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin (SMED30014105) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin (SMED30014105) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin (SMED30014105) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014105

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle progenitor cellSMED30014105SMESG000051236.1 SMED30014105smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014105SMESG000051236.1 dd_Smed_v4_9283_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 270.781 bits (691), Expect = 1.789e-74
Identity = 240/772 (31.09%), Postives = 374/772 (48.45%), Query Frame = 3
Query:  387 KVTDNTKENSFISNLNSFDVYSTPYTQNKKFNLLSNTKANRLFHLHSN-GKLYS-AQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQ-NRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDY-VNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLE-NNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVLFERDNKY-YLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDH-KGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILIT 2669
            ++ +N    + + +LN   + +   T   +F L+  T    L  +  + G++++    IDRE+LC  +    H    C   + +A+  D I   R  + R  IEDINDNAP F      I+I E+  + S ++LP A D D     +++Y+L ++     IF L+    P G    QLI  ++LDRE++  Y   +   D G P ++   ++ ++V D NDN P   +T   +   E+      + ++ A D D  +NAK+ F   N   V   A + F +   +G I +KE LD E    H+  V  S+  G +  A A VL+ V ++ND  P I I Y VN  N    + EN    TK +AL TVTDKD    G+V C   +     EI  R   + SN++ +     LD E+   Y +++   D G PPL   A++ + VKDENDNAPV       VS+ EN   G  +  ++A D D G N E+ Y +   +        ++  TG L    K+DRE++ + L +    +   D G PP  S     VS+ D+NDN+P F +   +F V EN     T+G I V D D  DNS + +S++   ++       F  D++   +    S D EK+++Y+F + A DG G  S +++A VT+ + D ND+ P FI P Y N++ Y     S     +   V  +D+   MN +  + +V  + + LF IDQ  G IT       +D+G H + V A D G P    S++I 
Sbjct:   65 EIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEH----CFYEVEVAILPDEIF--RLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQ---NIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNL--VSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD--GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTK-IALITVTDKDADHNGRVTCFTDH-----EIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDA---PPEFSLDRRTGMLTVVKKLDREKEDKYLFT----ILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD-------FTIDSQTGVIRPNISFDREKQESYTFYVKAEDG-GRVSRSSSAKVTINVVDVNDNKPVFIVPPY-NYS-YELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIV 800          
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 270.396 bits (690), Expect = 2.445e-74
Identity = 240/772 (31.09%), Postives = 374/772 (48.45%), Query Frame = 3
Query:  387 KVTDNTKENSFISNLNSFDVYSTPYTQNKKFNLLSNTKANRLFHLHSN-GKLYSAQT-IDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQ-NRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDY-VNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLE-NNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVLFERDNKY-YLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDH-KGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILIT 2669
            ++ +N    + + +LN   + +   T   +F L+  T    L  +  + G++++    IDRE+LC  +    H    C   + +A+  D I   R  + R  IEDINDNAP F      I+I E+  + S ++LP A D D     +++Y+L ++     IF L+    P G    QLI  ++LDRE++  Y   +   D G P ++   ++ ++V D NDN P   +T   +   E+      + ++ A D D  +NAK+ F   N   V   A + F +   +G I +KE LD E    H+  V  S+  G +  A A VL+ V ++ND  P I I Y VN  N    + EN    TK +AL TVTDKD    G+V C   +     EI  R   + SN++ +     LD E+   Y +++   D G PPL   A++ + VKDENDNAPV       VS+ EN   G  +  ++A D D G N E+ Y +   +        ++  TG L    K+DRE++ + L +    +   D G PP  S     VS+ D+NDN+P F +   +F V EN     T+G I V D D  DNS + +S++   ++       F  D++   +    S D EK+++Y+F + A DG G  S +++A VT+ + D ND+ P FI P Y N++ Y     S     +   V  +D+   MN +  + +V  + + LF IDQ  G IT       +D+G H + V A D G P    S++I 
Sbjct:   65 EIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEH----CFYEVEVAILPDEIF--RLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQ---NIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNL--VSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD--GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTK-IALITVTDKDADHNGRVTCFTDH-----EIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDA---PPEFSLDRRTGMLTVVKKLDREKEDKYLFT----ILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD-------FTIDSQTGVIRPNISFDREKQESYTFYVKAEDG-GRVSRSSSAKVTINVVDVNDNKPVFIVPPY-NYS-YELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIV 800          
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 270.011 bits (689), Expect = 2.702e-74
Identity = 240/772 (31.09%), Postives = 374/772 (48.45%), Query Frame = 3
Query:  387 KVTDNTKENSFISNLNSFDVYSTPYTQNKKFNLLSNTKANRLFHLHSN-GKLYS-AQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQ-NRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDY-VNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLE-NNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVLFERDNKY-YLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDH-KGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILIT 2669
            ++ +N    + + +LN   + +   T   +F L+  T    L  +  + G++++    IDRE+LC  +    H    C   + +A+  D I   R  + R  IEDINDNAP F      I+I E+  + S ++LP A D D     +++Y+L ++     IF L+    P G    QLI  ++LDRE++  Y   +   D G P ++   ++ ++V D NDN P   +T   +   E+      + ++ A D D  +NAK+ F   N   V   A + F +   +G I +KE LD E    H+  V  S+  G +  A A VL+ V ++ND  P I I Y VN  N    + EN    TK +AL TVTDKD    G+V C   +     EI  R   + SN++ +     LD E+   Y +++   D G PPL   A++ + VKDENDNAPV       VS+ EN   G  +  ++A D D G N E+ Y +   +        ++  TG L    K+DRE++ + L +    +   D G PP  S     VS+ D+NDN+P F +   +F V EN     T+G I V D D  DNS + +S++   ++       F  D++   +    S D EK+++Y+F + A DG G  S +++A VT+ + D ND+ P FI P Y N++ Y     S     +   V  +D+   MN +  + +V  + + LF IDQ  G IT       +D+G H + V A D G P    S++I 
Sbjct:   54 EIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEH----CFYEVEVAILPDEIF--RLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQ---NIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNL--VSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD--GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTK-IALITVTDKDADHNGRVTCFTDH-----EIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDA---PPEFSLDRRTGMLTVVKKLDREKEDKYLFT----ILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD-------FTIDSQTGVIRPNISFDREKQESYTFYVKAEDG-GRVSRSSSAKVTINVVDVNDNKPVFIVPPY-NYS-YELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIV 789          
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 270.011 bits (689), Expect = 2.702e-74
Identity = 240/772 (31.09%), Postives = 374/772 (48.45%), Query Frame = 3
Query:  387 KVTDNTKENSFISNLNSFDVYSTPYTQNKKFNLLSNTKANRLFHLHSN-GKLYS-AQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQ-NRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDY-VNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLE-NNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVLFERDNKY-YLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDH-KGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILIT 2669
            ++ +N    + + +LN   + +   T   +F L+  T    L  +  + G++++    IDRE+LC  +    H    C   + +A+  D I   R  + R  IEDINDNAP F      I+I E+  + S ++LP A D D     +++Y+L ++     IF L+    P G    QLI  ++LDRE++  Y   +   D G P ++   ++ ++V D NDN P   +T   +   E+      + ++ A D D  +NAK+ F   N   V   A + F +   +G I +KE LD E    H+  V  S+  G +  A A VL+ V ++ND  P I I Y VN  N    + EN    TK +AL TVTDKD    G+V C   +     EI  R   + SN++ +     LD E+   Y +++   D G PPL   A++ + VKDENDNAPV       VS+ EN   G  +  ++A D D G N E+ Y +   +        ++  TG L    K+DRE++ + L +    +   D G PP  S     VS+ D+NDN+P F +   +F V EN     T+G I V D D  DNS + +S++   ++       F  D++   +    S D EK+++Y+F + A DG G  S +++A VT+ + D ND+ P FI P Y N++ Y     S     +   V  +D+   MN +  + +V  + + LF IDQ  G IT       +D+G H + V A D G P    S++I 
Sbjct:   54 EIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEH----CFYEVEVAILPDEIF--RLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQ---NIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNL--VSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD--GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTK-IALITVTDKDADHNGRVTCFTDH-----EIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDA---PPEFSLDRRTGMLTVVKKLDREKEDKYLFT----ILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD-------FTIDSQTGVIRPNISFDREKQESYTFYVKAEDG-GRVSRSSSAKVTINVVDVNDNKPVFIVPPY-NYS-YELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIV 789          
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 271.166 bits (692), Expect = 1.040e-73
Identity = 240/771 (31.13%), Postives = 374/771 (48.51%), Query Frame = 3
Query:  387 KVTDNTKENSFISNLNSFDVYSTPYTQNKKFNLLSNTKANRLFHLHSN-GKLYS-AQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQ-NRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDY-VNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLE-NNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVLFERDNKY-YLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDH-KGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILI 2666
            ++ +N    + + +LN   + +   T   +F L+  T    L  +  + G++++    IDRE+LC  +    H    C   + +A+  D I   R  + R  IEDINDNAP F      I+I E+  + S ++LP A D D     +++Y+L ++     IF L+    P G    QLI  ++LDRE++  Y   +   D G P ++   ++ ++V D NDN P   +T   +   E+      + ++ A D D  +NAK+ F   N   V   A + F +   +G I +KE LD E    H+  V  S+  G +  A A VL+ V ++ND  P I I Y VN  N    + EN    TK +AL TVTDKD    G+V C   +     EI  R   + SN++ +     LD E+   Y +++   D G PPL   A++ + VKDENDNAPV       VS+ EN   G  +  ++A D D G N E+ Y +   +        ++  TG L    K+DRE++ + L +    +   D G PP  S     VS+ D+NDN+P F +   +F V EN     T+G I V D D  DNS + +S++   ++       F  D++   +    S D EK+++Y+F + A DG G  S +++A VT+ + D ND+ P FI P Y N++ Y     S     +   V  +D+   MN +  + +V  + + LF IDQ  G IT       +D+G H + V A D G P    S++I
Sbjct:   65 EIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEH----CFYEVEVAILPDEIF--RLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQ---NIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNL--VSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD--GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTK-IALITVTDKDADHNGRVTCFTDH-----EIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDA---PPEFSLDRRTGMLTVVKKLDREKEDKYLFT----ILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD-------FTIDSQTGVIRPNISFDREKQESYTFYVKAEDG-GRVSRSSSAKVTINVVDVNDNKPVFIVPPY-NYS-YELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVI 799          
BLAST of Protocadherin vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 158.303 bits (399), Expect = 1.420e-38
Identity = 190/750 (25.33%), Postives = 331/750 (44.13%), Query Frame = 3
Query:  492 NTKANRLFHLHS-NGKLYSAQTIDREELCINV--ESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPE-IAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI-KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRV--HDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKG----LFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI----DNSKPF 2696
            ++++  LF L + +G++  A+++DRE L  ++   +   + DP  IS S  V              + + D+ DN+P F  D +   I+E  P+G+      A D DS +    +Y L E +       L  N  +G +  Q    LDRE  +     ++A D+G P +    ++ I V+DVNDN P  +  +YN+   E+      +  + A DED   N K+ + + +   +         I+ ++G + L+E++D  ++      +   + A    ++T  + I VI++ND  P  IA   +    +N  I E        V      D+D G  G +   +  +E+   I + DS +      I+T   LDRET   Y L++   D G P L     I VV+KD NDNAP   K E NV++ E  P G+ +  IT K +D  ++ ++TY I E+       L+I      L    ++ R       Q   V + +S   Q     R   +V + D N +AP F ++    ++ E+    Y +  ++   HD+ DN+++  S+       SS F   +  +   ++ +  LD E    +S  + ASD      +T+T  + VI++D ND++P F   +Y+      +  E   +    + V  +D+    NG   + L          LF++D+  G +  S  +        V+ + ARD G P   ++  IT+ +    DN+  F
Sbjct:  206 DSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDP-TISASTTVV-------------VHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGN---GKNLLAINAKSGVI--QTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIG-----GLTIDYSTGEVTLRERID-AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEE-------VGRVYAIDEDSGPNGIIKYSMEGSEDF--IIDEDSGL------IKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQI--ITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKR-------QDHKVRVEISATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI------DSSQFFRIDPSSG-DISVSSDLDREDRATFSVIVTASDHASPPLNTST-QIEVILDDINDNSPQFTSSSYAA-----TISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTF 892          

HSP 2 Score: 135.191 bits (339), Expect = 1.872e-31
Identity = 155/576 (26.91%), Postives = 257/576 (44.62%), Query Frame = 3
Query:  681 IQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKY--------SIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI-KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGD---LKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERD----NKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDE 2360
            + ++DINDNAP F   ++ + I E  P GS      A D+D +Q     Y++EE      +FS+      G++ L +  +L R+   K    + A D+G     GR V+N+ + DVN  P + +   ++++  E      P++ + A+D D  DNA++V+ I        D++++FRI+ +SG+I +   LD E        V  S++A      +  + + + ++ND +P+        ++  A I E+    T F+ ++ + D D G  G V   L          N  SS PS +         ++R    LDRE      L +   D+G P L A + I + + D NDNAP   +L  ++ + EN P+G+ V  I A+D DEG N ++++ I   +D     +E ++       + TR + D E  +     F   L  S  GQ    S     + V D NDN P  +++ I     +N Q    +G I   D D N+ L              + L E D     KY        +W++  + SFK   SDG   +  T    + V++E E
Sbjct:  569 VVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKIT--YRIEEAD--REVFSILDIGDQGAI-LSVSGELKRQDH-KVRVEISATDQGG--LQGRCVVNVFIDDVNSAP-YFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI--------DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQF-----TSSSYAATISEDIPVGTSFLQVSAI-DADIGPNGIVDYFL----------NESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKA---NKFFFELQAS-SGQLS--STVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPDQNATLE-------------YFLEENDLIEAEKYTGKILVKQEWKRNMDVSFKTCVSDGANTECSTCR-FIHVLVEPE 1091          

HSP 3 Score: 123.635 bits (309), Expect = 5.333e-28
Identity = 141/580 (24.31%), Postives = 247/580 (42.59%), Query Frame = 3
Query:  681 IQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSS----IPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDL-TKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILT---VSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVL---FERDNKYYLNTTRSLDWEKEKN-YSFKILASDGTGYKSHTATATVTVIIEDENDHAPSF 2381
            I + DIND+AP     +  I ++E+  +G       A D+DS    I  Y +E +  F     ++++    S  ++  + LDRE  A+Y   + A D G P       I + + D+NDN P   +  YN+   E       ++ + A D DE+   K+ ++I   +    +      I +    + +  +L   +D + R  +  ++  G        V I  +N        +  Y N++  +  I E+       + L    D D+G            +N   +++ DSS    I  +   I     LDRE +  + + +   D   PPL     I+V++ D NDN+P     +   ++ E+ P+GT    ++A D D G NG + Y ++ESS   + +   ++  +G L+   K+DREQ       F VI+      D+G P   +     +++ D NDNAP FE  S    + EN     T+G I   D D+     +S        +  F +    E++    + T    D+E + N + F++ AS G      ++T  V + + D ND+ P+ 
Sbjct:  467 INVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDF----IIDED----SGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRI---EEADREVFSILDIGDQGAILSVSGELK-RQDHKVRVEISATDQGGLQGRCVVNVFIDDVN--------SAPYFNDHPFSVKIPEHSPIGYPVITLKA-EDHDRG------------DNARIVYSIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQ-------FAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSG----QLSSTVPVRIHVSDVNDNKPAL 1000          

HSP 4 Score: 95.9005 bits (237), Expect = 1.771e-19
Identity = 87/267 (32.58%), Postives = 133/267 (49.81%), Query Frame = 3
Query:  630 IAVKSDSIEEPRTFECRIQI--EDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGN-----IYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNK 1409
            I   SD    P     +I++  +DINDN+P+F +  +   I E  PVG+ F    A D D     I DY L E+S  P I     +R +G+L +    KLDRE+ A     + A DRG P  +    I + + DVNDN P   Q +Y++   E+      +  I A+D DE DNA + F+I        DA K F IEE++       I  + + DYE  + ++F+ E+  ++G + ++T  V I V ++ND  P +  D+V   N+
Sbjct:  753 IVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVS--SKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFG----GADA-KLFDIEEDAEQNGVVRILTRAEFDYEA-KANKFFFELQASSGQL-SSTVPVRIHVSDVNDNKPALK-DFVILMNR 1009          
BLAST of Protocadherin vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 136.346 bits (342), Expect = 6.796e-32
Identity = 182/706 (25.78%), Postives = 315/706 (44.62%), Query Frame = 3
Query:  630 IAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTD-----KDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQ------LRVSLV----HLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESS--ILITIVIDNSK 2690
            +AVK +  E   T +  ++++D NDNAP F      + I E   +G+ F+LP  TD D  ++ +  + + + ++   +F L   +    L   L+   +LDRE R KYE ++ A D G P K G+L  +I ++D NDN P  S++ Y      +      L+ + A D D  +N+++ + I   +     +N  F I + SG I     L       H   V  S++     +++A V I V+     +P + I ++ E+N +A + EN    +  VA  ++       K + +G    C    ++             ++ Y +     LDRET   + L+   E  G   +    L+   + D NDNAP     + + +  N+  G   T +TAKD D G+NG + YS+     L  + + I+  TG +     ID    SE    F V     D G P   +       + D     P+FE    Q ++ E+      +G   V    +NSQ      +R SL     HL  +  S  V  +          ++ D+EK+K+Y   ++A   T   S T+T+ +++ ++D ND+ P F +PN  + T  +      E  +L VS  D+DS     G+ S+H++++    F I+   G++   + ++    G+  + V A+D G    E+S  I IT++  ++K
Sbjct:   95 VAVKVE--ESGETIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNV-NNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDI---KKTSAPSNSNFAISQ-SGVITTTASL--LPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESN-SAHLMENSTLGS-IVARVSIAQQYRDTKLRLIGSSALCPQQTDQ-------------AHVYLLLLCGILDRETASEHHLKFLLEKDGQIIIEHPQLL--TIGDINDNAPQWH-SSQIHISLNRTQGGSRT-LTAKDPDLGQNGWIRYSV-----LDTELVSIDKETGRIFVPNTIDCNIGSEI--KFRV--RAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDT----PIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVDTMSGTVCIQ----------KTFDFEKQKSYQTTVIA---TNANSETSTSLISIRLKDVNDNWPIF-YPNEYHLT--VREGPKPEEPLLVVSASDMDS--GTFGEVSYHILSESSS-FSINPVTGEVFAQKPLAR---GRFHLVVSAKDGGGQSSENSANIHITVIDKDTK 737          

HSP 2 Score: 97.4413 bits (241), Expect = 5.012e-20
Identity = 150/682 (21.99%), Postives = 296/682 (43.40%), Query Frame = 3
Query:  651 IEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQ-----YSIRDYKL-----EENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDD--NSQLRVSLVHLPNEMSSPFVLFERDN-KYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESS 2657
            IE P+     + I DINDNAP++ + +  I++  ++  G   +L  A D D  Q     YS+ D +L     E   IF P                    +D    ++ +F + A D G+P  +  L +  ++LD    PP   +  + ++  E       L+K+ A +    ++ ++ + + N+       +++  ++  SG + +++  D+E+ + ++  V  +N   + +T+T+ + I++ ++ND  P   I Y NE +    ++E    +   + ++  +D D G  G+V   + +  + F I+     + + K   R          G + L +  +D G       A I + V D++   P    + + S YE +    ++  I    +  G   ++ YSI  S D    +  I+  TG +     +D +     L +    L   +  Q   +      + ++D NDN P+F +  ++  + E+ +       ++  DKD   N ++R S++      S P    E D     L+T   LD+E  +NY  ++ A+D  G    ++  T+ + + D ND+AP F     S +T  +  +   +  +  V   D DS +  NG+  + + N  +  F ID+  G + T R++    +    I+++A D G PP+ S+
Sbjct:  423 IEHPQL----LTIGDINDNAPQWHSSQIHISLNRTQ--GGSRTL-TAKDPDLGQNGWIRYSVLDTELVSIDKETGRIFVP------------------NTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQ-------DEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATN--ANSETSTSLISIRLKDVNDNWP---IFYPNEYHLT--VREGPKPEEPLLVVSA-SDMDSGTFGEVSYHILSESSSFSINPVTGEVFAQKPLAR----------GRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTP----QFSRSKYEIRTTEDILPGIAIGSV--GAMSKVKYSIY-SGDQDHNF-SIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGESNQTQVV------IFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIIS-----SHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATD-LGIPPRSSNMTLFIHVLDVNDNAPEF---EKSWYTMEVLENSPPKTIVGKVVARDKDSLE--NGQIVYRITNGSE-YFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSST 1028          

HSP 3 Score: 97.4413 bits (241), Expect = 5.228e-20
Identity = 159/683 (23.28%), Postives = 284/683 (41.58%), Query Frame = 3
Query:  693 DINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVS--NNAGHVDTATATVLIQVINLNDETPE-----------------IAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFE--IHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGD-PPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASD-GTGYKSHTATATVTVIIEDENDHAPS------FIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPK 2648
            D     P+F    + + I E  P+G+     +A +          Y L+          L  +  +G++ +Q  +  D EK+  Y+  ++A +  +   T  + I +  ++ N    + ++  Y++   E     +PLL + A D D     ++ + I++E       +  F I   +G ++ ++ L      + RF++ VS  +  G     +A + I VI+ + +TP+                 IAI  V   +K  +   + DQ   F       D+D G   +++     + +V +  + N  +++PS + S +T+V +              ED  D PP  + +L+++ ++++      +KL     V            + A D D+ KNGE+ YSI  S       +EI+  TG L T   +D E      +++ + +  +D G PP+ S     + V D NDNAPEFE      +V EN      +G++   DKD  +N Q    +V+     S  F + E+    Y  T RS+D E   +    I+A D G   +S TA+A ++V+  D ND+ PS       + P  S  +  I             ++  +D    +NG    +       LF +  N G +   R ++ SD     ++VI  D G P K
Sbjct:  532 DTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQD-----EHLTVDTMSGTVCIQ--KTFDFEKQKSYQTTVIATNANSETSTSLISIRLKDVNDNWPIFYPNE--YHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSE-------SSSFSINPVTGEVFAQKPL-----ARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMSKVKYSIYSGDQDHNFS-----IDEDTG---KIYVTRYLDADVHDTVLLNIQATLPSGE-SNQTQVVI------------FIEDHNDNPPQFSSSLVEISIRED------LKLHEPFYV------------VQASDKDKKKNGEVRYSIISSH--PGSSIEIDQFTGQLSTGSLLDYE----ATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQ----IVYRITNGSEYFGIDEKLGNVY--TKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVL--DVNDNPPSCLSITPIVVPAGSPLSTAIG------------TIVAMDPDKGLNGSV-LYRAQLQSSLFVVKSN-GDVYLRRQLNASDERHQRLSVIVSDQGVPRK 1126          

HSP 4 Score: 93.5893 bits (231), Expect = 8.472e-19
Identity = 82/321 (25.55%), Postives = 140/321 (43.61%), Query Frame = 3
Query: 1098 QPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKG---------QPPQISRKAFDVSVKD 2033
            +P   + A D+D+  N ++ + I++  P          I++ +G +     LDYE    ++  V+ ++      ++  T+ I V+++ND  PE    +         + EN   KT  V      DKD    GQ+  R++N    F I  +      N Y+ R+   +DRE   + ++ +  EDKG PP  + A  ++ V D NDN P       + V    P+ T +  I A D D+G NG + Y     S L      +    GD+  R +++     E  Q   VI  VSD+G          P +IS+ + D+ +++
Sbjct:  854 EPFYVVQASDKDKKKNGEVRYSIISSHP-----GSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTME-----VLENSPPKT-IVGKVVARDKDSLENGQIVYRITNGSEYFGIDEK----LGNVYTKRS---IDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRAQLQSSLF-----VVKSNGDVYLRRQLN--ASDERHQRLSVI--VSDQGVPRKSVVCHVPVRISKGSADIQIQE 1147          

HSP 5 Score: 83.5741 bits (205), Expect = 8.857e-16
Identity = 94/376 (25.00%), Postives = 167/376 (44.41%), Query Frame = 3
Query: 1599 LDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI-KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVK--DENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDD--NSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSF--HLVNDHKGLFKIDQNKGKITTSRTM-SESDMGKHVITVIARDHGNPPKESSILITIVIDNSKPFSI 2702
            +DRE +  +E Q+E +++     + +    V+V DENDN PV   +   +S+ ++   G  +  I A D D G+NG ++Y I   +DL    + +N  TG ++     D + D     ++ +++   D G P + +     VS+K    + +AP F     +  V E+      L +IR  ++    N  L  SL     E      +  +  +  L T   LDWE E   S  +  SDG G    +A   + +++E  ++ AP F     S++T  I     A       SVG + + D   G      + ++D +   KI+++ G I   + + S  ++    ITV+A  + +P K+S   + + I    PF +
Sbjct: 2188 IDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDL--NIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSL----KEHQGKLGIDVKTGELTLKT--HLDWESEPIISMYLSVSDGNG---RSAVVPLKIVVEPVDEFAPVF---TKSSYTLQIPISTPA-----GESVGQMQAIDEDGGVHGVVKYSISDRQSTVKIEEHTGIIRLQKPLVSRRNLTIEQITVVA--YSSPTKQSKTTVYLEIG---PFDV 2539          

HSP 6 Score: 70.0922 bits (170), Expect = 1.207e-11
Identity = 118/510 (23.14%), Postives = 215/510 (42.16%), Query Frame = 3
Query: 1206 FRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENE---DQKTKFVALATVTDKDKGLGGQVHCRLSNN---------ENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYY-ELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVH-LPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNSKP 2693
            F I   +G+I +   LD E  ++H   + +++     D+ T  V + V + ND  P++     +E      I E+    D   +F A    +D D G  G+    L  +         E    +  R SS+ S K  +R    +D    G Y E  +E  ++ +P   AKA ++            +K     ++ E  P G  +  +      + +   LTYSI E +        ++S  G ++T +++DRE     L+ + + +  +  GQ  QI  +  DV V + NDN P F   S   +V EN +    +  +   D D+ + LR  LV     +  + F + +     +L  T  LD+E    ++  I A+DG    S      +T+ + D ND+AP+F  P Y       ++      A   +   DLD++    G  ++ L      +F++    G +         +  ++++TV A D+G P   +S+ ++++I  ++P
Sbjct: 1673 FSINSTTGSISVL-PLDREASQEHLLIIILTDGGSRNDSCT--VRVTVADQNDNKPQLDASTPSELE----IAESSRVGDVLHRFRA----SDMDIGQNGKFSFELLEDSSGSLDLVPETGDLVLRRLSSLQSWKIKLRV---VDHGVPGLYVEKNLEISNR-NPQTEAKAPLEF-----------LKQTYLSTIDEGLPRGQFIAKL------QPELAGLTYSIVEGN--IDSAFSVDSE-GVIRTNLELDRE----ILERYSLKVIGTGSGQ--QIGTRV-DVRVNNLNDNVPSFP-MSKPRRVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHL--TAPLDFEVLPEHTLTIKATDG----SFDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFA--KIEAHDLDAR----GALTYSLGQGSSSIFRVAPESGALFMKVLPPAGE--RYLVTVTATDNGVPSFSTSVPVSVIIGEAEP 2125          

HSP 7 Score: 70.0922 bits (170), Expect = 1.281e-11
Identity = 101/413 (24.46%), Postives = 174/413 (42.13%), Query Frame = 3
Query: 1485 GLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLE--NNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMN-GKCSFHLVNDHKGL----FKIDQNKGKITTSRTMSESDMGKHVITVIARDHG-NPPKESSILITIVIDNSKPFS 2699
            G+  +   R   N   F I++   SI        + + LDRE    + L +   D G         ++V V D+NDN P +     + + + E+  +G ++    A D+D G+NG+ ++ + E S      L++   TGDL  R          +LQS+ + L V D G P     K  ++S ++    A     +  Q  ++   + L   G+     + + + L  S+V     + S F +   D++  + T   LD E  + YS K++   GTG      T  V V + + ND+ PSF        +K     E+  +     +VG   +KD  N     + LV+D  G     F IDQ  G I  +  +    + +H +T+ A D   +     +I ++ + DN+  FS
Sbjct: 1657 GMTEESRFRFQGNAPKFSINSTTGSI--------SVLPLDREASQEHLLIIILTDGGS--RNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLEDS---SGSLDLVPETGDLVLRRL-------SSLQSWKIKLRVVDHGVPGLYVEKNLEISNRNPQTEAKAPLEFLKQTYLSTIDEGL-PRGQFIAKLQPELAGLTYSIVE--GNIDSAFSV---DSEGVIRTNLELDREILERYSLKVI---GTGSGQQIGT-RVDVRVNNLNDNVPSF------PMSKPRRVPENLRVGSYVATVG---AKDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSFDTFTNLTIFVSDINDNAPTFS 2030          

HSP 8 Score: 52.373 bits (124), Expect = 2.894e-6
Identity = 72/336 (21.43%), Postives = 143/336 (42.56%), Query Frame = 3
Query:  387 KVTDNTKENSFISNLNSFDVYSTPYTQNKKFNL-LSNTKANRLFHLHSNGKLYSAQTIDREELC-------INVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYK-LEENSIFPPIFSLEQNRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKT--GRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVIN 1355
            +V +N+K    I NL+          ++++F+  + + +A+++F +   G+L+ A  IDRE+         I+ E    +K  C                   +C + + D NDN P F +  + +++K+S   G      +A+D DS +     Y+ L  N +   I +L  N  TGS+ L      +LD    A ++ ++ A D G+P +   G++ +++ +   + + P      Y +   E       L KI A +     N  +++ +   Q           I+  +G + LK  LD+E +     Y+ VS+  G        ++++ ++
Sbjct: 2139 EVMENSKIGLQIGNLSG--------EESREFHYRIQDPEASKIFSIDKFGRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQC-------------------KCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDL--NIVTL--NPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLKEHQ-------GKLGIDVKTGELTLKTHLDWESEPIISMYLSVSDGNGRSAVVPLKIVVEPVD 2436          
BLAST of Protocadherin vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 134.806 bits (338), Expect = 2.378e-31
Identity = 155/576 (26.91%), Postives = 257/576 (44.62%), Query Frame = 3
Query:  681 IQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKY--------SIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI-KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGD---LKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERD----NKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDE 2360
            + ++DINDNAP F   ++ + I E  P GS      A D+D +Q     Y++EE      +FS+      G++ L +  +L R+   K    + A D+G     GR V+N+ + DVN  P + +   ++++  E      P++ + A+D D  DNA++V+ I        D++++FRI+ +SG+I +   LD E        V  S++A      +  + + + ++ND +P+        ++  A I E+    T F+ ++ + D D G  G V   L          N  SS PS +         ++R    LDRE      L +   D+G P L A + I + + D NDNAP   +L  ++ + EN P+G+ V  I A+D DEG N ++++ I   +D     +E ++       + TR + D E  +     F   L  S  GQ    S     + V D NDN P  +++ I     +N Q    +G I   D D N+ L              + L E D     KY        +W++  + SFK   SDG   +  T    + V++E E
Sbjct:  210 VVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKIT--YRIEEAD--REVFSILDIGDQGAI-LSVSGELKRQDH-KVRVEISATDQGG--LQGRCVVNVFIDDVNSAP-YFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI--------DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQF-----TSSSYAATISEDIPVGTSFLQVSAI-DADIGPNGIVDYFL----------NESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKA---NKFFFELQAS-SGQLS--STVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPDQNATLE-------------YFLEENDLIEAEKYTGKILVKQEWKRNMDVSFKTCVSDGANTECSTCR-FIHVLVEPE 732          

HSP 2 Score: 129.413 bits (324), Expect = 9.002e-30
Identity = 138/558 (24.73%), Postives = 242/558 (43.37%), Query Frame = 3
Query: 1059 NYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPE-IAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI-KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRV--HDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKG----LFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI----DNSKPF 2696
            +YN+   E+      +  + A DED   N K+ + + +   +         I+ ++G + L+E++D  ++      +   + A    ++T  + I VI++ND  P  IA   +    +N  I E        V      D+D G  G +   +  +E+   I + DS +      I+T   LDRET   Y L++   D G P L     I VV+KD NDNAP   K E NV++ E  P G+ +  IT K +D  ++ ++TY I E+       L+I      L    ++ R       Q   V + +S   Q     R   +V + D N +AP F ++    ++ E+    Y +  ++   HD+ DN+++  S+       SS F   +  +   ++ +  LD E    +S  + ASD      +T+T  + VI++D ND++P F   +Y+      +  E   +    + V  +D+    NG   + L          LF++D+  G +  S  +        V+ + ARD G P   ++  IT+ +    DN+  F
Sbjct:   20 SYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIG-----GLTIDYSTGEVTLRERID-AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEE-------VGRVYAIDEDSGPNGIIKYSMEGSEDF--IIDEDSGL------IKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQI--ITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKR-------QDHKVRVEISATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI------DSSQFFRIDPSSG-DISVSSDLDREDRATFSVIVTASDHASPPLNTST-QIEVILDDINDNSPQFTSSSYAA-----TISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTF 533          

HSP 3 Score: 123.25 bits (308), Expect = 6.473e-28
Identity = 141/580 (24.31%), Postives = 247/580 (42.59%), Query Frame = 3
Query:  681 IQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSS----IPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDL-TKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILT---VSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVL---FERDNKYYLNTTRSLDWEKEKN-YSFKILASDGTGYKSHTATATVTVIIEDENDHAPSF 2381
            I + DIND+AP     +  I ++E+  +G       A D+DS    I  Y +E +  F     ++++    S  ++  + LDRE  A+Y   + A D G P       I + + D+NDN P   +  YN+   E       ++ + A D DE+   K+ ++I   +    +      I +    + +  +L   +D + R  +  ++  G        V I  +N        +  Y N++  +  I E+       + L    D D+G            +N   +++ DSS    I  +   I     LDRE +  + + +   D   PPL     I+V++ D NDN+P     +   ++ E+ P+GT    ++A D D G NG + Y ++ESS   + +   ++  +G L+   K+DREQ       F VI+      D+G P   +     +++ D NDNAP FE  S    + EN     T+G I   D D+     +S        +  F +    E++    + T    D+E + N + F++ AS G      ++T  V + + D ND+ P+ 
Sbjct:  108 INVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDF----IIDED----SGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRI---EEADREVFSILDIGDQGAILSVSGELK-RQDHKVRVEISATDQGGLQGRCVVNVFIDDVN--------SAPYFNDHPFSVKIPEHSPIGYPVITLKA-EDHDRG------------DNARIVYSIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQ-------FAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSG----QLSSTVPVRIHVSDVNDNKPAL 641          

HSP 4 Score: 120.168 bits (300), Expect = 6.691e-27
Identity = 154/643 (23.95%), Postives = 281/643 (43.70%), Query Frame = 3
Query:  681 IQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATV-TDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFV-LFERD-NKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKG-LFKIDQNKGKITTSRTMSESDM 2597
            I + D+NDNAP F +D + + I E+  + ++ +   ATD+D        Y +  +S    I  L  +  TG + L+  +++D  K +    V+ A D   P  +  + + INV+D+ND+ P L      I  EE+    + + ++ A DED   N  + + +        + ++ F I+E+SG I   + LD E   ++   V   +        + T+ + + ++ND  P       ++   N  I E   + ++ + L  V  D+D+ +  ++      +  VF I +    I      +     L R+    +++++E        L+ + ++ V + D N          +V + E+ PIG  V  + A+D D G N  + YSI  S     ++  I+  +GD+     +DRE  +    +F VI+T SD   PP  +    +V + D NDN+P+F + S    ++E+     +  ++   D D      V    L    SSP + LF  D     L  +  LD E+       I A D  G  S +A + +T+ + D ND+AP+F      ++  YI+ +      + T+   D D  D  N   SF +       LF I+++  +    R ++ ++ 
Sbjct:    4 ITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSS---GIGGLTIDYSTGEVTLR--ERID-AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSM--------EGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTF-----DKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIE---EADREVFSILD----IGDQGAILSVSGELKRQD---HKVRVEISATDQGGLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS-----QFFRIDPSSGDISVSSDLDREDRA----TFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDY-FLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARD-RGTPSLSAASEITLTLSDVNDNAPTF---EQLSYDLYIAENSPVGSTVGTIVARDADEGD--NADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEF 601          

HSP 5 Score: 95.9005 bits (237), Expect = 1.791e-19
Identity = 87/267 (32.58%), Postives = 133/267 (49.81%), Query Frame = 3
Query:  630 IAVKSDSIEEPRTFECRIQI--EDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGN-----IYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNK 1409
            I   SD    P     +I++  +DINDN+P+F +  +   I E  PVG+ F    A D D     I DY L E+S  P I     +R +G+L +    KLDRE+ A     + A DRG P  +    I + + DVNDN P   Q +Y++   E+      +  I A+D DE DNA + F+I        DA K F IEE++       I  + + DYE  + ++F+ E+  ++G + ++T  V I V ++ND  P +  D+V   N+
Sbjct:  394 IVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVS--SKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFG----GADA-KLFDIEEDAEQNGVVRILTRAEFDYEA-KANKFFFELQASSGQL-SSTVPVRIHVSDVNDNKPALK-DFVILMNR 650          

HSP 6 Score: 95.1301 bits (235), Expect = 2.490e-19
Identity = 70/235 (29.79%), Postives = 115/235 (48.94%), Query Frame = 3
Query: 1680 LIKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSF 2381
            ++++ V D NDNAPV   ++ NV++ EN  I  ++  + A D D G NG++ YS++ SS +    L I+  TG++  R +ID +    T      ++   D  QP   S     ++V D ND+AP          + EN      +G +   D+D        ++    E S  F++ E  +   + TT+ LD E    YS K+ A D  G  S   + T+ V+++D ND+AP+F
Sbjct:    1 MVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGG--LTIDYSTGEVTLRERIDAKNSPIT-----AVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPN---GIIKYSMEGSEDFIIDE--DSGLIKTTKLLDRETTARYSLKVTARD-MGTPSLNTSTTIAVVLKDINDNAPTF 222          

HSP 7 Score: 61.2326 bits (147), Expect = 5.730e-9
Identity = 60/231 (25.97%), Postives = 96/231 (41.56%), Query Frame = 3
Query: 2016 DVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI----DNSKPF 2696
            +++V D NDNAP F + S    + EN      +  ++  D+D  +  +   VH     SS       D      T R     K    +  I A DG    + ++T  +T+ + D NDHAP+ I        K I+  E+  I      V  +D     NG   + +       F ID++ G I T++ +      ++ + V ARD G P   +S  I +V+    DN+  F
Sbjct:    3 EITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGK---VHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAVIRAKDG-AQPALSSTVPLTINVIDINDHAPTLIAAQ-----KMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED--FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTF 222          
BLAST of Protocadherin vs. Ensembl Celegans
Match: cdh-4 (Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI5])

HSP 1 Score: 134.806 bits (338), Expect = 2.654e-31
Identity = 133/495 (26.87%), Postives = 244/495 (49.29%), Query Frame = 3
Query: 1197 NKYFRIEENSGNIYL------------KEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNN-ENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI-KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSL-VHLPNEMS--SPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARD 2630
            N  F++ +N GN+++             +++DYE+++Q  F+     +   V     TV+I+  NLND  P+I I+ + + + +  +  +ED + +++      D D     ++  R+ ++   +F+I + +  +   K        LD E  G++ L +   D        KA I V V D+NDNAP   K   ++ V E++ IG  + H  A   D+  N  + Y + + SD+T  ++ +N+ TG L     + +  D ETL +  + +   D G PP  +    ++SV DENDNAP+FE      +V EN ++   +  ++  D D      VS  + + +E +  +P + F  ++   +  ++S+D+EK K Y+ K++A DG G     + A + + +EDENDHAP+F   +  N T  +   E+    +L  SV DLD   +     +  +  D    FK+++ K ++ T++ +      K+++TVIA+D
Sbjct: 2941 NVTFKLSDNDGNVFVVNFRNGIVKVKESDQIDYEKNQQLEFHRLTIQDNSEVCKELITVVIE--NLNDNRPKI-IEKLLKVSIDENLPTSEDAR-QYITRIVAEDAD---FDEIKFRMVDDFGGLFQIDDINGVVTVVK-------PLDSEILGFFNLTVVASDG---EFEDKATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQ--NETIEYYL-KPSDVTS-FVNLNAQTGILT----LAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDG-GRPPLRSEALLEIHVEDENDHAPTF---DDCNMTALVQEGEAIGHRLLKFSVSDLDGPKN-GAPFTVEIQGDGAKSFKVNE-KLELLTAKKLEYRKKDKYLLTVIAKD 3404          

HSP 2 Score: 119.398 bits (298), Expect = 1.114e-26
Identity = 189/696 (27.16%), Postives = 305/696 (43.82%), Query Frame = 3
Query:  681 IQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATD-DDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNI-QYEESKF-------SMQPLLKIGAKDEDENDNAKMVFKI--VNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNE-NVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYEL-QMECEDKGDPPLRAKALIKVVVKDENDNAP-VIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTK-KYLEINSHTG-----DLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKA-FDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHL------VNDHKGL-FKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDN 2684
            + I D+NDNAP F  D     I E   VG+  ++  A D DDS    IR   +EEN    P F L +N    S  L +  +LDREK   Y+ +  A D G                       +S  N +  Q+E+ +F       S  P+L    KD+D + N    F I   NE+ V       F I+ N+ ++ LK     E   Q++  V   +  G  +T+T       + +N ++ + +     E NK   + EN  + T  +  +++      LG  V  +LS+N+ NVF ++ R+  +      ++    +D E     E  ++  +D  +     K LI VV+++ NDN P +I+    VS+ EN P        T++D  +     +T  ++E +D  + K+  ++   G     D+   + + +  DSE L  F + +  SD     +   KA   V+V D+NDNAP FE  +   +V E++   Y L   R    D N  +   L   P++++S FV         L   + LD+E        ++A D +G       A V + + DEND+AP F    Y    K  S  +S E  +LTV   D+DS+    G  S+ L        D   L F I+ N G +  S+++    + K+ + VIA+D G PP  S  L+ I +++
Sbjct: 2700 VDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEEN----PYFDLNEN----SGWLTVASQLDREKIDHYKLIARATDEGG------------FNTDLPFTIVVSDVNDSPPQFEKEEFNIDLHLPSTSPILHFSIKDDDLSPNNVSQFFIPKGNEEGV-------FWIDSNN-DLLLKRPEIVENKMQYQLKVTAFD--GVFETSTK------VKINLKSSKDSDIRCPEANKTVILAENSKKGTVVLGESSL------LGPNVTFKLSDNDGNVFVVNFRNGIV-----KVKESDQIDYEKNQQLEFHRLTIQDNSEV---CKELITVVIENLNDNRPKIIEKLLKVSIDENLP--------TSEDARQ----YITRIVAEDADFDEIKFRMVDDFGGLFQIDDINGVVTVVKPLDSEILGFFNLTVVASDG----EFEDKATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQNETIEYYL--KPSDVTS-FVNLNAQTGI-LTLAKPLDFETLSALKLTVVAKD-SGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENS--KSGE-KVLTVKALDVDSEHF--GAVSYELEIVSETTTDTPVLPFAINSN-GDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVED 3318          

HSP 3 Score: 103.605 bits (257), Expect = 7.797e-22
Identity = 161/683 (23.57%), Postives = 287/683 (42.02%), Query Frame = 3
Query:  699 NDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSE-----QYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQL-IQKLDREKRAKYEFVL--LAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN---NVSVYENKPIGTLVTHITAK---DIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVK--DENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERD-NKYYLNTT--RSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYI-SYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNS 2687
            N ++P F +    + + E  P+G++ +   A D+D+      +Y I D     + +      L  +  +G + +   + KL +EK    +  L   AID G P K+    + + + DVN++ P   + +Y ++  E++   + + K+ A D D  +N K+ F + N Q    + +    I+  +G + L + LD E  + H F +  S+    +  +   + I V ++ND  P+  + +       A I E+      FV+     D+D G   ++   L++ +  F I +    I    +       LD     ++ L +E  D GDP L     + V + D   N   I+ ++     SVYEN  IGT V  I AK   D  + K   L Y I          ++     G ++T   +DRE  S    +     + +D  + P+  R    V ++  D ND+ P  +       V EN  A   + ++   D DD      + +    E   P   F  D    Y+ T+  R LD EK+  +   +   DG G     +   V V + DEND++P+        FT+ I  Y   ++ A     +  +D+ +  N + +++ + +    F ID N G I  S  +   +   + +TV A DHG P ++ +    ++  NS
Sbjct:  602 NKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEV------LTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQ----EKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQH-----SRARIPEDLPHGA-FVSCMAAFDEDIGQNSKLKFLLNSEKVPFRIDHHSGCI----FIHAPEYPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEFDDVAKEASVYENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGGDGWPHFSID---QKGTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPR-RRDVLHVFIRILDRNDHRPVAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQSFFRIDLTSGYITTSGIRRLDREKQSEHELWVSICDG-GEPQLCSNVIVIVNVLDENDNSPT--------FTQAIHHYSVRSKFAGKLCRIFAVDADEGENARLTYN-ITEGDARFSIDNN-GNIIASEAIHGDE--SYALTVQATDHGTPGQQFAATRVVLTANS 1247          

HSP 4 Score: 98.5969 bits (244), Expect = 2.809e-20
Identity = 123/506 (24.31%), Postives = 226/506 (44.66%), Query Frame = 3
Query: 1206 FRIEENSGNIYLKEKLDYERDEQ-HRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSN------NEN-----VFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDP-PLRAKALIKVVVKDENDNAPVIK-LENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVS--DKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEI------AILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHV---ITVIARDHGNP 2642
            F I   +G + +  K++  R E+ + F V  S +  +   A   V I++++ ND  P  +  ++ +      I +  D   K  A    TD+D+G  G++  + ++      N N     + E+  + +S P+  ++I   + L R +     L +     G   P + K +I  + + EN ++PV       V V E+ PIGT+V  + A D D G NG + Y I + +  + + L ++  +G++     + +    E L+   V L VS  D G P + S K   + +KD N+++P+F+  S   +++EN++    + ++  +D D  +N +++ SL +  N+  S  +  +      +   +SLD E +  ++F I+ASD  G+    +   +T+ +ED ND+ P           K +  H  A I            +   D     N K  F L+N  K  F+ID + G I         D  K     +++   DHG+P
Sbjct:  436 FAIGSKNGILRVSAKIN--RSERVYNFKVIASLHGINEKLAEKDVSIEILDSNDHAPVFSAKWMRQTP--IVIGKPGDVLVKVDA----TDQDEGENGKIVYKFTSELPLEINANTGEITLVEVPKKGNSWPATVWAIDLGLPLSRMSA----LNLMFYKNGTKIPAKPKPII--IQESENKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLM-KEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGN--NQEKSSVISIDAKTG-IVKLLKSLDREDQDVHTFAIIASD-EGFPMRVSVTNLTISVEDVNDNPP-----------KCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKF-LLNSEKVPFRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDP 910          

HSP 5 Score: 91.6633 bits (226), Expect = 3.290e-18
Identity = 156/687 (22.71%), Postives = 273/687 (39.74%), Query Frame = 3
Query:  681 IQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSE---QYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKY--FRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI-KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKI--DREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFI-----------FPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDN 2684
            + + DIND  P F    ++ +I ES   G    +  ATDDD     +YS+ D    +       FS+   + T    + + +KL+ +        + A D  NPP      + +N+   +   P  S ++Y     E          IG   + E +  ++ F IV   P   +++ +  F +E ++G I +K  LD ER  Q +  +  ++ AG V  A  TV + + ++ND  P    DY     +   I E+    T  V + +  D+D    G++   L      F+++        N   +     LDRE   +Y+L     D+G           +VV D ND+ P   K E N+ ++   P  + + H + KD D   N    + I + ++  +    I+S+   L  R +I  ++ Q    + +F  +   S K +    S K  D+   + N      EN      V      L      ++ D D N                 FV+  R+    +  +  +D+EK +   F  L        S      +TV+IE+ ND+ P  I            P   +  +YI+                + ++D+   +  F +V+D  GLF+ID   G +T  + +    +G   +TV+A D G    +++IL+T++  N
Sbjct: 2493 LSVIDINDKPPFFVLPFYSTSISESAKEGDTVMMVSATDDDENDTIEYSLLDGSESQ------FFSVHPRQGT----ITVAKKLEHKAGVTLSLTIKATDSANPPHHATTTVEVNIASESVKVPRFSNSHYLFSVMEDADVGN---VIGRVQQMETEIDEIRFTIV---PGSEESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMTIR-ADAAGGVH-AITTVTVDIGDVNDNAPAFHGDY-----ERFTISEDAAVGTS-VTIFSAMDRDDSPSGRIRFSLVEENPYFDLNE-------NSGWLTVASQLDREKIDHYKLIARATDEGG--FNTDLPFTIVVSDVNDSPPQFEKEEFNIDLH--LPSTSPILHFSIKDDDLSPNNVSQFFIPKGNE--EGVFWIDSNNDLLLKRPEIVENKMQYQLKVTAFDGVFETSTKVKINLKSSKDSDIRCPEANKTVILAENSKKGTVVLGESSLLGPNVTFKLSDNDGNV----------------FVVNFRNGIVKVKESDQIDYEKNQQLEFHRLTIQD---NSEVCKELITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITR---------------IVAEDADFDEIKFRMVDDFGGLFQIDDINGVVTVVKPLDSEILGFFNLTVVASD-GEFEDKATILVTVIDQN 3107          

HSP 6 Score: 91.6633 bits (226), Expect = 3.862e-18
Identity = 188/866 (21.71%), Postives = 352/866 (40.65%), Query Frame = 3
Query:  300 KIIKMKIVFGMIL---------FSFGLFRKCKS------EPCDIKVTDNTKENSFISNLNSFDVYSTPYTQ--NKKFNLLSNTKANRLFHLHSNGKLYSAQTIDRE-----ELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIE-----DINDNAPRFRTDKFTINIKESEPVGS-LFSLPIATDD--DSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDED-----ENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYER--DEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAID---YVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGG--QVHCRLSNNENVFEIHNRDS---SIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLE-NNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSS--PFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNSKPFSIGQSNENNRDPNYVNKKF 2753
            KI+  K+V G  L         F+F L  K         EP  I+V D  +       + S +VY+   ++   KK  +L    A       S G L   + +D++     +         + K   + + +  V++  +  P+    + Q+E      I  +AP F   K+T +  ES  +G  L ++   T D  D+ +YS+   K            +E +  TG  ++ +  +LD EK  KY+  L+A   G    +      + + DVND  P   +++ + +  +S  + Q +  + A D D     + ++ K+++KIV+           F I   +G + L   ++ +   +E  +  + VS   G   TA A ++++++      P    +   YV    +N  + ++        AL TV  K    GG   +   L+   +     ++++   +I      I     L+      Y++ +  ED      RA + + + V D ND  P   L   + S+ E+   G  V  ++A D DE  N  + YS+ + S+   ++  ++   G +    K++ +       +  + +  +D   PP  +    +V++  E+   P F N    F V E+      +G ++  + + + ++R ++V    E  S  PF +     K  + +  SLD E++  +   I A    G     A  TVTV I D ND+AP+F   +Y  FT      E A +         +D  DS +G+  F LV ++   F +++N G +T +  +    +  + +   A D G              +   PF+I  S+ N+  P +  ++F
Sbjct: 2028 KIVGGKVVLGKKLPSIEEEDLEFNFKLIAKDNGSVHRVEEPVKIRVVDKARP------VFSQNVYTAVISKESTKKSTVLVKVMAKSSLQSKSKG-LIGYRILDKKSPFSVDFLTGEVRLNNLKMLAETNYTFEVEAREVTRPKMI-AKAQVEIIVKSGITTHAPVFEKLKYTASTPESTSIGQRLLTIKATTSDENDTIEYSLSGSK-----------DIEIHPETG--DVTITGQLDYEKTQKYDLKLVATSSGK-QVSSEAEFIVLIEDVNDEMPEFIRSDVSAKISDSAITGQFITIMSATDMDTTNSLDEESQKLLYKIVDGD------ETLFNISPATGELSLARPVEQDDLVNEDTKKVLNVSVTDGMF-TAYAKLVVEILRSGSMQPPPRFEQSHYVANALENTIVNKS--------ALLTVAVK----GGVPPLQFSLAPTTSSNSSTSKEAWPVAIDRKTGRIHVSRVLNYHRDKRYQIPLVVEDATG--RRAFSTLTLSVIDINDKPPFFVLPFYSTSISESAKEGDTVMMVSATDDDE--NDTIEYSLLDGSE--SQFFSVHPRQGTITVAKKLEHKAGV----TLSLTIKATDSANPPHHATTTVEVNIASESVKVPRFSNSHYLFSVMEDADVGNVIGRVQQMETEID-EIRFTIVPGSEESDSFLPFSVERSTGKIIVKS--SLDRERKNQWKMTIRADAAGGVH---AITTVTVDIGDVNDNAPAF-HGDYERFT----ISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEENP-YFDLNENSGWLTVASQLDREKIDHYKLIARATDEGG------------FNTDLPFTIVVSDVNDSPPQFEKEEF 2818          

HSP 7 Score: 85.1149 bits (209), Expect = 3.448e-16
Identity = 107/456 (23.46%), Postives = 200/456 (43.86%), Query Frame = 3
Query: 1212 IEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIP-SNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENN---VSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYL--EINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDD--NSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHL-VNDHKGLFKIDQN 2552
            I+  +G I++   L+Y RD++++  + V +  G    A +T+ + VI++ND+ P   + + + +     I E+  ++   V + + TD D+    +      +    F +H R  +I  + K   +  VTL         L ++  D  +PP  A   ++V +  E+   P  +  N+    SV E+  +G ++  +      E +  E+ ++I   S+ +  +L   +   TG +  +  +DRE+ ++    + + +     G    I+    D+   D NDNAP F     +F ++E+     ++      D+DD  + ++R SLV    E +  F L E  N  +L     LD EK  +Y     A+D  G+ +       T+++ D ND  P F    ++     I  H  +   IL  S+ D D   S N    F +   + +G+F ID N
Sbjct: 2452 IDRKTGRIHVSRVLNYHRDKRYQIPLVVEDATGR--RAFSTLTLSVIDINDKPPFFVLPFYSTS-----ISESA-KEGDTVMMVSATDDDENDTIEYSLLDGSESQFFSVHPRQGTITVAKKLEHKAGVTL--------SLTIKATDSANPPHHATTTVEVNIASESVKVP--RFSNSHYLFSVMEDADVGNVIGRVQQM---ETEIDEIRFTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRERKNQ----WKMTIRADAAGGVHAITTVTVDIG--DVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLV----EENPYFDLNE--NSGWLTVASQLDREKIDHYKLIARATDEGGFNTDLP---FTIVVSDVNDSPPQFEKEEFN-----IDLHLPSTSPILHFSIKDDDL--SPNNVSQFFIPKGNEEGVFWIDSN 2864          

HSP 8 Score: 72.7886 bits (177), Expect = 1.813e-12
Identity = 143/618 (23.14%), Postives = 254/618 (41.10%), Query Frame = 3
Query:  681 IQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIR---------DYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTAT-ATVLIQVINLNDETPEIAID-YVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIP---SNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVS-VYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKID-REQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQ---LRVSLVHLPNEMSSPFVLFERDNKYYL---NTTRSLDWE----KEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPS----------FIFPNYSNFTKYISYH 2426
            + IE++NDN P+       ++I E+ P          T +D+ QY  R         + K      F  +F ++         + +++ LD E    +   ++A D     K     I + V+D NDN P   ++ Y+++  ES+     L    A   D+N+  +   K         D   +  +   +G + L + LD+E     +  V V+ ++G     T A V I V++ ND  P+   + YV +      +KEN     K + +  + D D    G V   L   E V E       +P   ++   +    ++D E    Y L++  +D G PPLR++AL+++ V+DEND+AP     N  + V E + IG  +   +  D+D  KNG   +++    D  K + ++N    +L T  K++ R++D         +LTV  K    + +     + ++  + +AP  +   IQ    +N+     +G ++  D+D+  Q   LR  LV     + SP    +     +L   +      W      +  ++F +  +D            VT I  D  DHA S          F+  +   F + IS+H
Sbjct: 2999 VVIENLNDNRPKIIEKLLKVSIDENLP----------TSEDARQYITRIVAEDADFDEIKFRMVDDFGGLFQIDDINGV----VTVVKPLDSEILGFFNLTVVASDGEFEDKA---TILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQNETIEYYLK-------PSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTV-VAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGK------VKENSKSGEKVLTVKAL-DVDSEHFGAVSYEL---EIVSETTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQEGEAIGHRLLKFSVSDLDGPKNGA-PFTVEIQGDGAKSF-KVNEKL-ELLTAKKLEYRKKDK-------YLLTVIAKDVKGKTTDCPLTIFIRQTSRHAPTMKPMKIQINTLQNELPEGIIGRLKASDEDEEDQNGLLRFGLVE--GSIQSPRAQVQESRSTHLFRVDPNTGDIWSDHSITQGLHTFNVTVTDSKFNTVSYVEVHVTSIDNDVIDHAVSIRIRSMSVDEFMRKHVKEFRRIISHH 3569          

HSP 9 Score: 58.5362 bits (140), Expect = 4.428e-8
Identity = 65/259 (25.10%), Postives = 107/259 (41.31%), Query Frame = 3
Query: 1599 LDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISE-----SSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFP---VILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQF--QVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFE-RDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVT 2342
            LDRE +  +EL +   D G+P L +  ++ V V DENDN+P      +     +K  G L   I A D DEG+N  LTY+I+E     S D     +   +  GD    + +         Q F    V+LT +  GQ P+ S+           ++ PE       +   +++  Q   T+G++   D D + +L  S+         P  +F+ R +   L   + ++  K       I  +DG  +   T    V+
Sbjct: 1114 LDREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTFTQAIHHYSVRSKFAGKLC-RIFAVDADEGENARLTYNITEGDARFSIDNNGNIIASEAIHGDESYALTVQATDHGTPGQQFAATRVVLTANSAGQKPRKSK-----------NSPPEISGKKSDYVIPISDADQVGLTVGKLEASDADGD-ELWWSI-----SSGDPDSVFDVRQDTGQLLLAKKVELLKRGELRLNISVTDGQAWDHSTVIIQVS 1354          

HSP 10 Score: 57.3806 bits (137), Expect = 9.287e-8
Identity = 65/243 (26.75%), Postives = 105/243 (43.21%), Query Frame = 3
Query:  633 AVKSDSIEEPRTFECRIQIE--DINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLE---ENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQ 1346
             V  DS   P   E +++I   D NDNAP+F  +K+   +KE+   G       A D DSE +    Y+LE   E +   P+     N    + ++ + Q +D EK  KY   ++A D G PP     ++ I+V D ND+ P     N     +E +     LLK    D D   N    F +     ++ D  K F++ E    +   +KL+Y + +++   V   +  G       T+ I+
Sbjct: 3186 VVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAIN---SNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQEGEAIGHRLLKFSVSDLDGPKNGAP-FTV----EIQGDGAKSFKVNEKL-ELLTAKKLEYRKKDKYLLTVIAKDVKGKTTDCPLTIFIR 3419          

HSP 11 Score: 53.1434 bits (126), Expect = 1.638e-6
Identity = 102/481 (21.21%), Postives = 197/481 (40.96%), Query Frame = 3
Query: 1206 FRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRL--SNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYE-LQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNV---SVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQ--------QALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASD-GTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGK 2603
             R+E +SGN+ + E LDYE   + R  V+V         + AT  + + + ND +P     Y   +   AF+ E+ D     +A  T  DKD+G  G V   +   N E++F+I  +          +R    LD E +     L++   D     L+ +  + + +++ N+     K +  V   ++Y++   GT V  + A       +G ++Y +  +      + E+++ +G +     + + +  ++++   ++ +   +    ++  K     +   N ++P F     +  + EN         ++L  L  +   D+D  S   V    L  +    F + +      + T  S D+EK K YSF + A D G   +     + + V + DEND  P   FP+ S     I    +  +++   +  D+DS  S+      + + D    F +D   G +    +   SDM K
Sbjct: 1413 IRVEPSSGNVIVMEPLDYEAARRIRAVVQVQQANMK---SFATFSVNINDENDNSP-----YFVGHTAFAFVDES-DTVDDVLATVTAFDKDRGENGIVTYSIVSGNEESLFKIDAKSG-------EVRLAKPLDPELQHVESILRIRAIDSAANSLKDE--MSLHIRNSNEAPETAKFDRKVYQTTLYDSTRPGTPVLVLNAL-----HHGTVSYKLEPNC----TFFEVHTLSGAVHLATWLTKLKHRKSVECTAIVESTEGQQDIAKVIAK-----IIRTNQHSPIFRRQVYRGTIRENMPTGSSVLSKSLLPL-VVSAIDEDPGSNGLVGYRMLSPKDEQMFSVDQYSGA--IRTQMSFDFEKMKEYSFYVQAFDMGQPPRRSLMPSLIVVTVIDENDEPPR--FPSNSLDISMI-LPTANGVSVGGQTAQDMDSVGSLR-----YFIKDQSVPFSVDSKTGDVLVKDSNGISDMTK 1850          

HSP 12 Score: 52.7582 bits (125), Expect = 2.537e-6
Identity = 133/618 (21.52%), Postives = 244/618 (39.48%), Query Frame = 3
Query:  699 NDNAPRFRTDKFTINIKESEPVGS------LFSLPI-ATDDDSEQYSIRDYKLEENSIFPP----IFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLL------KIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDD-NSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDE-NDHAPSFIFPNYSNFTKYISYHESAEIA--ILTVSVGDLDSKDSM 2489
            N ++P FR   +   I+E+ P GS      L  L + A D+D     +  Y++       P    +FS++Q   +G++  Q+    D EK  +Y F + A D G PP+   +   I V         + + +   ++  +   +  +L       +G +   + D+   +   + +Q V       F ++  +G++ +K+  +   D    F +EV    G     +A+ ++++  ++ E  +        N  +  + EN       + L+  T  DK      H  + N    F IH     I S+       + LDRE      L ++ +     P+ A+AL+ V +++ ND  P+           +  IGT+V      D DEG        ++ SS+   +Y +I      L  ++    E+D E    F   L   D G    + R    V ++  +   P F   ++   V   +    +   ++V  K    S+ +  + +   +  SPF +     +  LN  + L    E NY+F++ A + T  K   A A V +I++     HAP F    Y+  T      ES  I   +LT+     D  D++
Sbjct: 1664 NQHSPIFRRQVYRGTIRENMPTGSSVLSKSLLPLVVSAIDEDPGSNGLVGYRM-----LSPKDEQMFSVDQY--SGAIRTQM--SFDFEKMKEYSFYVQAFDMGQPPRRSLMPSLIVVTV-------IDENDEPPRFPSNSLDISMILPTANGVSVGGQTAQDMDSVGSLRYFIKDQSVP------FSVDSKTGDVLVKDS-NGISDMTKLFDLEVFVTDGK---QSASYVMKISTISTENSKFKF---TRNEYHTSLIENTTLPPGSIILSVATIGDK----LDHFSIVNPHEAFFIHPGTGVISSSG------IALDREKSAIIRLVVQAKSHEKNPVMARALVVVGIENINDETPIFMGTPYDITIGHSDIGTVVLEPKVIDNDEGD------VVTISSENMPEYFKIVGGKVVLGKKLPSIEEEDLE----FNFKLIAKDNG---SVHRVEEPVKIRVVDKARPVFSQ-NVYTAVISKESTKKSTVLVKVMAKSSLQSKSKGLIGYRILDKKSPFSVDFLTGEVRLNNLKML---AETNYTFEVEAREVTRPK-MIAKAQVEIIVKSGITTHAPVFEKLKYTASTP-----ESTSIGQRLLTIKATTSDENDTI 2219          
BLAST of Protocadherin vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 114.775 bits (286), Expect = 3.056e-25
Identity = 182/721 (25.24%), Postives = 307/721 (42.58%), Query Frame = 3
Query:  618 ISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKE------------SEPVGSLFSLPIATDDDSEQYSIRDYKL--EENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDR-------GNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENED-QKTKFVALATVTDKDKGLGGQVHCRLSNN--ENVFEIHNRDSSIPSNKYSIRTRVTLDRETKG---YYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENK-PI---GTLVTHITAKDIDE--GKNGELTYSISESSDL-TKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAF---DVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKY----YLNTTRSLDWE---KEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVN---DHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGN 2639
            ++L+    +  +   +TF   +++ D+ND  P+F  D FT  I E             +P+ ++ +  I TD D  Q  +  Y++  E N      F +++   TG +     +K DREK   Y   + A DR        N P    + + I + DVNDN P   +  Y  + +ES+     ++ I A D D++ N +  + ++     ++     F +  +SG I++KE LD+E  +Q+   V ++++  H   AT  V I + ++ND  P+    +  +      I+E+ D  K  F   AT  D+D+    ++  RL     + VF I     +I   K        LDR+       +   ++  D     L   A ++V V+D NDN+P+        + EN+ PI   G     + A+D D+   +N  + Y I  +  +  +    I+ +TG +     +DRE  SE  + F + +  +D+G P   SR+ F    + V D NDNAP FE    +  V E       +      D D+ ++  V    L  E    +V  ++D+K      L   + LD+E   +   +   I  SDG     H A A V V + D NDHAP              + H   E      S+G   + D   G  +   +N   D K  F IDQ+ G +  + T+   D+  + + + A D+ N
Sbjct: 1180 LTLTATDMTSRVASTKTF--VVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKA--IDTDSDGPQNEVH-YRIVGEANGEETKHFRIDE--LTGEIFPN--EKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLR--YHLIGAGGGRIP----FGVRTDSGTIFVKEPLDFEASDQYHL-VLIASDGRH--NATTNVYIHIEDVNDNAPQ----FEQQKYATTVIEEDVDIPKVLFNVHATDADQDEK-SSRIVYRLEGQGADEVFRIGKYSGTIELVK-------ALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSE--REFIIEVRANDRGVP---SREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDG----RHDAEAAVHVALVDRNDHAPHI---------HGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQD-GTLRVAHTLDREDIAVYNLIIEAYDNSN 1851          

HSP 2 Score: 97.8265 bits (242), Expect = 4.306e-20
Identity = 169/752 (22.47%), Postives = 307/752 (40.82%), Query Frame = 3
Query:  681 IQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDR--EKRAKYEFVLLAIDRGNPP--KTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLD----YERDEQHRFYVEVSNNA------GHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRL----SNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIK---LENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETL--------QSFPVILTVSDKGQPPQISRKA-FDVSVKDENDNAPEFE---NYSIQFQVTENQQALYTLGEIRVHDKDD--NSQL--RVSLVHLP-NEMSSPFVL---FERDNKYY-LNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSN-FTKYISYHESAEIA----ILTVSVGDLDSKDSMNGKCSFHLVNDHKG----LFKIDQNKGKITTSRTMSESDMGKHVITVIARDH-------GNPPKESSILITIVIDNSKPFSIGQSNENNRDPNYVNKKFSGH 2762
            I+I+D+NDN P F    +T  ++E  P+        A D D+   S   Y ++ ++     FS+  N   G ++ ++    D+  E+   Y F + A D G P    +  ++        +++   L  + Y     E      P+++I A+D D ++   + +  +++          F I+E++G + L+  +      E +      V V ++           T+ AT+LI + ++N+  PE   D    ++    ++         +     TD D    G +   L    S +   F I  +   +  + +     V  DRET+   ++ ++  D+GD PL       V V D NDN+P  +    E +VS +E   +GT V  + A D D   N E+TYS+   +   ++      H  DL     ++R     TL        Q F   +   D G P  +   A   ++V D+   AP+++   +      V EN +    +   R     D  NS +  +++    P N+  S F     FE  N++  +     LD+E+  NY+  + A+D T   + T T  V V   D ND  P F    ++    + ++ +E  E      I+TV   D DS    N +  + +V +  G     F+ID+  G+I  +       +  +++TV A D         N P + ++ + IVI++           N+  P++  +K+ G 
Sbjct:  630 IRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHN-----FSINSN---GEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDE---VTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFP-DCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPH-----VVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFE--AVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEE------HQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEV--RDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQN-EVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDV----------NDNAPSFEEQKYIGR 1343          

HSP 3 Score: 91.2781 bits (225), Expect = 4.656e-18
Identity = 129/505 (25.54%), Postives = 218/505 (43.17%), Query Frame = 3
Query:  603 KDPCDISLS-----IAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKF-TINIKESEPVGSLFSLPIATDDDSEQYSIR-DYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRA---KYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQP----LLKIGAKDEDE--NDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDT--ATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRE---TKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPE 2054
            K+P D   S     + + SD      T    I IED+NDNAP+F   K+ T  I+E   +  +     ATD D ++ S R  Y+LE       +F + +   T    ++L++ LDR+  A    + FV+ AID       G   + +NV D+NDN P   +  +    EE++  +       + + A+D D+   +NA + + IV  +   ++    FRI++N+G I+    LD E   +  F +EV  N   V +    A V I+V ++ND  P     +  +      ++E        ++ +     ++        +LS   + F +     S  S+   +R +  LD E    +  + L +   D       A+A + V + D ND+AP I       V E+ P GT +   TA D D G      + I+  SD  +++      T D    +++    D E +  + +I+   D      I R+   V ++D NDN PE
Sbjct: 1394 KEPLDFEASDQYHLVLIASDGRHNATT-NVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGA-DEVFRIGKYSGT----IELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGY-IEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNK--LINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAP-----FFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRH---DAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGRYTATDRDAGDTAR--FRINRQSDPKRQF------TIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSN--NIGRQMVAVYLQDVNDNGPE 1871          

HSP 4 Score: 78.1814 bits (191), Expect = 4.243e-14
Identity = 125/553 (22.60%), Postives = 228/553 (41.23%), Query Frame = 3
Query: 1128 EDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYE---RDEQHRFYVEV--SNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSN-KYSIRTRVTLDR--ETKGYYELQMECEDKGDP-PLRAKALIKVVVKDENDNAPVIKLENNVSVY--ENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYL---EINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKG------QPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALY-----TLGEIRVHDKDD--NSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHL----------VNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPK-ESSILITI 2672
            ED      + + +  + P   D  K+FRI+ ++G I+L   LD++     + H+  V     N   HVD     + I++ ++ND  P             A ++E+       + + T  DKD G          N+   + + N + SI SN + S + R+  D+  E    Y   +   D G+P  L + A+I +  ++ ND + V    +  + +  E+   GT V  I A+D D     E+TYS  + +  + + +    I+ HTG +K R  +     +E      + + V D G           S     + ++D N+N PEF + +    + +  +  Y     T+ ++   D D   N  +  SL +  +E    FV+  +      +     D E        + A+D  G +        +V + D ND++P F  P+Y      +S  E+   +++TV   D D+  + N + ++ L           ND      +++  G+IT  + +      K +  VIA D+G P   +SS  +T+
Sbjct:  561 EDGRSKGPITYSLEGDTPE--DETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVD-----LTIRIDDVNDNVPTFTRPLY-----TAQVREDIPLNQTILKV-TAVDKDTG---------DNSRITYSVDNHNFSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADR---DEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATD-RGDRPLIGFCQFSVEVVDINDNSPQFERPSYET---SVSRFEAVGTSVITVFAFDNDA--AHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQ-KFIFNVIADDNGIPEALQSSAQVTL 1081          

HSP 5 Score: 72.0182 bits (175), Expect = 3.233e-12
Identity = 148/615 (24.07%), Postives = 241/615 (39.19%), Query Frame = 3
Query:  681 IQIEDINDNAPRF-RTDKFTINIKESEPVGSLFSLPI------ATDDDSEQ-----YSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKI----VNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPE----------IAIDYVNENNKNAF----IKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAP---------VIKLENNVSVYENKPIGTLVTHITAKDID-EGKNGELTYSI-SESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDK-------GQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSF 2381
            I IED+N+N P F    K++   K  E  G+  + P       ATDDDS       YS+   + E    F        +R TG L        DRE R + +  + A DRG+ P  G    ++ V+D+NDN P   + +Y       +     ++ + A D D   NA++ + +       +  + D + +  +   SG I L + +  +  +     +   N       ++A V + V++   + P+          I +D   E NK       +   + + +  +   T +    G G +   +     N FE  N           +     LD E    Y L +   D        K  + V V+D ND  P          I  E   + +  K  G  +  + A D D +G   E+ Y I  E++    K+  I+  TG++    K DRE+    +  + + +  SD+          P        + + D NDNAP FE      +V E++   + +  I+ HD D +S LR  L+        PF +  R +   +     LD+E    Y   ++ASDG     H AT  V + IED ND+AP F
Sbjct:  853 IGIEDVNNNKPEFPDCAKYSDIAKIME--GTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFV------IDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTAS---GGPGNKAESKF-RQFNKFENGNE-------WVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFV-VEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREK----IDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIG-AGGGRIPFGV--RTDSGTIFVKEPLDFEASDQYHLVLIASDG----RHNATTNVYIHIEDVNDNAPQF 1436          
BLAST of Protocadherin vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 206.453 bits (524), Expect = 3.121e-53
Identity = 196/668 (29.34%), Postives = 311/668 (46.56%), Query Frame = 3
Query:  663 RTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGS---LNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKD-KGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLE-NNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFE-RDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLV-NDHKGLFKIDQNKGKITTSR--TMSESDMGKHVITVIARDHGN 2639
            R     + ++D NDNAP F      I   E+ P     +L  A D D E Y+ + Y +   ++    F L  +R       L+LQ+   LDRE    Y  ++ A+D G PP  G + +NI + DVNDN P  +Q+ Y     E+      +L++ A D D ++N  + + I   Q    D  + FRI+  +G IY+ + LD+E  E H   V   ++       TA V I+V ++ND  P I + ++++ + +  I E+  Q  +FVA  +V D D K     V+  L+  +  F +  RD+SI    Y +   + LDRE    Y L +   DKG PPL A   I + + D NDN P  + +  + +V E    GT V  + A D DEG N  LTYS++E+ +   ++ +I+  TG + TR  ID E  +E +    V+    D G PP  S     V++ D NDN P F+       V EN+     +  ++V   D +  +   + +   E       FE R     +     LD+E+  +Y F +LA+D  G  +   TA + + + D ND+ P F    Y    +      S   +   V+V   D      G+ S+ +V  +  G+F+ID++ G+I   R   +S      H++ + A D GN
Sbjct:  156 RNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVND-AFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQS---DKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSD-DASPKISESA-QPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSI----YLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCE--TEPVPQLTVV--ARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCI--LKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLST---TAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGN 804          

HSP 2 Score: 197.593 bits (501), Expect = 1.625e-50
Identity = 193/697 (27.69%), Postives = 321/697 (46.05%), Query Frame = 3
Query:  648 SIEEPRTF---ECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKV-------DANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIK--LENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYL-EINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEI----RVHDKDDNS------QLRVSLVHLPNEMSSPFVLFERD-NKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATA-TVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVN----------DHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDH 2633
            ++ EP  +   +  I++ED+NDNAP F      I++ ES  +G+      A D DS       Y L + S    +F+++      S +L L Q LD E   ++  ++ A D G P  +  L I ++V DVNDNPP   +  Y++   ES+     ++++ A D D  +NA++ ++IV+     V       D +++F I  NSG IYL+  LD E  ++++  V  ++N      A   V+++V++ ND  P+       + +K  F  E   ++   V + T +D D G    +   L    + F++H     I        TR  LDRE +  Y+L +E  D+G P   A+  +++ V D NDNAP I    E+ VSV E +P GT V  + A D D G+N  +TYSI +  D     L  I+  +G ++TR+ +D E+ S     + + +  SD G PP+ + +   V V D NDN P F + S+ F+V E+    + +G I    R  D   NS       LRV+    P         F+ D +   L   R LD E +  +  +I A D T   +  ++A TV + + D ND+A     P +      +   E+  +  +  +    D+    NG   + L+               LF++D   G ++    +    + ++++ V A D 
Sbjct:  905 TLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKES-GKGLFAIDAR----SGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKF------QKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEI-------STREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERS----IYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNA-----PEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQ 1574          

HSP 3 Score: 183.726 bits (465), Expect = 2.984e-46
Identity = 192/710 (27.04%), Postives = 314/710 (44.23%), Query Frame = 3
Query:  681 IQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSE-----QYSIRDYKLE--ENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQ-----VHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNV-SVYENKPIGTLVTHITA--KDIDEGKNG--------ELTYSISE-SSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDD--NSQLRVSLV----HLPNEMSSPFVLFERDN-KYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIE--DENDHAPSFIFPNYSNF-TKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDH-KGLFKIDQNKGKITTSRTMSES-----DMGKHVITVIARDHGNP-PKESSILITIVIDNS 2687
            + ++D+NDN P F  D++++N+ ES  + +      A+D D+       Y I D  ++   NSI     S        S  + L   LDRE R +Y+  +LA D G P    +  + + VLD NDN P   ++ Y  + EE+      +  + A D D  +NA + + ++   P+    N  F++   +G I  +E LD E  E +   VE  +    V +A   V I V ++ND  PEIA    +       ++E +   T+ V +  V D+D G         V  R S+   +F       SI      IRTRV LD E +  Y L +   D G+PP     +++V V D NDN P     + V  V E+  +G +V  I+   +  D  +N          +TY+++  + DL +   +I+ H+G+L     +DRE  SE       + T +     PQ S     + V D NDNAPE+    I  QV+E       +      D D   N  L+  L+     L         LF  D+    L+    LD+E  + Y   + A D +   +     +VTV +   D NDHAP F+ PN S   T  +   ++  I  +   +  +D     NG+ ++ +   + +G F+I+   G I   +++  +       G+  + + A+DHG P PK+SS+ + +++  S
Sbjct: 1024 VDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLL---PI----NSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIA----DPQEDVVSVREEQPPGTEVVRVRAV-DRDHGQNASITYSIVKGRDSDGHGLF-------SIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNN--PQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGS 1712          

HSP 4 Score: 157.532 bits (397), Expect = 3.133e-38
Identity = 178/708 (25.14%), Postives = 302/708 (42.66%), Query Frame = 3
Query:  681 IQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEEN-SIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRL--SNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI-KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVN-------------DHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNSKPFSIGQSNENNRDPNYVNKKF 2753
            ++I D+NDN P F  D +  N+ E    G+     +A D D    S   Y L E        F ++    TG +  +    +D E     +  ++A D G PP +    + + + DVNDN P   Q+ YN+   E++   + +LK+ A D D   NA MV   + E    +     F +   SG I +  +LD+ER   + F V  ++  G   + TA + +Q+ ++ND  P         + + +    ++   T  VA+   TD D G  GQV  R+   N   +F I      I    + +R  + L   T+  + L +   D G+    A A++ + + D     P+  K   N  V E+ P GT+V  + A   D      + YSI         Y  I +++G+++    +D E  S+ L +    L     G+PP       ++ V+D NDNAPEFE   ++  V E+ +    L     HDKD  S  +V+   +       F +  R     L  ++ LD+E  + ++  + A+DG G  S +   T+ V ++D ND+ P F    YS     +S   S    I+ V+  DLD+ +  N + ++ +V+             D    F I  N G I     +      ++ +TV+A D+G P   +   + + + ++          N+ DP +   K+
Sbjct:  492 LRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQ--TGLITTR--SHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNA-MVNYTIGEGFKHL---TEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGL--STTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAV-VATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEI----FVVRPDM-LSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGD--PDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATL-----GEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLIL--SQHLDYESSQRHTLIVTATDG-GVPSLSTNLTILVDVQDVNDNPPVFEKDEYS---VNVSESRSINAQIIQVNASDLDTGN--NARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDA----------NDNDPKFQKSKY 1158          

HSP 5 Score: 148.288 bits (373), Expect = 2.285e-35
Identity = 210/771 (27.24%), Postives = 344/771 (44.62%), Query Frame = 3
Query:  543 SAQTIDREELCINVESCCHKKDPCDISLSI-AVKSDSIEEPRT--FECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSE-----QYSIRDYKLEENSIFPPIFSL-EQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXX----XXXXXXHLSQTNYNIQYEESKFSMQPLLKIG-------AKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKL-----DYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDK------GDPPLRAK-----------------ALIKVVVKDENDNAPVIKLEN--NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSE-TLQSFPVILTVSDKGQPPQISRKA---FDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRS-LDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGL---FKIDQNKGKITTSRTMSESDMGKHV-ITVIARDHGNPPKESSILITIVI 2678
            +A  IDR    + V     ++   +  L I A+ + +   P++     +I++ D+NDNAP +  D   + + E+ PVG++     ATD D+      QY +  Y  + N       SL   +  TG+L+LQ    LD E   +Y  ++ A+D+ +   T RL  ++ V       ND+ PH    N +     S F +    +IG       A DED  DN ++ ++I        +    FRI   +G I L + L     D E+  +    +   ++       ++  L  ++  +   P   +  V      A I EN    + FV   T     K L G  +  LS  E    + N    +   +  I TR   DRE++  Y L +   D           +R +                 A I + V D NDN+P  +  +   +SV EN   G + T + A D+DEG N +L YSI+   +L  K+  I+S +G+L  R  +DREQ S  TLQ     +  SD+GQP   SR+      + V+D+NDNAP F+       V E+     ++ +I   D D     R+ +  L NE    F +   D +  L TT   LD E + +Y+F +LA+DG  Y+  +AT  V + + D ND+ P  IF  Y    +  +  +  +  +    V  LD+    N +  + L  ++  +   F+I+ + G ++ S++++ S+ GK + + V+ARD GNPP+ S  LI ++I
Sbjct: 1424 AAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQ--APLDFEAVQEYLLIVQALDQSSN-VTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLF-ISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGG-----NGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAV----YRATILENVPSGS-FVLQVTA----KSLHGAENANLSY-EIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHT-VVASDLDEGPNADLIYSIT-GGNLGNKF-SIDSSSGELSAR-PLDREQHSRYTLQ-----IQASDRGQPK--SRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARL-VYSLANETQWQFAI---DGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRP--IFERYPYIGQVPALIQPGQTLL---KVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLA-SESGKLLHLEVVARDKGNPPQSSLGLIELLI 2154          

HSP 6 Score: 147.517 bits (371), Expect = 3.703e-35
Identity = 175/724 (24.17%), Postives = 313/724 (43.23%), Query Frame = 3
Query:  624 LSIAVKSDSIEEPR--TFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSL--PIATDDDSEQYSIRDY--KLEENSIFPPI------FSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAID--RGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQP----VKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVD---TATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLS--NNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDP-PLRAKALIKVVVKDENDNAP-VIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKA------------------FDVS-----VKDENDNAPEFENYSI-QFQVTENQQ--ALYTLGEIRVHDKDDNSQLRVSLV--HLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHG 2636
            L +A  SD    PR      R+++ D+NDN P F +      ++E   +G +     PI    D  + S+ +    L       P+       + + +R +G  NL + + LDRE ++++   + A+D    N P++  + + I V DVNDN P   Q   ++Q  E+      +    A D D   N  + ++++   P     +  A   FR++  +G + L+  LD+E  +++   V+  + + +V      + TV +++++ ND  P       +     +    +  +  + VA     D+D G  GQ+   ++  N E  F I+++   I   K       T D E  G + L +  +D G P P ++   + ++V+  ++N P  ++     ++ EN P G+ V  +TAK +   +N  L+Y I   + +      ++   G + TR + DRE  +    S+ + + V D  +   +S  A                  FDV+     V D NDN+PEF   S     V EN +   ++T+    + D+  N+ L  S+   +L N+       F  D+     + R LD E+   Y+ +I ASD    KS      +T+ +ED+ND+AP F    Y+      S  E A +    V +  +D+   +N +  + L N+ +  F ID   G ITT   +       +   V+A D G
Sbjct: 1333 LGVAA-SDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSG--NLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKS--LPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIP--AGVANDLFHVDWQRGIITTRGQFDRESQA----SYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDL-DEGPNADLIYSITGGNLGNK-------FSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTG-----SVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGG 2032          

HSP 7 Score: 129.798 bits (325), Expect = 9.254e-30
Identity = 199/839 (23.72%), Postives = 348/839 (41.48%), Query Frame = 3
Query:  501 ANRLFHL-HSNGKLYSAQTIDREE-----LCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFE------CRIQIEDINDNAPRFRTDK-FTINIKESEPVGSLFSLPIATDDDSEQ-----YSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNP-PKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGH-VDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRV-------TLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN---NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLK--------------------TRMKI------------------DREQDSETLQSFP----------VILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIA--ILTVSVGDLDSKDSMNGKCSFHLVND--HKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNSKPFSIGQSNENNRDPNYVNKKFSGHFIM 2771
            AN LFH+    G + +    DRE      L + V     +      ++     SDSI +    +        I + D+NDN+P FR    + +++ E+   G + ++ +A+D D        YSI    L         FS++ +  +G L+    + LDRE+ ++Y   + A DRG P  + G   I I V D NDN P    + Y    +E       +++I A D D   NA++V+ + NE   +      F I+  SG I    KLD E    + F V  ++   + V +AT  V I V+++ND  P I   Y       A I+  +        L  V   D  LG       +N E V+ ++  +S++ S K+ I           +L  E+     L++   DKG+PP  +  LI++++ +     PV++ +N    V + EN P GT +  + A   D G+  ++ +S    ++     L ++S +G+++                    +R +                    R Q + T  SF           V+L       P   S     + ++DENDN+P+F        V+E       + ++   D D  S  R+    +     + FV+ E      + T   LD E    Y  KI+A+D  G    T TAT+ V I D ND+ P+F  PN       ++  E+ E+   I ++S  D+D+  ++  +       D  +  +F +D+  GK+   R +      ++ + VIA D  +   E+  ++T+ ++          +EN+  P ++ ++   +F +
Sbjct: 1763 ANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTV-VASDLDEGPNADLIYSITGGNLGNK------FSIDSS--SGELS---ARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQ------FAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRP-IFERYPYIGQVPALIQPGQ-------TLLKVQALDADLG-------ANAEIVYSLNAENSAV-SAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSD-GRRQKVQFSFGAGNE--DGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVI-EPAFSGIVRTNIVLDREIRDIYKLKIIATD-EGVPQMTGTATIRVQIVDVNDNQPTFP-PN-----NLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAH---EARTVLTVRVN----------DENDNAPVFLAQQPPAYFAI 2543          

HSP 8 Score: 128.642 bits (322), Expect = 2.488e-29
Identity = 194/782 (24.81%), Postives = 324/782 (41.43%), Query Frame = 3
Query:  513 FHLHSNGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQI--EDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGN-PPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNK--------YSIRTRVTLDRETKGYY-------------------------------------ELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVS-VYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDRE-QDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVH---LPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIF---PNYSNFTKYISYHE---SAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSE---SDMGKHVITVIARDHGNPPKESSILITI 2672
            F + S+    SA+ +DRE+         H +     +L I        + R   C I I  ED NDNAPRF+  K+T +++E  P+G+      A D D    +   Y L   + +   F+++      S  +  + KLDRE +A Y F++LA D G    ++  + + INVLD+NDN P   +  Y  Q        Q LLK+ A D D   NA++V+ + N +   V A   FRI  ++G +   + L  E  +     V   +      ++   + + +      TP   + + NE  +   +KEN    T+ + +  +    +    Q      N + +  + +    I  NK        +S  +   L R    +Y                                      + +       P L + A + + ++DENDN+P    +  V+ V E    GT V  + A D D G N  L Y I + +      +E  + +G ++T + +DRE +D   L+     +  +D+G P         V + D NDN P F   ++   V+E  +    +  I  +D D    L   L     +  E  S F L     K  L   R LD+E ++ Y   ++ASD     +H A   +TV + DEND+AP F+    P Y      IS      S +  +LTV+  D DS+ + N K  + +    +G F +  + G ++ + +  +   S  G + + +IA+D G P  +SS L+ +
Sbjct: 1895 FSIDSSSGELSARPLDREQ---------HSR----YTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQ--FAIDGQ----SGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSL-NAENSAVSAK--FRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTP--VLRFQNETYR-VMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIE-PAFSGIVRTNIVLDREIRDIYKLK-----IIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLK--RRLDYELQQEYELDVIASDA----AHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGN-NSKVIYIIEPAQEG-FSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRV 2636          

HSP 9 Score: 90.5077 bits (223), Expect = 8.874e-18
Identity = 156/717 (21.76%), Postives = 301/717 (41.98%), Query Frame = 3
Query:  672 ECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSE-----QYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAF-----IKENEDQKTKFVALATV--TDKD-KGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDN-APVIKLENNVSVYENKPIGTLVTHITAKDIDE-----GKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFD------VSVKDENDNAPEFENYS-IQFQVTENQQALYTLGEIRVHDKDD----NSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEK-EKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKG----------LFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNSKPFS 2699
            E  I++ED NDN+P+F   +F   + E    G+  +   A D D+      +Y I D   +   +  P FS       G +   ++  LDRE R  Y+  ++A D G P  TG   I + ++DVNDN P     N     E ++     +  I A D D      + +++  E  V ++    F ++  SG + LK +LDYE  +++   V ++++A H   A   + ++V + ND  P     ++ +     F     I E  +  +    L TV  TD D +G   +V   +   +  F +H  +  +  N   ++  V+    + G Y +++  +D G P L++  L++V   D     +  ++ +    + E  P+G++V  +    +D+       N E  + + +S  +                   +DRE++      + + L +S    PP IS           +++ D NDN P F+  +  + +++E     Y++ +++  D D     NS++   +    +E    F +       ++N    LD++   K+Y   I A D    +   +     + + DEND+ P F    Y +F   ++ +E    ++      DLD       K  F  +N   G          +F++D   G +T++         ++ + ++A D G   K++S+ + + I++   F+
Sbjct: 2307 ELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFS-------GIVRTNIV--LDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAV-ITSISANDVDT--YPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDV-IASDAAH--EARTVLTVRVNDENDNAPV----FLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVS----SSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQSKAIV--------------LVKPLDRERN----DLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHM--FTIDLVTGVLFVNN--RLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHF---LAENEPVGSSVFRAHASDLD-------KGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGG--KKASVAVRVEIESRDEFT 2966          

HSP 10 Score: 88.9669 bits (219), Expect = 2.963e-17
Identity = 102/396 (25.76%), Postives = 173/396 (43.69%), Query Frame = 3
Query: 1551 DSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKAL-IKVVVKDENDNAPVI-KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHT---GDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVH--DKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSF--IFPNYSNFTKYISYHESAEIAILTVSVGDLDSK-DSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESS----ILITIVIDNSKPF 2696
            D +I      IRT+V LDRET+  Y L          PL  + + + V VKDENDNAP   +   ++   EN P     T + A+D+D        Y+I   +        ++SH    G L   ++I    D ET   + +++   D G PP       +++++D NDN P F        V EN     ++ ++     D D+N  +  ++    ++    F +  R    Y+N  ++LD+E ++ +   ++A D  G +    TA V++ + D ND+ P+   IF +     K     +  E  +  +SV D DSK +  N   + +  + H  L   D +   +     +    +  + ++V+A D G PP  +S    + IT V DN   F
Sbjct:  122 DLAIDRATGEIRTKVKLDRETRASYSLVAI-------PLSGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGN--VNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYIN--KALDFETKELHELVVVAKD-HGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEF-VARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEF 504          

HSP 11 Score: 73.9442 bits (180), Expect = 1.125e-12
Identity = 142/603 (23.55%), Postives = 249/603 (41.29%), Query Frame = 3
Query:  636 VKSDSIEEPRTFECRIQIEDINDNAPRFRTDK----FTINIKESEPVGSL---FSLPI--ATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAG------HVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATV-TDKDKGLGGQVHCRLS--NNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVS-VYENKPIGTLVTHITAKDIDEGKNGELTYSI--SESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQAL---YTLGEIRVHDKDDNS------QLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIE 2354
            + SD+  E RT    +++ D NDNAP F   +    F I    SE   SL   F L    ATD DSE  + +   + E +     FS+  +    S+N+  +Q         Y   ++A D G P      ++ +   D         Q  Y  Q  E+      +L++G   +D  D +  +     E   ++  +K          I L + LD ER++ ++  + +S+  G         ++  +V+I +++ ND  P     +       A I E    +     L  +  D++     +V   ++  N+E++F I      + +    +  R+  D   K Y  +   C+     PL +    ++ + DENDN P   L   V  + EN+P+G+ V    A D+D+G  G+L YSI  + S + + K   ++S +G + +    D EQ     Q + + L  SD G   + +  A  V ++  ++  P+F   + +F V     AL   Y +G++   D D         QL     H     SS  VL +R  K   +   +L +   ++ S  I AS G  + S ++ A V + ++
Sbjct: 2506 IASDAAHEARTV-LTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPA--QEGFSVHPSNGVVSVNMSRLQPA-VSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLG---QDALDQSLAIIAGNEESAFELLQSKA---------IVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPI----FDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTI-----DLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQR----QRYDMELLASDMGG--KKASVAVRVEIESRDEFTPQFTERTYRF-VLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSHFKVNRSSGAVLIKRKLKLDGDGDGNL-YMDGRDISLVISASSGR-HNSLSSMAVVEIALD 3074          
BLAST of Protocadherin vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 206.453 bits (524), Expect = 3.121e-53
Identity = 196/668 (29.34%), Postives = 311/668 (46.56%), Query Frame = 3
Query:  663 RTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGS---LNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKD-KGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLE-NNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFE-RDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLV-NDHKGLFKIDQNKGKITTSR--TMSESDMGKHVITVIARDHGN 2639
            R     + ++D NDNAP F      I   E+ P     +L  A D D E Y+ + Y +   ++    F L  +R       L+LQ+   LDRE    Y  ++ A+D G PP  G + +NI + DVNDN P  +Q+ Y     E+      +L++ A D D ++N  + + I   Q    D  + FRI+  +G IY+ + LD+E  E H   V   ++       TA V I+V ++ND  P I + ++++ + +  I E+  Q  +FVA  +V D D K     V+  L+  +  F +  RD+SI    Y +   + LDRE    Y L +   DKG PPL A   I + + D NDN P  + +  + +V E    GT V  + A D DEG N  LTYS++E+ +   ++ +I+  TG + TR  ID E  +E +    V+    D G PP  S     V++ D NDN P F+       V EN+     +  ++V   D +  +   + +   E       FE R     +     LD+E+  +Y F +LA+D  G  +   TA + + + D ND+ P F    Y    +      S   +   V+V   D      G+ S+ +V  +  G+F+ID++ G+I   R   +S      H++ + A D GN
Sbjct:  156 RNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVND-AFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQS---DKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSD-DASPKISESA-QPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSI----YLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCE--TEPVPQLTVV--ARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCI--LKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLST---TAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGN 804          

HSP 2 Score: 197.593 bits (501), Expect = 1.625e-50
Identity = 193/697 (27.69%), Postives = 321/697 (46.05%), Query Frame = 3
Query:  648 SIEEPRTF---ECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKV-------DANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIK--LENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYL-EINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEI----RVHDKDDNS------QLRVSLVHLPNEMSSPFVLFERD-NKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATA-TVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVN----------DHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDH 2633
            ++ EP  +   +  I++ED+NDNAP F      I++ ES  +G+      A D DS       Y L + S    +F+++      S +L L Q LD E   ++  ++ A D G P  +  L I ++V DVNDNPP   +  Y++   ES+     ++++ A D D  +NA++ ++IV+     V       D +++F I  NSG IYL+  LD E  ++++  V  ++N      A   V+++V++ ND  P+       + +K  F  E   ++   V + T +D D G    +   L    + F++H     I        TR  LDRE +  Y+L +E  D+G P   A+  +++ V D NDNAP I    E+ VSV E +P GT V  + A D D G+N  +TYSI +  D     L  I+  +G ++TR+ +D E+ S     + + +  SD G PP+ + +   V V D NDN P F + S+ F+V E+    + +G I    R  D   NS       LRV+    P         F+ D +   L   R LD E +  +  +I A D T   +  ++A TV + + D ND+A     P +      +   E+  +  +  +    D+    NG   + L+               LF++D   G ++    +    + ++++ V A D 
Sbjct:  905 TLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKES-GKGLFAIDAR----SGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKF------QKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEI-------STREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERS----IYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNA-----PEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQ 1574          

HSP 3 Score: 183.726 bits (465), Expect = 2.984e-46
Identity = 192/710 (27.04%), Postives = 314/710 (44.23%), Query Frame = 3
Query:  681 IQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSE-----QYSIRDYKLE--ENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQ-----VHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNV-SVYENKPIGTLVTHITA--KDIDEGKNG--------ELTYSISE-SSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDD--NSQLRVSLV----HLPNEMSSPFVLFERDN-KYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIE--DENDHAPSFIFPNYSNF-TKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDH-KGLFKIDQNKGKITTSRTMSES-----DMGKHVITVIARDHGNP-PKESSILITIVIDNS 2687
            + ++D+NDN P F  D++++N+ ES  + +      A+D D+       Y I D  ++   NSI     S        S  + L   LDRE R +Y+  +LA D G P    +  + + VLD NDN P   ++ Y  + EE+      +  + A D D  +NA + + ++   P+    N  F++   +G I  +E LD E  E +   VE  +    V +A   V I V ++ND  PEIA    +       ++E +   T+ V +  V D+D G         V  R S+   +F       SI      IRTRV LD E +  Y L +   D G+PP     +++V V D NDN P     + V  V E+  +G +V  I+   +  D  +N          +TY+++  + DL +   +I+ H+G+L     +DRE  SE       + T +     PQ S     + V D NDNAPE+    I  QV+E       +      D D   N  L+  L+     L         LF  D+    L+    LD+E  + Y   + A D +   +     +VTV +   D NDHAP F+ PN S   T  +   ++  I  +   +  +D     NG+ ++ +   + +G F+I+   G I   +++  +       G+  + + A+DHG P PK+SS+ + +++  S
Sbjct: 1024 VDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLL---PI----NSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIA----DPQEDVVSVREEQPPGTEVVRVRAV-DRDHGQNASITYSIVKGRDSDGHGLF-------SIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNN--PQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGS 1712          

HSP 4 Score: 157.532 bits (397), Expect = 3.133e-38
Identity = 178/708 (25.14%), Postives = 302/708 (42.66%), Query Frame = 3
Query:  681 IQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEEN-SIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRL--SNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI-KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVN-------------DHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNSKPFSIGQSNENNRDPNYVNKKF 2753
            ++I D+NDN P F  D +  N+ E    G+     +A D D    S   Y L E        F ++    TG +  +    +D E     +  ++A D G PP +    + + + DVNDN P   Q+ YN+   E++   + +LK+ A D D   NA MV   + E    +     F +   SG I +  +LD+ER   + F V  ++  G   + TA + +Q+ ++ND  P         + + +    ++   T  VA+   TD D G  GQV  R+   N   +F I      I    + +R  + L   T+  + L +   D G+    A A++ + + D     P+  K   N  V E+ P GT+V  + A   D      + YSI         Y  I +++G+++    +D E  S+ L +    L     G+PP       ++ V+D NDNAPEFE   ++  V E+ +    L     HDKD  S  +V+   +       F +  R     L  ++ LD+E  + ++  + A+DG G  S +   T+ V ++D ND+ P F    YS     +S   S    I+ V+  DLD+ +  N + ++ +V+             D    F I  N G I     +      ++ +TV+A D+G P   +   + + + ++          N+ DP +   K+
Sbjct:  492 LRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQ--TGLITTR--SHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNA-MVNYTIGEGFKHL---TEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGL--STTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAV-VATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEI----FVVRPDM-LSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGD--PDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATL-----GEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLIL--SQHLDYESSQRHTLIVTATDG-GVPSLSTNLTILVDVQDVNDNPPVFEKDEYS---VNVSESRSINAQIIQVNASDLDTGN--NARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDA----------NDNDPKFQKSKY 1158          

HSP 5 Score: 148.288 bits (373), Expect = 2.285e-35
Identity = 210/771 (27.24%), Postives = 344/771 (44.62%), Query Frame = 3
Query:  543 SAQTIDREELCINVESCCHKKDPCDISLSI-AVKSDSIEEPRT--FECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSE-----QYSIRDYKLEENSIFPPIFSL-EQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXX----XXXXXXHLSQTNYNIQYEESKFSMQPLLKIG-------AKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKL-----DYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDK------GDPPLRAK-----------------ALIKVVVKDENDNAPVIKLEN--NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSE-TLQSFPVILTVSDKGQPPQISRKA---FDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRS-LDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGL---FKIDQNKGKITTSRTMSESDMGKHV-ITVIARDHGNPPKESSILITIVI 2678
            +A  IDR    + V     ++   +  L I A+ + +   P++     +I++ D+NDNAP +  D   + + E+ PVG++     ATD D+      QY +  Y  + N       SL   +  TG+L+LQ    LD E   +Y  ++ A+D+ +   T RL  ++ V       ND+ PH    N +     S F +    +IG       A DED  DN ++ ++I        +    FRI   +G I L + L     D E+  +    +   ++       ++  L  ++  +   P   +  V      A I EN    + FV   T     K L G  +  LS  E    + N    +   +  I TR   DRE++  Y L +   D           +R +                 A I + V D NDN+P  +  +   +SV EN   G + T + A D+DEG N +L YSI+   +L  K+  I+S +G+L  R  +DREQ S  TLQ     +  SD+GQP   SR+      + V+D+NDNAP F+       V E+     ++ +I   D D     R+ +  L NE    F +   D +  L TT   LD E + +Y+F +LA+DG  Y+  +AT  V + + D ND+ P  IF  Y    +  +  +  +  +    V  LD+    N +  + L  ++  +   F+I+ + G ++ S++++ S+ GK + + V+ARD GNPP+ S  LI ++I
Sbjct: 1424 AAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQ--APLDFEAVQEYLLIVQALDQSSN-VTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLF-ISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGG-----NGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAV----YRATILENVPSGS-FVLQVTA----KSLHGAENANLSY-EIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHT-VVASDLDEGPNADLIYSIT-GGNLGNKF-SIDSSSGELSAR-PLDREQHSRYTLQ-----IQASDRGQPK--SRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARL-VYSLANETQWQFAI---DGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRP--IFERYPYIGQVPALIQPGQTLL---KVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLA-SESGKLLHLEVVARDKGNPPQSSLGLIELLI 2154          

HSP 6 Score: 147.517 bits (371), Expect = 3.703e-35
Identity = 175/724 (24.17%), Postives = 313/724 (43.23%), Query Frame = 3
Query:  624 LSIAVKSDSIEEPR--TFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSL--PIATDDDSEQYSIRDY--KLEENSIFPPI------FSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAID--RGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQP----VKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVD---TATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLS--NNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDP-PLRAKALIKVVVKDENDNAP-VIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKA------------------FDVS-----VKDENDNAPEFENYSI-QFQVTENQQ--ALYTLGEIRVHDKDDNSQLRVSLV--HLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHG 2636
            L +A  SD    PR      R+++ D+NDN P F +      ++E   +G +     PI    D  + S+ +    L       P+       + + +R +G  NL + + LDRE ++++   + A+D    N P++  + + I V DVNDN P   Q   ++Q  E+      +    A D D   N  + ++++   P     +  A   FR++  +G + L+  LD+E  +++   V+  + + +V      + TV +++++ ND  P       +     +    +  +  + VA     D+D G  GQ+   ++  N E  F I+++   I   K       T D E  G + L +  +D G P P ++   + ++V+  ++N P  ++     ++ EN P G+ V  +TAK +   +N  L+Y I   + +      ++   G + TR + DRE  +    S+ + + V D  +   +S  A                  FDV+     V D NDN+PEF   S     V EN +   ++T+    + D+  N+ L  S+   +L N+       F  D+     + R LD E+   Y+ +I ASD    KS      +T+ +ED+ND+AP F    Y+      S  E A +    V +  +D+   +N +  + L N+ +  F ID   G ITT   +       +   V+A D G
Sbjct: 1333 LGVAA-SDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSG--NLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKS--LPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIP--AGVANDLFHVDWQRGIITTRGQFDRESQA----SYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDL-DEGPNADLIYSITGGNLGNK-------FSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTG-----SVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGG 2032          

HSP 7 Score: 129.798 bits (325), Expect = 9.254e-30
Identity = 199/839 (23.72%), Postives = 348/839 (41.48%), Query Frame = 3
Query:  501 ANRLFHL-HSNGKLYSAQTIDREE-----LCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFE------CRIQIEDINDNAPRFRTDK-FTINIKESEPVGSLFSLPIATDDDSEQ-----YSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNP-PKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGH-VDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRV-------TLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN---NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLK--------------------TRMKI------------------DREQDSETLQSFP----------VILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIA--ILTVSVGDLDSKDSMNGKCSFHLVND--HKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNSKPFSIGQSNENNRDPNYVNKKFSGHFIM 2771
            AN LFH+    G + +    DRE      L + V     +      ++     SDSI +    +        I + D+NDN+P FR    + +++ E+   G + ++ +A+D D        YSI    L         FS++ +  +G L+    + LDRE+ ++Y   + A DRG P  + G   I I V D NDN P    + Y    +E       +++I A D D   NA++V+ + NE   +      F I+  SG I    KLD E    + F V  ++   + V +AT  V I V+++ND  P I   Y       A I+  +        L  V   D  LG       +N E V+ ++  +S++ S K+ I           +L  E+     L++   DKG+PP  +  LI++++ +     PV++ +N    V + EN P GT +  + A   D G+  ++ +S    ++     L ++S +G+++                    +R +                    R Q + T  SF           V+L       P   S     + ++DENDN+P+F        V+E       + ++   D D  S  R+    +     + FV+ E      + T   LD E    Y  KI+A+D  G    T TAT+ V I D ND+ P+F  PN       ++  E+ E+   I ++S  D+D+  ++  +       D  +  +F +D+  GK+   R +      ++ + VIA D  +   E+  ++T+ ++          +EN+  P ++ ++   +F +
Sbjct: 1763 ANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTV-VASDLDEGPNADLIYSITGGNLGNK------FSIDSS--SGELS---ARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQ------FAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRP-IFERYPYIGQVPALIQPGQ-------TLLKVQALDADLG-------ANAEIVYSLNAENSAV-SAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSD-GRRQKVQFSFGAGNE--DGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVI-EPAFSGIVRTNIVLDREIRDIYKLKIIATD-EGVPQMTGTATIRVQIVDVNDNQPTFP-PN-----NLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAH---EARTVLTVRVN----------DENDNAPVFLAQQPPAYFAI 2543          

HSP 8 Score: 128.642 bits (322), Expect = 2.488e-29
Identity = 194/782 (24.81%), Postives = 324/782 (41.43%), Query Frame = 3
Query:  513 FHLHSNGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQI--EDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGN-PPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNK--------YSIRTRVTLDRETKGYY-------------------------------------ELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVS-VYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDRE-QDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVH---LPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIF---PNYSNFTKYISYHE---SAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSE---SDMGKHVITVIARDHGNPPKESSILITI 2672
            F + S+    SA+ +DRE+         H +     +L I        + R   C I I  ED NDNAPRF+  K+T +++E  P+G+      A D D    +   Y L   + +   F+++      S  +  + KLDRE +A Y F++LA D G    ++  + + INVLD+NDN P   +  Y  Q        Q LLK+ A D D   NA++V+ + N +   V A   FRI  ++G +   + L  E  +     V   +      ++   + + +      TP   + + NE  +   +KEN    T+ + +  +    +    Q      N + +  + +    I  NK        +S  +   L R    +Y                                      + +       P L + A + + ++DENDN+P    +  V+ V E    GT V  + A D D G N  L Y I + +      +E  + +G ++T + +DRE +D   L+     +  +D+G P         V + D NDN P F   ++   V+E  +    +  I  +D D    L   L     +  E  S F L     K  L   R LD+E ++ Y   ++ASD     +H A   +TV + DEND+AP F+    P Y      IS      S +  +LTV+  D DS+ + N K  + +    +G F +  + G ++ + +  +   S  G + + +IA+D G P  +SS L+ +
Sbjct: 1895 FSIDSSSGELSARPLDREQ---------HSR----YTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQ--FAIDGQ----SGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSL-NAENSAVSAK--FRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTP--VLRFQNETYR-VMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIE-PAFSGIVRTNIVLDREIRDIYKLK-----IIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLK--RRLDYELQQEYELDVIASDA----AHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGN-NSKVIYIIEPAQEG-FSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRV 2636          

HSP 9 Score: 90.5077 bits (223), Expect = 8.874e-18
Identity = 156/717 (21.76%), Postives = 301/717 (41.98%), Query Frame = 3
Query:  672 ECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSE-----QYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAF-----IKENEDQKTKFVALATV--TDKD-KGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDN-APVIKLENNVSVYENKPIGTLVTHITAKDIDE-----GKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFD------VSVKDENDNAPEFENYS-IQFQVTENQQALYTLGEIRVHDKDD----NSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEK-EKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKG----------LFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNSKPFS 2699
            E  I++ED NDN+P+F   +F   + E    G+  +   A D D+      +Y I D   +   +  P FS       G +   ++  LDRE R  Y+  ++A D G P  TG   I + ++DVNDN P     N     E ++     +  I A D D      + +++  E  V ++    F ++  SG + LK +LDYE  +++   V ++++A H   A   + ++V + ND  P     ++ +     F     I E  +  +    L TV  TD D +G   +V   +   +  F +H  +  +  N   ++  V+    + G Y +++  +D G P L++  L++V   D     +  ++ +    + E  P+G++V  +    +D+       N E  + + +S  +                   +DRE++      + + L +S    PP IS           +++ D NDN P F+  +  + +++E     Y++ +++  D D     NS++   +    +E    F +       ++N    LD++   K+Y   I A D    +   +     + + DEND+ P F    Y +F   ++ +E    ++      DLD       K  F  +N   G          +F++D   G +T++         ++ + ++A D G   K++S+ + + I++   F+
Sbjct: 2307 ELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFS-------GIVRTNIV--LDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAV-ITSISANDVDT--YPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDV-IASDAAH--EARTVLTVRVNDENDNAPV----FLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVS----SSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQSKAIV--------------LVKPLDRERN----DLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHM--FTIDLVTGVLFVNN--RLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHF---LAENEPVGSSVFRAHASDLD-------KGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGG--KKASVAVRVEIESRDEFT 2966          

HSP 10 Score: 88.9669 bits (219), Expect = 2.963e-17
Identity = 102/396 (25.76%), Postives = 173/396 (43.69%), Query Frame = 3
Query: 1551 DSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKAL-IKVVVKDENDNAPVI-KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHT---GDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVH--DKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSF--IFPNYSNFTKYISYHESAEIAILTVSVGDLDSK-DSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESS----ILITIVIDNSKPF 2696
            D +I      IRT+V LDRET+  Y L          PL  + + + V VKDENDNAP   +   ++   EN P     T + A+D+D        Y+I   +        ++SH    G L   ++I    D ET   + +++   D G PP       +++++D NDN P F        V EN     ++ ++     D D+N  +  ++    ++    F +  R    Y+N  ++LD+E ++ +   ++A D  G +    TA V++ + D ND+ P+   IF +     K     +  E  +  +SV D DSK +  N   + +  + H  L   D +   +     +    +  + ++V+A D G PP  +S    + IT V DN   F
Sbjct:  122 DLAIDRATGEIRTKVKLDRETRASYSLVAI-------PLSGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGN--VNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYIN--KALDFETKELHELVVVAKD-HGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEF-VARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEF 504          

HSP 11 Score: 73.9442 bits (180), Expect = 1.125e-12
Identity = 142/603 (23.55%), Postives = 249/603 (41.29%), Query Frame = 3
Query:  636 VKSDSIEEPRTFECRIQIEDINDNAPRFRTDK----FTINIKESEPVGSL---FSLPI--ATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAG------HVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATV-TDKDKGLGGQVHCRLS--NNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVS-VYENKPIGTLVTHITAKDIDEGKNGELTYSI--SESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQAL---YTLGEIRVHDKDDNS------QLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIE 2354
            + SD+  E RT    +++ D NDNAP F   +    F I    SE   SL   F L    ATD DSE  + +   + E +     FS+  +    S+N+  +Q         Y   ++A D G P      ++ +   D         Q  Y  Q  E+      +L++G   +D  D +  +     E   ++  +K          I L + LD ER++ ++  + +S+  G         ++  +V+I +++ ND  P     +       A I E    +     L  +  D++     +V   ++  N+E++F I      + +    +  R+  D   K Y  +   C+     PL +    ++ + DENDN P   L   V  + EN+P+G+ V    A D+D+G  G+L YSI  + S + + K   ++S +G + +    D EQ     Q + + L  SD G   + +  A  V ++  ++  P+F   + +F V     AL   Y +G++   D D         QL     H     SS  VL +R  K   +   +L +   ++ S  I AS G  + S ++ A V + ++
Sbjct: 2506 IASDAAHEARTV-LTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPA--QEGFSVHPSNGVVSVNMSRLQPA-VSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLG---QDALDQSLAIIAGNEESAFELLQSKA---------IVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPI----FDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTI-----DLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQR----QRYDMELLASDMGG--KKASVAVRVEIESRDEFTPQFTERTYRF-VLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSHFKVNRSSGAVLIKRKLKLDGDGDGNL-YMDGRDISLVISASSGR-HNSLSSMAVVEIALD 3074          
BLAST of Protocadherin vs. Ensembl Fly
Match: ft (gene:FBgn0001075 transcript:FBtr0077478)

HSP 1 Score: 198.364 bits (503), Expect = 1.175e-50
Identity = 185/692 (26.73%), Postives = 305/692 (44.08%), Query Frame = 3
Query:  669 FECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRD-YKLEENSI---FPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHR---------FYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI-KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDRE-QDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPN-EMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNY----SNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGK--HVITVIARDHGNPPKESSILITIVI 2678
             E RI++ D+NDN+P F      I+  ES   G+   L  ATD D  +  + D Y++   ++   F  + +   +  T  L+L+    LDRE R  Y+  + A D G+PP+ G L +N+ +LDVNDNPP    ++YN+   E+     P++ + A D D  DN+K+ + +        +    F +   +G I   E+++  +    +         F V   ++          V + +++ ND  P I+  +  +  K A + EN    T   A+A V D D GL G+   R+ +   +      ++   ++ + +R    LDRE  G Y L +   D+G P     A + + V D ND+ PV  K E +  + E  P G+ V  ITA D D G N ++ Y I   ++L  K+  ++  TG + T   +DRE +D+  L      ++  D G  P+ +     V + DEND AP+F        + E+      +  +   D D  +   V+    P+ E   P           L T R LD EK   Y   ++A D       +ATATV + + D ND+ P F   +Y    ++    I   +  E   + + V   D  D  N    + L +  +GLF++D   G I+       S   K  + + V ARD G    +   ++ IV+
Sbjct:  140 IEVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYL-------AETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVA-VKDSDSGLNGRTSVRIVSGNELGHFRLEEA---ADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNEL--KWFSMDPLTGLIVTTGPLDREIRDTVELS-----ISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGEGLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEIVL 813          

HSP 2 Score: 170.629 bits (431), Expect = 4.171e-42
Identity = 192/698 (27.51%), Postives = 313/698 (44.84%), Query Frame = 3
Query:  681 IQIEDINDNAPRFRTDKF---TINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAF-IKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSI----PSNKYSIRTRVTLDRETKG------------YYELQMECEDKGDPPLRAKALIKVVVKDENDNAP-VIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKG-QPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGL-----FKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKE---SSILITIVIDN 2684
            I I D+NDNAP F  D+    TI++ E+  VG    L    D D+   S   Y L  N    P         TG L LQ  + +  E  +     L+A D G+PP + +L +++ + DVND+ P    T+Y     E+         + A D D  DN ++ ++I     ++ +  + F +  + G ++++  LD E  + +   V   +      ++   V+I VI+ ND  P+        N+   F I EN    T FV   T  D+D G   ++   LS+    F I  R+  I    P ++ ++  +V+ + E  G            Y  L+    D G P L+ K  +KV+V D NDNAP  ++   +V++ E    GT +TH+  +D DEG NG++ YS+++ ++  +    ++S TG L    ++DRE  S+ +     I+   D   + P  S  +  + V DENDNAPEF   S +  V E       L   R  D D     +V            F +       YL+  + LD+E   +Y+  I ASD  G  S + T    V++ D+ND+ P  IFP+ +   + I      +  I+TV+  D DS   +NGK S+ +      L     F I+   G I T R +    +    +TV+A D   P +    +  L+T+++++
Sbjct:  930 IAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNN----PNQQFRIGPVTGVLYLQ--RPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEI-----IEGNTERMFGVFPD-GYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFT------NSTFTFSIPENAPADT-FVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREAL-VKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQ--FNLDSATGQLSLGRRLDRE--SQEIHHL--IVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLH--KPLDYEDITSYTLNITASD-CGTPSLSTTVLYNVLVVDDNDNPP--IFPS-TAIVRQIKEGIPLKTPIVTVTADDPDS--GLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVED 1593          

HSP 3 Score: 163.31 bits (412), Expect = 5.863e-40
Identity = 197/780 (25.26%), Postives = 331/780 (42.44%), Query Frame = 3
Query:  489 SNTKANRLFHLHSN-GKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRT--FECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDD---SEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEI-AIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGD------------------------------------PPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKY-----LEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDN 2684
            S  + +RLF + +  G L +A  +DRE      E   +         +IA+      +PRT   + R+ + D ND+ P+F    F  N+ E   +G   S   A D D   S  + + D    +       F LE +  TG L L     LDRE ++KYE   L I   +  +       I V D NDNPP    T Y+    E+      + +I A+D D   NA++ + +V++      AN  F +   +G + L  +LDYE  + +   V+  +N     + T TV   V++LND  P    + Y +E      + EN    T+ V + +  D D G  G +   ++  +   E       I SN  +IRTR  LDRE +  Y L +   D  D                                      L +   + +++KD ND  PV    N  ++ EN  I T+V  + A D DEG+NG + Y + E+ D            +N   G L+    +DRE  S    S+ + +T  D+G+PPQ +     + + DENDN+P F+       V EN      + ++   D D+ +  R+    +  + +  F + E  +   +   ++L++E+   YS  + A D         TA +T+ I D ND+ P+F+   Y       +   +    +LTV+  D D+   +N +  + L      LF+I+ + G I   + +      ++ +T++A D G+PP   + ++ + + +
Sbjct: 1757 SRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVY---------AIALGG----QPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDTLGSVTFLLMDGHDGK-------FLLEPS--TGKLILN--DTLDRETKSKYE---LRIRVSDGVQYTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDW-----ANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSE------VFENVPIATEVVTV-SAKDIDSGNNGLIEYSITAGDVDSEF-----GIDSNG-TIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETAIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRS----SYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISE--DTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGY-VLTVNAYDADTP-PLNSQVRYFLKEGDSDLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQD 2483          

HSP 4 Score: 157.918 bits (398), Expect = 2.942e-38
Identity = 181/750 (24.13%), Postives = 320/750 (42.67%), Query Frame = 3
Query:  474 KFNLLSNTKANRLFHLHS-NGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPR--TFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYL-KEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNN-ENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDD---NSQLRVSLVHLPNEMSS--PFV--LFERDNKYYLNT--TRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVN-DHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI 2678
            +FNLL   +    FH+ S  G++ +A T+DREE  +               L++  +  SI EPR  +    I + D+NDN P+F +  + + + E    G       A D D  + ++  Y +         F +       S  L+L  K        Y  V+ A+D+G    + +  + + +      P      N +    E     + + K+ A    +    K+ + I     +  D+    R++ NSG + + ++ LDYE    +  ++E ++       +   + + V + ND  P      + +   NA + E E+   + +A+   +D+D G  G V  RL N+ +  FEI        +    I TR+ LDRE  G Y   +E  D+G P +   A + + + D+NDN P      +++V EN  IG+ V  +T+ D+D G N   +YS SE+     +   I   +G++     +DREQ  E      ++  V+  G     +     ++++D+NDNAPEFE+    F   E QQ++  +G+I   D+D    NS +  SL   P+ M S  P    +F +    + ++   RS     E  Y+  +LA+D  G     +   V + I D +++ P F    Y          + A      V V   D +D    +  + L+  +   +F + ++ G IT  + +      ++ + V A D G PP+     + IV+
Sbjct: 2527 RFNLLG--EHMHRFHIDSETGEISTATTLDREETSV-------------YHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQH--YFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVILRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGG--IMGDS---LRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAP-----VMEQLIYNAEVLE-EESPPQLIAVVKASDRDSGDNGNVIYRLQNDFDGTFEI--------TESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTRLFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENP---GEKFRIEPQSGNITVAGHLDREQQDEY-----ILKVVASDGA--WRAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSL-QQPSPMFSIDPATGEVFSKKAVRFKHSQYVRS----PENMYALTVLATD-NGKPPLYSECLVNINIVDAHNNPPKFEQAEY-----LAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVV 3219          

HSP 5 Score: 148.673 bits (374), Expect = 2.117e-35
Identity = 185/701 (26.39%), Postives = 302/701 (43.08%), Query Frame = 3
Query:  666 TFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEE------NSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVE-----VSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKG-LGGQVHCRL-SNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKG-QPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTEN-QQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYY-LNTTRSLDWEK-----------EKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFT-KYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKG-LFKIDQNKGKITTSRTMSESDMGKHV--ITVIARDHGNPPKESSILITI 2672
            T +  I I+D+ND  P F +   T  I E+  + ++     A D+D  +    DY ++E          P  FSL    PT    L+++  LDRE R+ Y   + A DRG PP++    + I +LD NDN P      Y+    E+      +L++ A D DE  N ++ + IV       D N  F I E++G + + + L+YER  ++   V      + N AG     TA + I ++++ND  P     +++       ++        +V      D D   L  QV   L   + ++F I+     I   K        LDRE +  Y L +   D G PPL    +++V V+D NDN PV +L++ + +V EN P GT V    A D DEG N +L +++            I+S TG++ T   +DRE+ S     + + L   D     P+ S     +SV D NDN P+F++ +    V E   +  +  G  R  D DD      ++VH        + +  RD  Y+ +NT   +   K           +  Y+  I A D  G +S ++ A +TVI+       P  +FP ++     + +  E      +   V     K  + GK  + +     G   ++D N G ++  +   + ++  H+  I + A D   P   S  LIT+
Sbjct: 2150 TVKVTILIKDVNDEVPVFISANETA-IMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLN---PTDG-QLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIV-----LGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGD----TAELTINILDINDNRPT----FLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSGDIALLK-------PLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEH---MHRFHIDSETGEISTATTLDREETS----VYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGA-RALDLDDGEN---AVVH--------YTISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMD-QGEQSLSSKAELTVILR------PPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYEL-THLYEIWIEAADGDTPSLRSVTLITL 2798          

HSP 6 Score: 145.206 bits (365), Expect = 2.341e-34
Identity = 174/652 (26.69%), Postives = 291/652 (44.63%), Query Frame = 3
Query:  687 IEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATAT--VLIQVINLNDETP--------EIAIDYVNENNK-------NAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKG-DPPLRAKALIKVVVKDENDNAP-VIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSP----FVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGT--GYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKIT 2567
            I D+ND+ P F    +  ++ E+  V + F    ATD D        Y++ E +    +F +    P G L ++    LDRE+R  Y   +   D G P ++  + + I+V+D NDN P  + + +     E+  +   + K+ A D D   NA++ F + ++        + F I+  +G I      D E   +     E S   G +  + A   +L++    ++  P        ++ +  VN+N         +  I E   + T    + T  D D+GL G V+  L+      +  N DS+  + + S+  R  LDRE++  + L +  +D     PL + A I +VV DENDNAP   +  + VSV E  P GT +    A D D+G N ++ +SIS  +   +    I+S TG L     +D E     + S+ + +T SD G P   +   ++V V D+NDN P F + +I  Q+ E       +  +   D D     +VS      E   P    F +        ++T R +D E    +   ++A+D      +  +    VTVI+ED ND+AP F+  N +      S  + +  A++ V   D DS  S NG  ++ +V+  + LFK+ +N G IT
Sbjct: 1039 IADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNT-ERMFGV---FPDGYLFVR--APLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQ-------TQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFT-QDADEGLNGDVYYSLAKGNEAGQF-NLDSA--TGQLSLGRR--LDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGN--RRDTFHIDSITGSLYLHKPLDYED----ITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGI--NTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADS--SSNGLVTYEIVSGPQELFKLQRNTGIIT 1661          

HSP 7 Score: 144.821 bits (364), Expect = 3.094e-34
Identity = 176/706 (24.93%), Postives = 316/706 (44.76%), Query Frame = 3
Query:  603 KDPCDISLSIAVKSDSIEEPRTFEC--RIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRL--SNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAP-VIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKG----QPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD---DNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVND-HKGLFKIDQNKGKITTSRTMSESDMGKHVITVI-ARDHGNPPKESSILITIVI 2678
            + P ++     + +D+ + P   EC   I I D ++N P+F   ++   + +    G       A D      +  DY L   ++   IFS+   R  G + L  ++ +      +YE V+ A DRG PP++    + I V   N + P  S  +Y +   E++     +L +GA D+D   N  + + I        +  + F ++E +G I ++++LDY+  +++   + V +   H  ++ A + I + ++ND  P       N    + +I EN+   T FV  A   DKD      +H     S  +  F I N+ +       +I + V+ D E +  Y LQ++ ++  D  + + A + V V   N+  P  ++   +  V E   +GT V  + A D D G++G + Y +  SS+   K   I+++TG +     +DRE  +       V+LTV  K     +          +S++D ND  PEF  +     ++E       +  ++  DKD    N+Q   S+++    +   F +  +  +  ++T   LD E+   Y+  I A D TG    T +ATV + +ED ND+ P+F          YIS +E A  +I+T+   D D   +  G  ++ L+   HK    +D+N G +  S T  + +M   +  +I   D G P ++S  L+TI +
Sbjct: 3084 RSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNL-SSIFSV--GRHDGWITL--VKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGG-----NERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPP-----VFNHKEYHCYIPENKPVGT-FVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNG------TISSAVSFDYEERRIYTLQIKAKNP-DSSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSN--DKGFRIDTNTGLIYVARHLDRETQNR------VVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIIN--GNLKQSFKIDVQTGE--ISTASRLDREETSTYNLVIGAID-TGLPPQTGSATVHIELEDVNDNGPTF---TPEGLNGYISENEPAGTSIMTLIASDPDLPRN-GGPFTYQLIGGKHKSWLSVDRNSG-VVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITV 3747          

HSP 8 Score: 137.502 bits (345), Expect = 4.698e-32
Identity = 170/689 (24.67%), Postives = 296/689 (42.96%), Query Frame = 3
Query:  681 IQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQ-YSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAK-----YEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIK-LENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFD---VSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASD-GTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDH-KGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITI----VIDNSKPFS 2699
            I I+D NDNAP F    ++ +  E +   +L    IATD D +   S+  Y L++ S   P+FS++    TG +  +   +    +  +     Y   +LA D G PP     ++NIN++D ++NPP   Q  Y     +     Q ++++ A D+ +    +M + ++       + +  F +  + G I L + +    + ++   V  ++      +    V+I V   N +TP  ++     N+    + ENE   +  + +   TD D G  G +   +S          +D S+      I  +  LD +    Y L +  +D G  PL + A++ +++ D NDN PV    E +  + ENKP+GT V    A D D  KN  + Y+   S    + +  +N   G + + +  D E+          I T+  K + P  S +++    V V   N+  P+F      F V+E       +G ++  DKD     RV  + + +     F +       Y+   R LD E +      ++A + G+   + T  A V + I+D ND  P FI   Y   T  IS        + TV   D D + + N + S+ ++N + K  FKID   G+I+T+  +   +   + + + A D G PP+  S  + I    V DN   F+
Sbjct: 3001 ITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPS---PMFSIDP--ATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMT-----FNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSV-----NSYQVIVPENEPVGSTILTVG-ATDDDTGPNGMLRYSISGGN-----ERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGP-DRHFFIMNQSNGTISSAVSFDYEERR--------IYTLQIKAKNPDSSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIYV--ARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPEFIKHYY---TSTISEAAPVGTKVTTVKAIDKDVR-TQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFT 3652          

HSP 9 Score: 128.257 bits (321), Expect = 2.890e-29
Identity = 171/748 (22.86%), Postives = 326/748 (43.58%), Query Frame = 3
Query:  513 FHLHSNGKLYSAQTIDREELCINVESCCHKKDPCDISLSI-AVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAID---RGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDED-ENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHR-------FYVEVSNNAGHVDTATATVLIQVINLNDETPEI-AIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLS-NNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVN--DHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDH----GNPPKESSILITIVIDNSKP 2693
            F +  +G++Y+   +DREE+              D +  + AV         T    + + D NDN P+F T  F++N+ E+  +GS      ++D D    +   Y   EN      F +E      S N+ +   LDRE++ +Y   ++A D   R   P T      I + D NDN P    + Y+  + E + S+  + +I A D D +  N+ + + +    P+       F I+  +G ++ K+ + ++  +  R         V  ++N      +   V I +++ ++  P+    +Y+      A + ++  +  + V +     +D G     +  ++ N  ++F +   D  I     ++   + +   T+  YEL +   D+G PP   +  + +VV  EN + P   + +  V V EN+P+G+ +  + A D D G NG L YSIS  ++  ++   ++  TG +     I ++ D + +Q + + +TV D G  P  S     + + D NDN P F +      + EN+     + +    DKD      +    LP+     F +  + N   +++  S D+E+ + Y+ +I A +     S  + A + V +   N+  P F+ P +     +    E++ +     +V   D     +G+  + LV   + KG F+ID N G I  +R +      + V+TV+A+++    GN   E+ ++I+I   N  P
Sbjct: 2857 FEITESGEIYTRMRLDREEIG-------------DYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKF-TRLFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENP--GEKFRIEPQ----SGNITVAGHLDREQQDEYILKVVASDGAWRAETPIT------ITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPSPM-------FSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYL------APLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWI-----TLVKPIQVPPNTR--YELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNE--RQDFSVDERTGGIV----IQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNG-TISSAVSFDYEERRIYTLQIKAKNPD--SSMESYANLYVHVLGVNEFYPQFLQPVF-----HFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKG-FRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDPP 3543          

HSP 10 Score: 122.865 bits (307), Expect = 1.325e-27
Identity = 189/780 (24.23%), Postives = 321/780 (41.15%), Query Frame = 3
Query:  531 GKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPR--TFECRIQIEDINDNAPRFRTDKFTINI----------KESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQT---NYNIQY---EESKFSMQPLLKIG---AKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYV------EVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTG---------YKSHTATAT------------VTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLV-NDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHG-NPPKESSILITIVI----DNSKPFS 2699
            G+L + + +DRE++                 +S+  +      P+  T    + + D+NDN P+F    +  ++          KE E    L  +  A+D D    ++ +Y+LE       +F L+    +G+++L+         +  Y+ ++ A D G   ++ +  I   VL          Q     Y  Q     E + + QP  ++G    K  +   N+ + + I+     + D  + FRI+  SG I     LD E    +R  +        S  A  V      V I +I+LND  P  A+D   E+     + EN     + + L+ V D+D G+  ++   L+NN N      R   +    Y  R    +  E      +++   D G PPL +K  + V++ D ND+ PV    +   S+ E   + T    + A DID G NG ++Y I E +  T++   +    G L  R  +DRE+       + + ++  D GQP + S     + V DENDNAP+F N +  F + EN  A   +G++   D+D   N++L  +L    +  +  F +  R+   ++ T R  D E     S    AS   G         Y    AT +            V VI+ D ND+AP F+   Y     +++  E A        V   D+ + +NG   + L   +  G F +D   G+++  R +       H + V+A+D     P  S+  ITIV+    DN+  F+
Sbjct:  657 GQLTTRRPLDREKMS-------------QYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHV-TASDKDDGDNALIEYRLESGG--EGLFQLDAR--SGAISLRGDAPASMHWKPHYKLLVSARDAGQR-RSQQDAIVEIVLKSKLEMLECGQAQAGGYEFQMVEDHEQQRNSQPNREVGIVQVKSTNGKANSHIEYDII-----QGDRAQNFRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALD--RESEPTISLPENAAVGQE-IYLSRVRDRDAGVNSRISYSLTNNPNQ---QFRIGPVTGVLYLQRP---IRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGN--TERMFGVFPD-GYLFVRAPLDREER----DYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTL----SSQTQDFTIDTRNG--FIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPY-----HVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFT 1385          

HSP 11 Score: 121.709 bits (304), Expect = 3.215e-27
Identity = 184/796 (23.12%), Postives = 338/796 (42.46%), Query Frame = 3
Query:  375 PCDIKVTDNTKENSFISNLNSFDVYSTPYTQNKKFNLLSNTKANRLFHLHSNGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIE--DINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATAT---VLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVT----DKDKGLGGQVHCRL-SNNENVFEIHNRDSSI----PSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVV---KDENDNAPVIKLEN----NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISE-----SSDLTKKYLEINSHTGDLKTRMKIDREQDSET--LQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDS---MNGKCSFHLVNDHKG-LFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILI 2666
            P  + +++   E + I+++ + D        +  ++L    +A +     + G+L   + +DRE   I+              L +  K  +++ P +    I I   D NDNAP F      +++ E+ P G+      A+D D    S   + +   +      +   +  TGSL L   + LD E    Y   + A D G P  +  ++ N+ V+D NDNPP    T    Q +E      P++ + A D D   N K+ + I  ++P ++   ++F I   +G I+   ++D E  +  R  V  ++ A   +   +T   V + V ++ND  P          + NA I   +   +K  + A +     D D    G V   + S  + +F++  R++ I    P  ++    R          Y+L ++  D+     R  + + + +         + V + E     + SVYEN+PIGT +  +TA       + E+ Y ++      S     +  +I++  G L T  ++DRE   E   ++ + + L     G  P+ SR    V+V D+ND+ P+F +    + V+E+ Q  +T+  +R HD D    +   L+   +     F+L     K  LN T  LD E +  Y  +I  SDG  Y      A  T+ + D ND+ P F    YS         +  E A     VG + ++D+    N + S+ +V+D    +F ++   G +T +  +   ++  +++ V A+D+G P   ++I +
Sbjct: 1282 PYHVTISEGASEGTHITHVFTQDA-DEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIH-------------HLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRD---TFHIDSITGSLYLH--KPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEP-QLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFV-------SMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQELFKLQ-RNTGIITFTPGPQFKQEVR----------YQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTA----HLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIAL-----GGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDTLGSVTFLLM---DGHDGKFLLEPSTGKLILNDT--LDRETKSKYELRIRVSDGVQYTE----AYATIQVSDTNDNPPLFEDTVYS--------FDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITV 2013          

HSP 12 Score: 119.783 bits (299), Expect = 1.084e-26
Identity = 185/746 (24.80%), Postives = 322/746 (43.16%), Query Frame = 3
Query:  483 LLSNTKANR--LFHLHS-NGKLYSAQTIDREELC---INVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKL-EENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPK----TGRXXXXXXXXXXXXXXXHLSQTNYNI--QYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNK-NAFIKENEDQKTKFVALAT----------VTD-KDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGY-YELQMECEDKGDPPLRAKALIKVVVKDENDNAP-VIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIA--ILTVSVGDLDSKDSMNGKCSFHL-VNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARD 2630
            + S +  NR   FH+ S  G LY  + +D E++    +N+ +     D    SLS  V  +           + + D NDN P F +      IKE  P+ +      A D DS       Y + ++    P       N  TG ++   ++++DRE    +   ++A DR  P +    T +LV  I     ++ P  +S     +  ++  SK S   ++++ AKD D + N  + ++IV+         + F+++ N+G I       ++++ +++  ++ ++ A   +  ++ V I +I       E ++    + +K +  + ENE   T  + +            VT+    G  GQV       + +F+I  +   +        T   LDRE     YE+++     G  P  ++  ++V V D+ND+ P  +      +V E+  IG  ++ + A D D    G +T+ + +  D   K+L +   TG L     +DRE  S+    + + + VSD     Q +     + V D NDN P FE+    F + EN Q  Y +G+I   D D     ++S   + +  +  F L  +     L  T  LD+E+ ++Y   + A D  G  S + T TV   + D ND+AP F   +YS+        E+  IA  ++TVS  D+DS +  NG   + +   D    F ID N G I T R +       + +TV ARD
Sbjct: 1420 VFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITA----SDCGTPSLSTTVLYN-----------VLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHT--LREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVS------GPQELFKLQRNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTAHLASAEIEYFVTNVTATGSRGQV-------DRLFDIDAKLGIL-------STAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPD--TLGSVTFLLMDGHD--GKFL-LEPSTGKLILNDTLDRETKSK----YELRIRVSDG---VQYTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTG--MLTLTARLDYEEVQHYILIVQAQD-NGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSS-----EVFENVPIATEVVTVSAKDIDSGN--NGLIEYSITAGDVDSEFGIDSN-GTIRTRRNLDREHRSTYTLTVTARD 2105          

HSP 13 Score: 117.472 bits (293), Expect = 6.544e-26
Identity = 132/516 (25.58%), Postives = 214/516 (41.47%), Query Frame = 3
Query: 1200 KYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPE-----IAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGG---QVHCRLSNNENVFEIHNRDSSIPSNKYS---IRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQ-----DSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPE-----FENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHK-GLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI 2678
            + F ++  +G +     LD E    H   V +S+      T    V I+V+++ND +PE     IAI +           E+    T+ + L   TD D G  G   Q      N +N F +    ++ PS   S   + T   LDRE++G Y+L +   D G PP      + V + D NDN P+    + NVS+ E    GT V  + A D D G N ++TY ++E    T+    +N  TG + T  +++  Q      S + +S    +   D G P Q  R    V++ D ND+ P      F +      V EN      +  + V D D     R S+  +       F L E  + + +     LD E+   Y+  ++A D  G  + T TA + + + D NDH P F    YS         E A       S+   D    +N +  + +++ ++   F +D   G I T+  +         +++ ARD G  PK +   + ++I
Sbjct:  101 REFTLDPVTGEVKTNVVLDREGMRDHYDLVVLSSQP----TYPIEVRIKVLDVNDNSPEFPEPSIAISF----------SESATSGTRLL-LDAATDADVGENGVTDQYEIVAGNVDNKFRLVT--TANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAE----TEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMD-QGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLS-----ELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVII 589          

HSP 14 Score: 113.62 bits (283), Expect = 9.105e-25
Identity = 167/680 (24.56%), Postives = 284/680 (41.76%), Query Frame = 3
Query:  672 ECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLN-------LQLIQKLDREKRAKYEFVLLAIDRG-NPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPP---LRAKALIKVVVKDENDNAPVIKLENNVSVY-----ENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSV-------KDENDNAPEFENYS-IQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKY-YLNTTRSLDWEK-EKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAIL-TVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARD 2630
            + ++ + D+NDNAP F    + + I E    G+  +  + T D  E  +   Y           +SL +    G  N       L L ++LDRE +  +  +++A D     P +    I I VLD NDN P  +Q++  +   E+  +   L++  A D D+  N+++VF I        +    F I+  +G++YL + LDYE    +   +  S+      + T    + V++ ND  P      +        IKE    KT  V + T  D D GL G+V   +S  E       R   I +    I T   +DRE+   + L +   D+  P    L  + L+ V+V+D NDNAPV  +  N ++       +K   T V  + AKD D   NG +TY I       ++  ++  +TG       I      +  Q     LT+    +  Q  R++ +V +            + P+FE  S +   V EN+    ++  +  H      +  V+ V           LF+ D K   L+T   LD E   + Y  ++ A    G +  T+   V V + D+ND  P F+       T ++ Y+ S ++ I  T+S       D++ G  +F L++ H G F ++ + GK+  + T+      K+ + +   D
Sbjct: 1263 KVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHIT-HVFTQDADEGLNGDVY-----------YSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSI-----SAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQ-----IKEGIPLKTPIVTV-TADDPDSGLNGKVSYAISKQEPQLP-QGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVF-VSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGP---QELFKLQRNTG------IITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTAHLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAI-ALGGQPRTSRTKVRVTVLDKNDSPPQFL------DTPFV-YNVSEDLQIGHTISTLRAHDPDTL-GSVTFLLMDGHDGKFLLEPSTGKLILNDTLDRETKSKYELRIRVSD 1899          

HSP 15 Score: 66.6254 bits (161), Expect = 1.634e-10
Identity = 101/436 (23.17%), Postives = 174/436 (39.91%), Query Frame = 3
Query:  522 HSNGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAID----RGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDED-ENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIK-LENNVSVYENK-PIGTLVTHITAKDID 1808
             SNG + SA + D EE  I              +L I  K+            + +  +N+  P+F    F  ++ E+  VG+      ATD DS +   R Y L   S     F ++ N  TG +   + + LDRE + +    ++A +    RGN     +++I+I   +         +  Y     E+      +  + A D+D    N +  + I+N      +  + F+I+  +G I    +LD E    +   +   +      T +ATV I++ ++ND  P    + +N      +I ENE   T  + L          GG    +L   +     H    S+  N   +R+  + DRE     E  +E ED G P  +++ L+ + V D+NDN    + L   VS++    P    +  +   DID
Sbjct: 3387 QSNGTISSAVSFDYEERRI-------------YTLQIKAKNPDSSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDG-RVYYLLVGSSNDKGFRIDTN--TGLI--YVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDPP---EFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIING-----NLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLN-----GYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGK-----HKSWLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDNPSTTRSLHIAVSLFNGDLPSNVKLADVRPNDID 3786          
BLAST of Protocadherin vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0330601)

HSP 1 Score: 177.178 bits (448), Expect = 3.498e-44
Identity = 198/763 (25.95%), Postives = 329/763 (43.12%), Query Frame = 3
Query:  486 LSNTKANRLFHLHS-NGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIE--DINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFP--------PIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPP---KTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQ---PLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIP----SNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIK---LENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLP-NEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDH---KGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDN 2684
            L ++++  LF + S  G + ++ ++DRE +              D+     V +D    PR+    +Q+   D ND++P F  ++F  +I+E   VGS      ATD D  + +  +Y +E  +           PIF ++    +G ++ +    LDRE    Y  ++ A D  +     +T    + + VLD NDN P  S+  Y +Q  E ++       +  I A D D+ +NA + + I+       +    F I+  SG++ L + LDYE    +R  +   +      + T  +L+ VI+ ND  P        E+     + EN       + +    D D+G         +N E  + I  RD + P         ++T   LDRE +G +  Q+  +D G PP  A + + + V+D NDN P       E NV   E++P GT VT +TA D DE  +  L Y I+  +  T+    I S  G  +  + I +  D +  + F + +  +D G   +       +++ D N+ AP FEN      V E+     T+  +   D D   N+Q+  SL     N + SP           + T   LD E    Y   + A DG G  S + T  V + + D ND+AP+F  P Y       S  E A +    + V   D    +NG+  + L++D     G F ID   G I T++ +    +    +T IA D G+PP  S++ + I +++
Sbjct:  398 LLDSRSQSLFKVDSRTGVVTTSASLDRELM--------------DVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSR--SGVISTR--SSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGG-----NTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQES-----VLENVPVGYNIIRVQAY-DSDEG---------ANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVG--EDQPPGTPVTTVTATDPDE--DSRLHYEITTGN--TRGRFAITSQNG--RGLITIAQSLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDG-GNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQ-----ASILEDALVGTSVIQVAASDPDVGLNGRIKY-LLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLED 1105          

HSP 2 Score: 172.17 bits (435), Expect = 1.171e-42
Identity = 181/649 (27.89%), Postives = 295/649 (45.45%), Query Frame = 3
Query:  666 TFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGN--IYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNK-NAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDS-SIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLE-NNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDN--KYYLNTTRSLDWEK-EKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSF-----IFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTS 2573
            T +  + + D NDNAPRF T +F  ++ E+ PVG       A D D    +   Y + E       F L  +  TG +  Q I+ LDRE++ ++ F ++A D G PPK+    + I V DVNDN P  +   Y     E +    P+  + A D DE+  +++ ++I        +    F I   +G   I + + LDY+++++    V  +++ G  DTAT  V I + + N+  P      + EN   +A + E+    T  V + + TD D G+  Q+   L N E++  + + D  SI     +I T   LDRET   Y L +  +D G+P L     +++ V D NDNAP  K      S+ E+  +GT V  + A D D G NG + Y +S+  D+      I+  +G ++T   +DRE    ++  F +     DKG PP  S     + ++D ND+ P F +  I   V EN      +GEI  HD D+     V    +  + S+ F L  R    +  L T   LD+E   K +   + A+           A + +++ D ND+AP       IF N+ +      +  S EI    +   D D  D ++ +    L  ++  L +++ + G +  S
Sbjct:  672 TTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERD---DNFPLAVDPRTGWV--QTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED--SRLHYEITTG-----NTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTAT--VHINITDANNFAP------IFENAPYSASVFEDAPVGTT-VLVVSATDSDVGVNAQITYSL-NEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDR-DIEDGSFVIDPTSGTIRTNKGLDRE----SVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAAS----PPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRD------HFPSGEIG--RIPAFDADVSDKLHYRI---LSGNNANLLRLNSSSGGLVLS 1278          

HSP 3 Score: 140.584 bits (353), Expect = 5.929e-33
Identity = 132/534 (24.72%), Postives = 244/534 (45.69%), Query Frame = 3
Query: 1206 FRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIP-----SNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLR---AKALIKVVVKDENDNAPVIKLEN-NVSVYENKPIGT---LVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQ--VTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGK--ITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNSKPFSIGQSNENNRDPNYVNKKFSG 2759
            F+++  +G +     LD E  + H F V  ++++    + T T+ + V++ ND +P    +        A I+E     +  + L   TD+D G   ++   +    +   +  +D  +P     S    I TR +LDRET   Y L +   D          A A ++V V D+NDN P        V V E++  GT    V HI A D D+G N  + Y+I   +  T+    I+S +GD+     + +  D E+++S+ +++   D G P + +     V+V D NDNAP F  Y+ QFQ  V EN    Y +  ++ +D D+ +   ++      + + P  +  R    ++ T + LD E++  ++F+++A DG G    +A+++V + ++D ND+ P+F  P Y  +   +   +     + TV+  D D    ++ + +     + +G F I    G+  IT ++++      + ++TV A D G     +++ I I            ++ NN  P + N  +S 
Sbjct:  407 FKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFE-----ASIREGATVGSTVITL-RATDQDIGKNAEIEYGIEAVTDGAGL-AQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGN--TQSQFSIDSMSGDVS----LVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRF--YTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTG--WVQTIKPLDREEQGRFAFQVVAKDG-GVPPKSASSSVVITVQDVNDNDPAF-NPKY--YEANVGEDQPPGTPVTTVTATDPDEDSRLHYEIT---TGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINI------------TDANNFAPIFENAPYSA 904          

HSP 4 Score: 80.1073 bits (196), Expect = 1.232e-14
Identity = 80/327 (24.46%), Postives = 149/327 (45.57%), Query Frame = 3
Query: 1743 VSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSD-LTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSL------VHLPNEMSSPFVLFERDNKYYLNTTR-SLDWEKEKNYSFKILASDGTGYKS--HTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDH-KGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSI-LITIVID 2681
             SV E +P G  VT + A+D ++     + YS+    D  ++   +++S TG + T   +DRE     +  F V+ T  D   PP+       V+V D ND++P FE    +  + E      T+  +R  D+D   N+++   +        L  +   P  +F  D++  + +TR SLD E   +Y   + A+D    +S   TATA+V V + D+ND+ P F    Y+       +  + +  +  +   D D  +  N    + ++  + +  F ID   G ++  + +    +  + + + A+D G+P + ++  L+  VID
Sbjct:  366 ASVLEEQPAGAAVTTVRARDPEDSP---VVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDREL--MDVHYFRVVAT--DDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMP--IFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGN--NAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVID 681          
BLAST of Protocadherin vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0339463)

HSP 1 Score: 177.178 bits (448), Expect = 3.796e-44
Identity = 198/763 (25.95%), Postives = 329/763 (43.12%), Query Frame = 3
Query:  486 LSNTKANRLFHLHS-NGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIE--DINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFP--------PIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPP---KTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQ---PLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIP----SNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIK---LENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLP-NEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDH---KGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDN 2684
            L ++++  LF + S  G + ++ ++DRE +              D+     V +D    PR+    +Q+   D ND++P F  ++F  +I+E   VGS      ATD D  + +  +Y +E  +           PIF ++    +G ++ +    LDRE    Y  ++ A D  +     +T    + + VLD NDN P  S+  Y +Q  E ++       +  I A D D+ +NA + + I+       +    F I+  SG++ L + LDYE    +R  +   +      + T  +L+ VI+ ND  P        E+     + EN       + +    D D+G         +N E  + I  RD + P         ++T   LDRE +G +  Q+  +D G PP  A + + + V+D NDN P       E NV   E++P GT VT +TA D DE  +  L Y I+  +  T+    I S  G  +  + I +  D +  + F + +  +D G   +       +++ D N+ AP FEN      V E+     T+  +   D D   N+Q+  SL     N + SP           + T   LD E    Y   + A DG G  S + T  V + + D ND+AP+F  P Y       S  E A +    + V   D    +NG+  + L++D     G F ID   G I T++ +    +    +T IA D G+PP  S++ + I +++
Sbjct:  398 LLDSRSQSLFKVDSRTGVVTTSASLDRELM--------------DVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSR--SGVISTR--SSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGG-----NTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQES-----VLENVPVGYNIIRVQAY-DSDEG---------ANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVG--EDQPPGTPVTTVTATDPDE--DSRLHYEITTGN--TRGRFAITSQNG--RGLITIAQSLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDG-GNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQ-----ASILEDALVGTSVIQVAASDPDVGLNGRIKY-LLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLED 1105          

HSP 2 Score: 172.17 bits (435), Expect = 1.187e-42
Identity = 181/649 (27.89%), Postives = 295/649 (45.45%), Query Frame = 3
Query:  666 TFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGN--IYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNK-NAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDS-SIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLE-NNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDN--KYYLNTTRSLDWEK-EKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSF-----IFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTS 2573
            T +  + + D NDNAPRF T +F  ++ E+ PVG       A D D    +   Y + E       F L  +  TG +  Q I+ LDRE++ ++ F ++A D G PPK+    + I V DVNDN P  +   Y     E +    P+  + A D DE+  +++ ++I        +    F I   +G   I + + LDY+++++    V  +++ G  DTAT  V I + + N+  P      + EN   +A + E+    T  V + + TD D G+  Q+   L N E++  + + D  SI     +I T   LDRET   Y L +  +D G+P L     +++ V D NDNAP  K      S+ E+  +GT V  + A D D G NG + Y +S+  D+      I+  +G ++T   +DRE    ++  F +     DKG PP  S     + ++D ND+ P F +  I   V EN      +GEI  HD D+     V    +  + S+ F L  R    +  L T   LD+E   K +   + A+           A + +++ D ND+AP       IF N+ +      +  S EI    +   D D  D ++ +    L  ++  L +++ + G +  S
Sbjct:  672 TTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERD---DNFPLAVDPRTGWV--QTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED--SRLHYEITTG-----NTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTAT--VHINITDANNFAP------IFENAPYSASVFEDAPVGTT-VLVVSATDSDVGVNAQITYSL-NEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDR-DIEDGSFVIDPTSGTIRTNKGLDRE----SVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAAS----PPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRD------HFPSGEIG--RIPAFDADVSDKLHYRI---LSGNNANLLRLNSSSGGLVLS 1278          

HSP 3 Score: 140.198 bits (352), Expect = 6.118e-33
Identity = 132/534 (24.72%), Postives = 244/534 (45.69%), Query Frame = 3
Query: 1206 FRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIP-----SNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLR---AKALIKVVVKDENDNAPVIKLEN-NVSVYENKPIGT---LVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQ--VTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGK--ITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNSKPFSIGQSNENNRDPNYVNKKFSG 2759
            F+++  +G +     LD E  + H F V  ++++    + T T+ + V++ ND +P    +        A I+E     +  + L   TD+D G   ++   +    +   +  +D  +P     S    I TR +LDRET   Y L +   D          A A ++V V D+NDN P        V V E++  GT    V HI A D D+G N  + Y+I   +  T+    I+S +GD+     + +  D E+++S+ +++   D G P + +     V+V D NDNAP F  Y+ QFQ  V EN    Y +  ++ +D D+ +   ++      + + P  +  R    ++ T + LD E++  ++F+++A DG G    +A+++V + ++D ND+ P+F  P Y  +   +   +     + TV+  D D    ++ + +     + +G F I    G+  IT ++++      + ++TV A D G     +++ I I            ++ NN  P + N  +S 
Sbjct:  407 FKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFE-----ASIREGATVGSTVITL-RATDQDIGKNAEIEYGIEAVTDGAGL-AQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGN--TQSQFSIDSMSGDVS----LVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRF--YTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTG--WVQTIKPLDREEQGRFAFQVVAKDG-GVPPKSASSSVVITVQDVNDNDPAF-NPKY--YEANVGEDQPPGTPVTTVTATDPDEDSRLHYEIT---TGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINI------------TDANNFAPIFENAPYSA 904          

HSP 4 Score: 80.1073 bits (196), Expect = 1.338e-14
Identity = 80/327 (24.46%), Postives = 149/327 (45.57%), Query Frame = 3
Query: 1743 VSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSD-LTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSL------VHLPNEMSSPFVLFERDNKYYLNTTR-SLDWEKEKNYSFKILASDGTGYKS--HTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDH-KGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSI-LITIVID 2681
             SV E +P G  VT + A+D ++     + YS+    D  ++   +++S TG + T   +DRE     +  F V+ T  D   PP+       V+V D ND++P FE    +  + E      T+  +R  D+D   N+++   +        L  +   P  +F  D++  + +TR SLD E   +Y   + A+D    +S   TATA+V V + D+ND+ P F    Y+       +  + +  +  +   D D  +  N    + ++  + +  F ID   G ++  + +    +  + + + A+D G+P + ++  L+  VID
Sbjct:  366 ASVLEEQPAGAAVTTVRARDPEDSP---VVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDREL--MDVHYFRVVAT--DDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMP--IFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGN--NAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVID 681          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 291.197 bits (744), Expect = 9.826e-82
Identity = 231/735 (31.43%), Postives = 373/735 (50.75%), Query Frame = 3
Query:  531 GKLYSAQ-TIDREEL--CINVESCCHKKDPCDISLSIAVKSDSIEE--PRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEI---AIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSN----KYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLE-NNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHK-GLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNS 2687
            G +Y+ + +IDRE L  C N+     + DPC +   +++ +D ++   PR  E RI+I D NDN P+F +   T++I E+  VG+LF++P+ATD DS    I DY L        +FSL+  + +     QLI    LDRE R  Y+  +  +D G+PP+    ++ I + D NDN P   +++Y  +  E+      +L++ A D D   N ++ + +   QP      +   I+ N+G I++K  +D E     +FYV+  +N     ++ A V I V + ND  P I    I  V   +  A I E+    T  VAL  V+D+D+G    V C ++ +        R +S   N    KY ++T   LD E    Y +++   D G+P L +   +KV V D NDNAPV       V  +E    G  V  + A D D G N ELTYSI+  S + +   EIN +TG+++   ++DREQ    L  +  ++  +DKG P         V V D NDN P+F      F V EN   L  +G + V+D D+    RV L   P+  +  F++  ++  Y + +T S D EKE  YSF++ A DG G    ++   +T+ + DEND+AP    P  S++ K++    S E  + +V   D+D    +N +  F++V  +  GLF+I  ++G+IT ++  +   +G H + V  +D G PP++++ L+ I ++ +
Sbjct:   77 GDIYTTENSIDRESLKDCRNL----FEGDPCFLEFEVSI-TDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSL--HQP-SSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTA-VALVEVSDRDEGENAVVTCVVAGD---VPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGS-VPEGLFEINPNTGEVRVMSQLDREQ----LDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPD--NGKFMI--QNGTYTILSTISFDREKESTYSFRLKAVDG-GDPPRSSYVGITINVLDENDNAPYVTKPANSSY-KFLDPRTSPETHVESVEAEDIDI--GLNSELDFNIVGGNPHGLFRI-SSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNET 785          

HSP 2 Score: 129.798 bits (325), Expect = 8.265e-30
Identity = 140/536 (26.12%), Postives = 236/536 (44.03%), Query Frame = 3
Query:  507 RLFHLHSN-GKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTI--------NIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLN-----LQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHIT---AKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFEN 2063
            RL  +  N G ++   ++DREE+ I ++     KD    S S    S ++         I ++D NDNAP  R     +        NI E  PVG+  +L   +D D  + ++    +  +   P  F L     TG+       LQ    LD E+  +Y   ++A+D GNP  +    + + V D+NDN P  S T Y +++ E       +L + A D D   NA++ + I             F I  N+G + +  +LD E+ + ++F V  ++        TATV+++V++ ND  P+  +     N  +  ++EN    +  V + TV D D+G   +V   +  +   F I N         Y+I + ++ DRE +  Y  +++  D GDPP  +   I + V DENDNAP +    N S     P  +  TH+    A+DID G N EL ++I   +        I+S     +  + + +E   + +    +++ V DKG PP+ +     + V +   N    E 
Sbjct:  299 RLLSIDRNTGIIFVKGSVDREEISI-LKFYVQAKDNGPQSKS----SKAL-------VTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGD--VP--FQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSV----PEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFML-----NGYSFSVQENMPPLSP-VGMVTVNDHDEGENARVQLSVEPDNGKFMIQN-------GTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGN--PHGLFRISS-----EGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNETIGNVSHVEG 794          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 290.812 bits (743), Expect = 9.988e-82
Identity = 231/735 (31.43%), Postives = 373/735 (50.75%), Query Frame = 3
Query:  531 GKLYSAQ-TIDREEL--CINVESCCHKKDPCDISLSIAVKSDSIEE--PRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEI---AIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSN----KYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIK-LENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHK-GLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNS 2687
            G +Y+ + +IDRE L  C N+     + DPC +   +++ +D ++   PR  E RI+I D NDN P+F +   T++I E+  VG+LF++P+ATD DS    I DY L        +FSL+  + +     QLI    LDRE R  Y+  +  +D G+PP+    ++ I + D NDN P   +++Y  +  E+      +L++ A D D   N ++ + +   QP      +   I+ N+G I++K  +D E     +FYV+  +N     ++ A V I V + ND  P I    I  V   +  A I E+    T  VAL  V+D+D+G    V C ++ +        R +S   N    KY ++T   LD E    Y +++   D G+P L +   +KV V D NDNAPV       V  +E    G  V  + A D D G N ELTYSI+  S + +   EIN +TG+++   ++DREQ    L  +  ++  +DKG P         V V D NDN P+F      F V EN   L  +G + V+D D+    RV L   P+  +  F++  ++  Y + +T S D EKE  YSF++ A DG G    ++   +T+ + DEND+AP    P  S++ K++    S E  + +V   D+D    +N +  F++V  +  GLF+I  ++G+IT ++  +   +G H + V  +D G PP++++ L+ I ++ +
Sbjct:   79 GDIYTTENSIDRESLKDCRNL----FEGDPCFLEFEVSI-TDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSL--HQP-SSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTA-VALVEVSDRDEGENAVVTCVVAGD---VPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGS-VPEGLFEINPNTGEVRVMSQLDREQ----LDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPD--NGKFMI--QNGTYTILSTISFDREKESTYSFRLKAVDG-GDPPRSSYVGITINVLDENDNAPYVTKPANSSY-KFLDPRTSPETHVESVEAEDIDI--GLNSELDFNIVGGNPHGLFRI-SSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNET 787          

HSP 2 Score: 130.183 bits (326), Expect = 5.685e-30
Identity = 140/536 (26.12%), Postives = 236/536 (44.03%), Query Frame = 3
Query:  507 RLFHLHSN-GKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTI--------NIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLN-----LQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHIT---AKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFEN 2063
            RL  +  N G ++   ++DREE+ I ++     KD    S S    S ++         I ++D NDNAP  R     +        NI E  PVG+  +L   +D D  + ++    +  +   P  F L     TG+       LQ    LD E+  +Y   ++A+D GNP  +    + + V D+NDN P  S T Y +++ E       +L + A D D   NA++ + I             F I  N+G + +  +LD E+ + ++F V  ++        TATV+++V++ ND  P+  +     N  +  ++EN    +  V + TV D D+G   +V   +  +   F I N         Y+I + ++ DRE +  Y  +++  D GDPP  +   I + V DENDNAP +    N S     P  +  TH+    A+DID G N EL ++I   +        I+S     +  + + +E   + +    +++ V DKG PP+ +     + V +   N    E 
Sbjct:  301 RLLSIDRNTGIIFVKGSVDREEISI-LKFYVQAKDNGPQSKS----SKAL-------VTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGD--VP--FQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSV----PEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFML-----NGYSFSVQENMPPLSP-VGMVTVNDHDEGENARVQLSVEPDNGKFMIQN-------GTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGN--PHGLFRISS-----EGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNETIGNVSHVEG 796          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 290.812 bits (743), Expect = 2.039e-81
Identity = 231/735 (31.43%), Postives = 373/735 (50.75%), Query Frame = 3
Query:  531 GKLYSAQ-TIDREEL--CINVESCCHKKDPCDISLSIAVKSDSIEE--PRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEI---AIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSN----KYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIK-LENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHK-GLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNS 2687
            G +Y+ + +IDRE L  C N+     + DPC +   +++ +D ++   PR  E RI+I D NDN P+F +   T++I E+  VG+LF++P+ATD DS    I DY L        +FSL+  + +     QLI    LDRE R  Y+  +  +D G+PP+    ++ I + D NDN P   +++Y  +  E+      +L++ A D D   N ++ + +   QP      +   I+ N+G I++K  +D E     +FYV+  +N     ++ A V I V + ND  P I    I  V   +  A I E+    T  VAL  V+D+D+G    V C ++ +        R +S   N    KY ++T   LD E    Y +++   D G+P L +   +KV V D NDNAPV       V  +E    G  V  + A D D G N ELTYSI+  S + +   EIN +TG+++   ++DREQ    L  +  ++  +DKG P         V V D NDN P+F      F V EN   L  +G + V+D D+    RV L   P+  +  F++  ++  Y + +T S D EKE  YSF++ A DG G    ++   +T+ + DEND+AP    P  S++ K++    S E  + +V   D+D    +N +  F++V  +  GLF+I  ++G+IT ++  +   +G H + V  +D G PP++++ L+ I ++ +
Sbjct:   92 GDIYTTENSIDRESLKDCRNL----FEGDPCFLEFEVSI-TDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSL--HQP-SSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTA-VALVEVSDRDEGENAVVTCVVAGD---VPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGS-VPEGLFEINPNTGEVRVMSQLDREQ----LDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPD--NGKFMI--QNGTYTILSTISFDREKESTYSFRLKAVDG-GDPPRSSYVGITINVLDENDNAPYVTKPANSSY-KFLDPRTSPETHVESVEAEDIDI--GLNSELDFNIVGGNPHGLFRI-SSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNET 800          

HSP 2 Score: 130.183 bits (326), Expect = 5.888e-30
Identity = 140/536 (26.12%), Postives = 236/536 (44.03%), Query Frame = 3
Query:  507 RLFHLHSN-GKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTI--------NIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGS-----LNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHIT---AKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFEN 2063
            RL  +  N G ++   ++DREE+ I ++     KD    S S    S ++         I ++D NDNAP  R     +        NI E  PVG+  +L   +D D  + ++    +  +   P  F L     TG+       LQ    LD E+  +Y   ++A+D GNP  +    + + V D+NDN P  S T Y +++ E       +L + A D D   NA++ + I             F I  N+G + +  +LD E+ + ++F V  ++        TATV+++V++ ND  P+  +     N  +  ++EN    +  V + TV D D+G   +V   +  +   F I N         Y+I + ++ DRE +  Y  +++  D GDPP  +   I + V DENDNAP +    N S     P  +  TH+    A+DID G N EL ++I   +        I+S     +  + + +E   + +    +++ V DKG PP+ +     + V +   N    E 
Sbjct:  314 RLLSIDRNTGIIFVKGSVDREEISI-LKFYVQAKDNGPQSKS----SKAL-------VTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGD--VP--FQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSV----PEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFML-----NGYSFSVQENMPPLSP-VGMVTVNDHDEGENARVQLSVEPDNGKFMIQN-------GTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGN--PHGLFRISS-----EGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNETIGNVSHVEG 809          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 290.812 bits (743), Expect = 2.163e-81
Identity = 231/735 (31.43%), Postives = 373/735 (50.75%), Query Frame = 3
Query:  531 GKLYSAQ-TIDREEL--CINVESCCHKKDPCDISLSIAVKSDSIEE--PRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEI---AIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSN----KYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIK-LENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHK-GLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNS 2687
            G +Y+ + +IDRE L  C N+     + DPC +   +++ +D ++   PR  E RI+I D NDN P+F +   T++I E+  VG+LF++P+ATD DS    I DY L        +FSL+  + +     QLI    LDRE R  Y+  +  +D G+PP+    ++ I + D NDN P   +++Y  +  E+      +L++ A D D   N ++ + +   QP      +   I+ N+G I++K  +D E     +FYV+  +N     ++ A V I V + ND  P I    I  V   +  A I E+    T  VAL  V+D+D+G    V C ++ +        R +S   N    KY ++T   LD E    Y +++   D G+P L +   +KV V D NDNAPV       V  +E    G  V  + A D D G N ELTYSI+  S + +   EIN +TG+++   ++DREQ    L  +  ++  +DKG P         V V D NDN P+F      F V EN   L  +G + V+D D+    RV L   P+  +  F++  ++  Y + +T S D EKE  YSF++ A DG G    ++   +T+ + DEND+AP    P  S++ K++    S E  + +V   D+D    +N +  F++V  +  GLF+I  ++G+IT ++  +   +G H + V  +D G PP++++ L+ I ++ +
Sbjct:  100 GDIYTTENSIDRESLKDCRNL----FEGDPCFLEFEVSI-TDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSL--HQP-SSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTA-VALVEVSDRDEGENAVVTCVVAGD---VPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGS-VPEGLFEINPNTGEVRVMSQLDREQ----LDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPD--NGKFMI--QNGTYTILSTISFDREKESTYSFRLKAVDG-GDPPRSSYVGITINVLDENDNAPYVTKPANSSY-KFLDPRTSPETHVESVEAEDIDI--GLNSELDFNIVGGNPHGLFRI-SSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNET 808          

HSP 2 Score: 130.183 bits (326), Expect = 5.749e-30
Identity = 140/536 (26.12%), Postives = 236/536 (44.03%), Query Frame = 3
Query:  507 RLFHLHSN-GKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTI--------NIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGS-----LNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHIT---AKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFEN 2063
            RL  +  N G ++   ++DREE+ I ++     KD    S S    S ++         I ++D NDNAP  R     +        NI E  PVG+  +L   +D D  + ++    +  +   P  F L     TG+       LQ    LD E+  +Y   ++A+D GNP  +    + + V D+NDN P  S T Y +++ E       +L + A D D   NA++ + I             F I  N+G + +  +LD E+ + ++F V  ++        TATV+++V++ ND  P+  +     N  +  ++EN    +  V + TV D D+G   +V   +  +   F I N         Y+I + ++ DRE +  Y  +++  D GDPP  +   I + V DENDNAP +    N S     P  +  TH+    A+DID G N EL ++I   +        I+S     +  + + +E   + +    +++ V DKG PP+ +     + V +   N    E 
Sbjct:  322 RLLSIDRNTGIIFVKGSVDREEISI-LKFYVQAKDNGPQSKS----SKAL-------VTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGD--VP--FQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSV----PEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFML-----NGYSFSVQENMPPLSP-VGMVTVNDHDEGENARVQLSVEPDNGKFMIQN-------GTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGN--PHGLFRISS-----EGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNETIGNVSHVEG 817          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 290.041 bits (741), Expect = 2.284e-81
Identity = 231/735 (31.43%), Postives = 373/735 (50.75%), Query Frame = 3
Query:  531 GKLYSAQ-TIDREEL--CINVESCCHKKDPCDISLSIAVKSDSIEE--PRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEI---AIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSN----KYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIK-LENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHK-GLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNS 2687
            G +Y+ + +IDRE L  C N+     + DPC +   +++ +D ++   PR  E RI+I D NDN P+F +   T++I E+  VG+LF++P+ATD DS    I DY L        +FSL+  + +     QLI    LDRE R  Y+  +  +D G+PP+    ++ I + D NDN P   +++Y  +  E+      +L++ A D D   N ++ + +   QP      +   I+ N+G I++K  +D E     +FYV+  +N     ++ A V I V + ND  P I    I  V   +  A I E+    T  VAL  V+D+D+G    V C ++ +        R +S   N    KY ++T   LD E    Y +++   D G+P L +   +KV V D NDNAPV       V  +E    G  V  + A D D G N ELTYSI+  S + +   EIN +TG+++   ++DREQ    L  +  ++  +DKG P         V V D NDN P+F      F V EN   L  +G + V+D D+    RV L   P+  +  F++  ++  Y + +T S D EKE  YSF++ A DG G    ++   +T+ + DEND+AP    P  S++ K++    S E  + +V   D+D    +N +  F++V  +  GLF+I  ++G+IT ++  +   +G H + V  +D G PP++++ L+ I ++ +
Sbjct:   98 GDIYTTENSIDRESLKDCRNL----FEGDPCFLEFEVSI-TDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSL--HQP-SSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTA-VALVEVSDRDEGENAVVTCVVAGD---VPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGS-VPEGLFEINPNTGEVRVMSQLDREQ----LDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPD--NGKFMI--QNGTYTILSTISFDREKESTYSFRLKAVDG-GDPPRSSYVGITINVLDENDNAPYVTKPANSSY-KFLDPRTSPETHVESVEAEDIDI--GLNSELDFNIVGGNPHGLFRI-SSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNET 806          

HSP 2 Score: 129.798 bits (325), Expect = 6.823e-30
Identity = 140/536 (26.12%), Postives = 236/536 (44.03%), Query Frame = 3
Query:  507 RLFHLHSN-GKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTI--------NIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLN-----LQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHIT---AKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFEN 2063
            RL  +  N G ++   ++DREE+ I ++     KD    S S    S ++         I ++D NDNAP  R     +        NI E  PVG+  +L   +D D  + ++    +  +   P  F L     TG+       LQ    LD E+  +Y   ++A+D GNP  +    + + V D+NDN P  S T Y +++ E       +L + A D D   NA++ + I             F I  N+G + +  +LD E+ + ++F V  ++        TATV+++V++ ND  P+  +     N  +  ++EN    +  V + TV D D+G   +V   +  +   F I N         Y+I + ++ DRE +  Y  +++  D GDPP  +   I + V DENDNAP +    N S     P  +  TH+    A+DID G N EL ++I   +        I+S     +  + + +E   + +    +++ V DKG PP+ +     + V +   N    E 
Sbjct:  320 RLLSIDRNTGIIFVKGSVDREEISI-LKFYVQAKDNGPQSKS----SKAL-------VTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGD--VP--FQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSV----PEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFML-----NGYSFSVQENMPPLSP-VGMVTVNDHDEGENARVQLSVEPDNGKFMIQN-------GTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGN--PHGLFRISS-----EGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNETIGNVSHVEG 815          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: ENSXETT00000047804.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 263.077 bits (671), Expect = 4.047e-72
Identity = 250/801 (31.21%), Postives = 381/801 (47.57%), Query Frame = 3
Query:  303 IIKMKIVFG----MILFSFGLFRKCKSEPCDIKVTDNTKENSFISNL-NSFDVYSTP-YTQNKKFNLLSNTKANRLFHLHSN-GKLYS-AQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQ-NRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYV-NENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDRE-QDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHL-PNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLV-NDHKGLFKIDQNKGKITTSRTMSESDMG---KHVITVIARDHGNP 2642
            I++M ++ G     +L +  +F     E   I V +   EN  I NL    ++   P  +   +F L+  T    L  +  N G++++ +  IDRE+LC    S    ++ C   + +AV  D +   R  + R  IEDINDN+P F +    I+I E+  V S +S+P A D D     I+ Y+L +      +F L+    P G    QLI  Q LDRE++  Y   +   D GNP ++   ++ + V DVNDN P   + +  +   E       + ++ A D D   NAK+ F   N+  +   A ++F I+ N+G I +KE LD E    H+  V  S+  G    + ATV I + ++ND  P I   Y+ N  N    + E     TK +AL TVTDKD  L G+V C   +     ++  R   +  N++ + T   LD E+   Y +++   D G PPL   A++ + +KDENDNAPV  L    +S  EN P GT +T I+A D D G+N EL+Y +  ++        ++  TG L    K+DRE QD  T   F VI    D G P   +     +SV D+NDN+P F +    F V EN     T+G I V D D  +N+ + +SLV+   N +  P     R N  +       D E++ +Y+F++ A D  G    ++T  VT+ +ED ND+ P F+ P  SN   Y     S     +   V  +D+   +N    + ++  + +GLF I +  G IT    +   D G   K VI V   D G P
Sbjct:   18 ILEMDLLSGTYLLAVLIACIVFESGAQEKNYI-VREELPENVLIGNLLKDLNLTLDPDLSTPLQFKLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLC----SGIFTENKCFYEVEVAVLPDEVF--RLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQ---NVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQ--ITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASD--GSSTPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTK-IALITVTDKDADLNGKVTCFTDH-----DVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNA---PTIFNLDRRTGILTAVRKLDREKQDRYT---FTVI--AKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNARDNFIIDPLTGVIRPNITF-------DREQQGSYTFQVKALD-KGSPQKSSTVKVTIFVEDVNDNKPVFVIP--SNNYSYDLVQTSTSPGSVVARVYAIDNDTGINADLRYSIIGGNSRGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKV--NDSGKP 778          

HSP 2 Score: 163.696 bits (413), Expect = 3.331e-40
Identity = 143/521 (27.45%), Postives = 250/521 (47.98%), Query Frame = 3
Query: 1206 FRIEENSGNIYLKE-KLDYER------DEQHRFY-VEVSNNAGHVDTATATVLIQVI--NLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSIS-ESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSI------QFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFER-DNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI----DNSKPFS 2699
             R+EEN+G I+    ++D E+       E   FY VEV   A   D     V I+ +  ++ND +P      +N +     I EN    +++ ++ +  D D G+ G  H  L   +NVF +   ++        +  + +LDRE K  Y ++++ ED G+P   + A+++V V D NDN PV K ++  V++ E+  +GT VT + A D D G N ++ +    + ++L K++  I+++TG +  +  +DRE+         + +  SD    P  SR    +++ D NDN P  +   I        Q++E       +  I V DKD +   +V+      +   PF L    DN++ L T   LD+E  + Y+ KI+ASD +G      +A + + I+DEND+AP F  P        +S+ E+         +   D+    N + S+ L  +   +F +D+  G +T  R +      ++  TVIA+D+GNP  +++  +T+ +    DNS  F+
Sbjct:   93 IRVEENTGEIFTTSNRIDREKLCSGIFTENKCFYEVEV---AVLPDEVFRLVKIRFLIEDINDNSPLFPSTVINIS-----IPENTAVNSRY-SVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESP----YHKLTVLASDGSSTP--SRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCF---TDHDVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASD-SGKPPLNQSAMLLIKIKDENDNAPVFTLPMIG-----LSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFT 589          

HSP 3 Score: 141.739 bits (356), Expect = 2.342e-33
Identity = 140/510 (27.45%), Postives = 218/510 (42.75%), Query Frame = 3
Query: 1233 IYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI-------KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKY-YLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVID---NSKPFSIGQSNENNRD 2729
            + +++ LD E+ + +   ++V +      ++TA + + V ++ND  P        E +    I E+    T    L   TD D G   ++H    N   +  +  R  +I +N   I  +  LDRE   Y++L +   D    P RA   I +   D NDN P I        +   V + E  P+ T +  IT  D D   NG++T           K +  N     L+T   +D E   E    + + +  SD G+PP        + +KDENDNAP F    I     EN      L +I   D D      +S +  PN  +    +F  D +   L   R LD EK+  Y+F ++A D  G  S     TVT+ + D+ND++PSF    Y NF  Y+  +      +  ++V D DS +  N   +  LVN     F ID   G I  + T      G +   V A D G+P K S++ +TI ++   ++KP  +  SN  + D
Sbjct:  219 LIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRP-----VFKEKDIEVNIPEDAAVGTSVTQLHA-TDADLGSNAKIHFYFGNQ--ITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTPSRATVTINIT--DINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFRLKPVFDNQFL--LETAAPLDYESTRE----YAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPT----IFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDN-GNPSLQTNTTVTLSVLDQNDNSPSFTHNEY-NF--YVPENLPMYGTVGLITVTDADSGE--NAVVTLSLVNARDN-FIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYD 701          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: ENSXETT00000047798.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 263.077 bits (671), Expect = 4.449e-72
Identity = 247/794 (31.11%), Postives = 376/794 (47.36%), Query Frame = 3
Query:  312 MKIVFGMILFSFGLFRKCKSEPCDIKVTDNTKENSFISNL-NSFDVYSTP-YTQNKKFNLLSNTKANRLFHLHSN-GKLYS-AQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQ-NRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYV-NENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDRE-QDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHL-PNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLV-NDHKGLFKIDQNKGKITTSRTMSESDMG---KHVITVIARDHGNP 2642
            + ++   I+F  G   K      +  V +   EN  I NL    ++   P  +   +F L+  T    L  +  N G++++ +  IDRE+LC    S    ++ C   + +AV  D +   R  + R  IEDINDN+P F +    I+I E+  V S +S+P A D D     I+ Y+L +      +F L+    P G    QLI  Q LDRE++  Y   +   D GNP ++   ++ + V DVNDN P   + +  +   E       + ++ A D D   NAK+ F   N+  +   A ++F I+ N+G I +KE LD E    H+  V  S+  G    + ATV I + ++ND  P I   Y+ N  N    + E     TK +AL TVTDKD  L G+V C   +     ++  R   +  N++ + T   LD E+   Y +++   D G PPL   A++ + +KDENDNAPV  L    +S  EN P GT +T I+A D D G+N EL+Y +  ++        ++  TG L    K+DRE QD  T   F VI    D G P   +     +SV D+NDN+P F +    F V EN     T+G I V D D  +N+ + +SLV+   N +  P     R N  +       D E++ +Y+F++ A D  G    ++T  VT+ +ED ND+ P F+ P  SN   Y     S     +   V  +D+   +N    + ++  + +GLF I +  G IT    +   D G   K VI V   D G P
Sbjct:   10 LAVLIACIVFESGAQEK------NYIVREELPENVLIGNLLKDLNLTLDPDLSTPLQFKLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLC----SGIFTENKCFYEVEVAVLPDEVF--RLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQ---NVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQ--ITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASD--GSSTPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTK-IALITVTDKDADLNGKVTCFTDH-----DVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNA---PTIFNLDRRTGILTAVRKLDREKQDRYT---FTVI--AKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNARDNFIIDPLTGVIRPNITF-------DREQQGSYTFQVKALD-KGSPQKSSTVKVTIFVEDVNDNKPVFVIP--SNNYSYDLVQTSTSPGSVVARVYAIDNDTGINADLRYSIIGGNSRGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKV--NDSGKP 758          

HSP 2 Score: 163.696 bits (413), Expect = 3.017e-40
Identity = 143/521 (27.45%), Postives = 250/521 (47.98%), Query Frame = 3
Query: 1206 FRIEENSGNIYLKE-KLDYER------DEQHRFY-VEVSNNAGHVDTATATVLIQVI--NLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSIS-ESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSI------QFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFER-DNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI----DNSKPFS 2699
             R+EEN+G I+    ++D E+       E   FY VEV   A   D     V I+ +  ++ND +P      +N +     I EN    +++ ++ +  D D G+ G  H  L   +NVF +   ++        +  + +LDRE K  Y ++++ ED G+P   + A+++V V D NDN PV K ++  V++ E+  +GT VT + A D D G N ++ +    + ++L K++  I+++TG +  +  +DRE+         + +  SD    P  SR    +++ D NDN P  +   I        Q++E       +  I V DKD +   +V+      +   PF L    DN++ L T   LD+E  + Y+ KI+ASD +G      +A + + I+DEND+AP F  P        +S+ E+         +   D+    N + S+ L  +   +F +D+  G +T  R +      ++  TVIA+D+GNP  +++  +T+ +    DNS  F+
Sbjct:   73 IRVEENTGEIFTTSNRIDREKLCSGIFTENKCFYEVEV---AVLPDEVFRLVKIRFLIEDINDNSPLFPSTVINIS-----IPENTAVNSRY-SVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESP----YHKLTVLASDGSSTP--SRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCF---TDHDVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASD-SGKPPLNQSAMLLIKIKDENDNAPVFTLPMIG-----LSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFT 569          

HSP 3 Score: 141.739 bits (356), Expect = 2.193e-33
Identity = 140/510 (27.45%), Postives = 218/510 (42.75%), Query Frame = 3
Query: 1233 IYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI-------KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKY-YLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVID---NSKPFSIGQSNENNRD 2729
            + +++ LD E+ + +   ++V +      ++TA + + V ++ND  P        E +    I E+    T    L   TD D G   ++H    N   +  +  R  +I +N   I  +  LDRE   Y++L +   D    P RA   I +   D NDN P I        +   V + E  P+ T +  IT  D D   NG++T           K +  N     L+T   +D E   E    + + +  SD G+PP        + +KDENDNAP F    I     EN      L +I   D D      +S +  PN  +    +F  D +   L   R LD EK+  Y+F ++A D  G  S     TVT+ + D+ND++PSF    Y NF  Y+  +      +  ++V D DS +  N   +  LVN     F ID   G I  + T      G +   V A D G+P K S++ +TI ++   ++KP  +  SN  + D
Sbjct:  199 LIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRP-----VFKEKDIEVNIPEDAAVGTSVTQLHA-TDADLGSNAKIHFYFGNQ--ITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTPSRATVTINIT--DINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFRLKPVFDNQFL--LETAAPLDYESTRE----YAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPT----IFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDN-GNPSLQTNTTVTLSVLDQNDNSPSFTHNEY-NF--YVPENLPMYGTVGLITVTDADSGE--NAVVTLSLVNARDN-FIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYD 681          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: ENSXETT00000047801.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 263.077 bits (671), Expect = 5.433e-72
Identity = 250/801 (31.21%), Postives = 381/801 (47.57%), Query Frame = 3
Query:  303 IIKMKIVFG----MILFSFGLFRKCKSEPCDIKVTDNTKENSFISNL-NSFDVYSTP-YTQNKKFNLLSNTKANRLFHLHSN-GKLYS-AQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQ-NRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYV-NENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDRE-QDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHL-PNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLV-NDHKGLFKIDQNKGKITTSRTMSESDMG---KHVITVIARDHGNP 2642
            I++M ++ G     +L +  +F     E   I V +   EN  I NL    ++   P  +   +F L+  T    L  +  N G++++ +  IDRE+LC    S    ++ C   + +AV  D +   R  + R  IEDINDN+P F +    I+I E+  V S +S+P A D D     I+ Y+L +      +F L+    P G    QLI  Q LDRE++  Y   +   D GNP ++   ++ + V DVNDN P   + +  +   E       + ++ A D D   NAK+ F   N+  +   A ++F I+ N+G I +KE LD E    H+  V  S+  G    + ATV I + ++ND  P I   Y+ N  N    + E     TK +AL TVTDKD  L G+V C   +     ++  R   +  N++ + T   LD E+   Y +++   D G PPL   A++ + +KDENDNAPV  L    +S  EN P GT +T I+A D D G+N EL+Y +  ++        ++  TG L    K+DRE QD  T   F VI    D G P   +     +SV D+NDN+P F +    F V EN     T+G I V D D  +N+ + +SLV+   N +  P     R N  +       D E++ +Y+F++ A D  G    ++T  VT+ +ED ND+ P F+ P  SN   Y     S     +   V  +D+   +N    + ++  + +GLF I +  G IT    +   D G   K VI V   D G P
Sbjct:   18 ILEMDLLSGTYLLAVLIACIVFESGAQEKNYI-VREELPENVLIGNLLKDLNLTLDPDLSTPLQFKLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLC----SGIFTENKCFYEVEVAVLPDEVF--RLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQ---NVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQ--ITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASD--GSSTPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTK-IALITVTDKDADLNGKVTCFTDH-----DVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNA---PTIFNLDRRTGILTAVRKLDREKQDRYT---FTVI--AKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNARDNFIIDPLTGVIRPNITF-------DREQQGSYTFQVKALD-KGSPQKSSTVKVTIFVEDVNDNKPVFVIP--SNNYSYDLVQTSTSPGSVVARVYAIDNDTGINADLRYSIIGGNSRGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKV--NDSGKP 778          

HSP 2 Score: 163.696 bits (413), Expect = 3.524e-40
Identity = 143/521 (27.45%), Postives = 250/521 (47.98%), Query Frame = 3
Query: 1206 FRIEENSGNIYLKE-KLDYER------DEQHRFY-VEVSNNAGHVDTATATVLIQVI--NLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSIS-ESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSI------QFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFER-DNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI----DNSKPFS 2699
             R+EEN+G I+    ++D E+       E   FY VEV   A   D     V I+ +  ++ND +P      +N +     I EN    +++ ++ +  D D G+ G  H  L   +NVF +   ++        +  + +LDRE K  Y ++++ ED G+P   + A+++V V D NDN PV K ++  V++ E+  +GT VT + A D D G N ++ +    + ++L K++  I+++TG +  +  +DRE+         + +  SD    P  SR    +++ D NDN P  +   I        Q++E       +  I V DKD +   +V+      +   PF L    DN++ L T   LD+E  + Y+ KI+ASD +G      +A + + I+DEND+AP F  P        +S+ E+         +   D+    N + S+ L  +   +F +D+  G +T  R +      ++  TVIA+D+GNP  +++  +T+ +    DNS  F+
Sbjct:   93 IRVEENTGEIFTTSNRIDREKLCSGIFTENKCFYEVEV---AVLPDEVFRLVKIRFLIEDINDNSPLFPSTVINIS-----IPENTAVNSRY-SVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESP----YHKLTVLASDGSSTP--SRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCF---TDHDVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASD-SGKPPLNQSAMLLIKIKDENDNAPVFTLPMIG-----LSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFT 589          

HSP 3 Score: 141.354 bits (355), Expect = 2.726e-33
Identity = 140/510 (27.45%), Postives = 218/510 (42.75%), Query Frame = 3
Query: 1233 IYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI-------KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKY-YLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVID---NSKPFSIGQSNENNRD 2729
            + +++ LD E+ + +   ++V +      ++TA + + V ++ND  P        E +    I E+    T    L   TD D G   ++H    N   +  +  R  +I +N   I  +  LDRE   Y++L +   D    P RA   I +   D NDN P I        +   V + E  P+ T +  IT  D D   NG++T           K +  N     L+T   +D E   E    + + +  SD G+PP        + +KDENDNAP F    I     EN      L +I   D D      +S +  PN  +    +F  D +   L   R LD EK+  Y+F ++A D  G  S     TVT+ + D+ND++PSF    Y NF  Y+  +      +  ++V D DS +  N   +  LVN     F ID   G I  + T      G +   V A D G+P K S++ +TI ++   ++KP  +  SN  + D
Sbjct:  219 LIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRP-----VFKEKDIEVNIPEDAAVGTSVTQLHA-TDADLGSNAKIHFYFGNQ--ITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTPSRATVTINIT--DINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFRLKPVFDNQFL--LETAAPLDYESTRE----YAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPT----IFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDN-GNPSLQTNTTVTLSVLDQNDNSPSFTHNEY-NF--YVPENLPMYGTVGLITVTDADSGE--NAVVTLSLVNARDN-FIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYD 701          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: ENSXETT00000027070.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:19099783:19110965:-1 gene:ENSXETG00000013163.1 transcript:ENSXETT00000027070.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 257.299 bits (656), Expect = 1.179e-70
Identity = 238/814 (29.24%), Postives = 387/814 (47.54%), Query Frame = 3
Query:  297 EKIIKMKIVFGMILFSFGLFRKCKSEPCDIK--VTDNTKENSFISNLNSFDVYSTPYTQNKKFNLLSNTKANRL-FHLHSNGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTF-ECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI-KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTK-----KYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSS-PFVLFERDNKY--YLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPN----YSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVN-DHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI 2678
            ++ I+ +++F    FSF     C+S  C ++  + +  +    I N+ +    S     ++KF+++S +K   L  HL  NG LY A  IDRE LC   ++C    +              +E P  F    ++I+D+NDN+P F    F I+I E   VG+ F+L  A D D    SI+ YKL  N  F     LE+    G    +L+  + LDREK+     +L A D G P KTG  +I I V D+NDN P  ++  Y +   E+      ++ + A D DE  NA++ + + N+ P   +A + F I   +G++ +  KLDYE    +   VE  +  G V  +   +LIQV ++ND  P+I I   ++      I   + +    +AL  + D D G  G+V  ++S +      H   SS   N Y + T + LDRE    Y + ++ EDKG P L     I++++ D NDNAPV  K++    + EN P G     + A D D  +NG++ Y I   +D+ +      Y+ IN+ +G L  +    R  D E L+ F   +   DKG P   + K   + + D NDNAP FE       + EN  +  +   +   D D N   +V  + L + +   P   +   N     L   RS D+E  + +  +++A D +G  S +A ATV + I D+ND+AP  ++P+     ++  ++I +  +    +  V   D DS    N   S+HL+         I QN G+I  +R + E+D  +  I V+ +D+G P   S++ + +V+
Sbjct:   11 KRTIRWQVIF--CFFSF----LCESVICQLQYSIYEEQRLGYVIGNIANDLGVSAEELSSRKFHIVSRSKKQYLNVHLE-NGDLYVADRIDREALCGMQQNCFLNIEAV------------MESPLHFYTINVEIQDVNDNSPSFSKSIFEISISELAVVGTHFALGSAKDPDLGNNSIQSYKLSANDYFG---MLEKVNTDGRKYPELVLEKTLDREKKNSSVLILSAFDGGTPSKTGTSLIRIVVTDINDNYPLFNKDTYRVTVSENVPIGFLVIDLHATDADEGSNAEITY-LFNDIP--ENAQEVFAINPENGSVQITGKLDYEVATNYEMTVEAKDGGGLV--SYCKLLIQVSDVNDNAPDILITSFSD------IIPEDSRVGTVIALVNLDDLDSGENGEVVGQISES---LPFHLISSS--GNYYKLVTSMDLDREKTSEYNITIKAEDKGSPQLTNSKTIRLILTDVNDNAPVFDKMDYVAYIQENNPSGNSFYRVHATDPDINENGKVVYMI--LTDIIEDIPISSYVSINTVSGVLYAQ----RSFDYEKLREF--YIQAEDKGSPQLTNNKTIRLILTDVNDNAPVFEKMDYVAYIQENNPSGSSFFRVHATDSDINENGKVVYMILTDIIEDMPLSSYISINTVSGVLYAQRSFDYESLREFYIQVMAKD-SGSPSRSANATVKICITDQNDNAPKILYPSQDSEAASVFEFIPHFSTKGYLVTKVVAVDADS--GHNAWLSYHLLQVPDPSFLIIGQNTGEIRITRDLQETDALRQRIVVMVKDNGYPMLSSTVTLNLVV 775          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: vapa (VAMP associated protein A [Source:Xenbase;Acc:XB-GENE-990155])

HSP 1 Score: 244.202 bits (622), Expect = 7.651e-66
Identity = 216/729 (29.63%), Postives = 353/729 (48.42%), Query Frame = 3
Query:  525 SNGKLYSAQT-IDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLE-QNRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYV-NENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVN-DHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNP-PKESSILITIVIDNS 2687
            S G++++  T IDRE+LC    S    ++ C   L + +  +     R  + +I ++D NDNAP F +    I+I E+  + S F +P A D D+    ++ Y+L        +F L+    P G    QLI  Q LDRE++  Y   +   D G P K+   ++ + V DVNDN P   ++   +   E+      ++++ A D D   NA++  K +    V     + F +   +G I ++  LD E    H+  V  ++  G    A ATV I V ++ND  P I + Y+ +  N   ++ E +   TK +AL TV+DKD  +  +V C +       E+     ++  N+Y + T   LD E    +  ++   D G P L   AL++V ++DENDN P+       +SV EN   G  +T ++A D D GKN ++ Y +  ++     + +++  TG L      DRE+     + F   +T  D G PP  S+ A  V+V DENDN+P+F +   QF V+EN     T+G I   D D      V+L  L +  +  FVL        + +  S D E++ +Y+F + A DG G    ++TA VT+ I D ND++P  I P  +   K +    SA    +   V  +D+   MN +  + +V+ ++KGLF+ID   G IT     S +D+G H + V   D G P P  + +L+ + ++ +
Sbjct:   81 STGEIFTTSTRIDREKLCAG--SSNSDENECFFELEVVILPNDFF--RLIKIKIIVKDTNDNAPMFPSTVINISIPENTLINSRFPIPSAVDPDTGFNGVQHYELLNGQ---SVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNKPVFKESQVEVHIPENAPIGTSVVQLHATDADIGSNAEI--KYIFGAQVTSATKRLFALNNTTGLITVQRPLDREETAVHKLTVLATD--GSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPINTK-IALITVSDKDTDVNSKVICFIER-----EVPFHLKAVYDNQYLLETSSLLDYEGIKEFSFKIVAADTGKPSLNQTALVRVELEDENDNPPIFSQPVIELSVSENNRRGLYLTTVSASDEDSGKNSDIVYQLGPNA----SFFDLDRKTGVLTASRVFDREEQ----ERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITATDSDAGENKAVTLSILNDNEN--FVLDPYSG--LIKSNVSFDREQQSSYTFDVKAVDG-GQPPRSSTAKVTINIMDANDNSPVVISPPSNTSFKLVPL--SAIPGSVVAEVFAVDTDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPSAADVGLHRLVVNISDLGYPKPLHTLVLVFLYVNET 777          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 265.003 bits (676), Expect = 8.516e-73
Identity = 237/761 (31.14%), Postives = 366/761 (48.09%), Query Frame = 3
Query:  396 DNTKENSFISNLNSFDVYSTPYTQNKKFNLLSNTKANRLFHLH-SNGKLYS-AQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQ-NRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDY-VNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLE-NNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFP--NYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDH-KGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNP 2642
            +N      + +LN   +     T   +F L+  T    L  +    G++++    IDRE+LC  +         C   + +AV  D I   R  + R  IEDINDNAP F T    I+I E+  + S +SLP A D D     +++Y+L ++     IF L+    P G    QLI  ++LDRE++  Y   +   D G P ++   ++ ++V D NDN P   +    +   E+      + ++ A D D  +NA++ F   N   V   A + F +   +G I +KE LD E    H+  V  ++  G    A ATVL+ V ++ND  P I I Y VN  N    + EN    TK +AL TV DKD    G+V C   +     E+  R   + SN++ + T   LD E+   Y +++   D G PPL   +++ + VKDENDNAPV      ++SV EN   G  +T I+A D D G+N E++Y +   +        ++  TG L    K+DRE+     + +   +   D G PP +S     V+V D+NDN+P F +    F V E+     T+G I V D D  +NS + +S++ + ++    F +  +      N   S D E++++Y+F + A DG G  S ++TA VT+ + D ND+ P FI P  NYS F   +       +    V++   D    MN +  + +V  + KGLF I+Q  G IT       SD+G H + V A D G P
Sbjct:   36 ENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGIVLDAR----CFYEVEVAVLPDEIF--RLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQ---NIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNL--VSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATD--GGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTK-IALITVMDKDSEHNGRVTCFTDH-----EVPFRLRPVFSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDA---PPEFNLDQRTGILTAVKKLDREKQ----EKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILDVNDQ----FTIDPQSGVIRPNI--SFDRERQESYTFYVKAEDG-GRVSRSSTARVTINVVDVNDNKPIFIDPPSNYS-FEWVLPSTNPGTVVFKVVAI---DDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQP 759          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 264.233 bits (674), Expect = 3.258e-72
Identity = 238/764 (31.15%), Postives = 370/764 (48.43%), Query Frame = 3
Query:  387 KVTDNTKENSFISNLNSFDVYSTPYTQNKKFNLLSNTKANRLFHLH-SNGKLYS-AQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQ-NRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDY-VNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLE-NNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFP--NYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDH-KGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNP 2642
            ++ +N      + +LN   +     T   +F L+  T    L  +    G++++    IDRE+LC  +         C   + +AV  D I   R  + R  IEDINDNAP F T    I+I E+  + S +SLP A D D     +++Y+L ++     IF L+    P G    QLI  ++LDRE++  Y   +   D G P ++   ++ ++V D NDN P   +    +   E+      + ++ A D D  +NA++ F   N   V   A + F +   +G I +KE LD E    H+  V  ++  G    A ATVL+ V ++ND  P I I Y VN  N    + EN    TK +AL TV DKD    G+V C  +++E  F    R   + SN++ + T   LD E+   Y +++   D G PPL   +++ + VKDENDNAPV      ++SV EN   G  +T I+A D D G+N E++Y +   +        ++  TG L    K+DRE+     + +   +   D G PP +S     V+V D+NDN+P F +    F V E+     T+G I V D D  +NS + +S++    +++  F +  +      N   S D E++++Y+F + A DG G  S ++TA VT+ + D ND+ P FI P  NYS F   +       +    V++   D    MN +  + +V  + KGLF I+Q  G IT       SD+G H + V A D G P
Sbjct:   33 EMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGIVLDAR----CFYEVEVAVLPDEIF--RLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQ---NIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNL--VSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATD--GGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTK-IALITVMDKDSEHNGRVTC-FTDHEVPF----RLRPVFSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDA---PPEFNLDQRTGILTAVKKLDREKQ----EKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSIL----DVNDQFTIDPQSGVIRPNI--SFDRERQESYTFYVKAEDG-GRVSRSSTARVTINVVDVNDNKPIFIDPPSNYS-FEWVLPSTNPGTVVFKVVAI---DDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQP 759          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 265.388 bits (677), Expect = 4.543e-72
Identity = 237/764 (31.02%), Postives = 370/764 (48.43%), Query Frame = 3
Query:  387 KVTDNTKENSFISNLNSFDVYSTPYTQNKKFNLLSNTKANRLFHLH-SNGKLYS-AQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQ-NRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDY-VNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLE-NNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFP--NYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDH-KGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNP 2642
            ++ +N      + +LN   +     T   +F L+  T    L  +    G++++    IDRE+LC  +         C   + +AV  D I   R  + R  IEDINDNAP F T    I+I E+  + S +SLP A D D     +++Y+L ++     IF L+    P G    QLI  ++LDRE++  Y   +   D G P ++   ++ ++V D NDN P   +    +   E+      + ++ A D D  +NA++ F   N   V   A + F +   +G I +KE LD E    H+  V  ++  G    A ATVL+ V ++ND  P I I Y VN  N    + EN    TK +AL TV DKD    G+V C  +++E  F +      + SN++ + T   LD E+   Y +++   D G PPL   +++ + VKDENDNAPV      ++SV EN   G  +T I+A D D G+N E++Y +   +        ++  TG L    K+DRE+     + +   +   D G PP +S     V+V D+NDN+P F +    F V E+     T+G I V D D  +NS + +S++ + ++    F +  +      N   S D E++++Y+F + A DG G  S ++TA VT+ + D ND+ P FI P  NYS F   +       +    V++   D    MN +  + +V  + KGLF I+Q  G IT       SD+G H + V A D G P
Sbjct:   33 EMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGIVLDAR----CFYEVEVAVLPDEIF--RLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQN---IFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNL--VSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATD--GGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTK-IALITVMDKDSEHNGRVTC-FTDHEVPFRLR----PVFSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDA---PPEFNLDQRTGILTAVKKLDREKQ----EKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILDVNDQ----FTIDPQSGVIRPNI--SFDRERQESYTFYVKAEDG-GRVSRSSTARVTINVVDVNDNKPIFIDPPSNYS-FEWVLPSTNPGTVVFKVVAI---DDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQP 759          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 265.003 bits (676), Expect = 6.274e-72
Identity = 238/764 (31.15%), Postives = 370/764 (48.43%), Query Frame = 3
Query:  387 KVTDNTKENSFISNLNSFDVYSTPYTQNKKFNLLSNTKANRLFHLH-SNGKLYS-AQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQ-NRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDY-VNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLE-NNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFP--NYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDH-KGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNP 2642
            ++ +N      + +LN   +     T   +F L+  T    L  +    G++++    IDRE+LC  +         C   + +AV  D I   R  + R  IEDINDNAP F T    I+I E+  + S +SLP A D D     +++Y+L ++     IF L+    P G    QLI  ++LDRE++  Y   +   D G P ++   ++ ++V D NDN P   +    +   E+      + ++ A D D  +NA++ F   N   V   A + F +   +G I +KE LD E    H+  V  ++  G    A ATVL+ V ++ND  P I I Y VN  N    + EN    TK +AL TV DKD    G+V C  +++E  F    R   + SN++ + T   LD E+   Y +++   D G PPL   +++ + VKDENDNAPV      ++SV EN   G  +T I+A D D G+N E++Y +   +        ++  TG L    K+DRE+     + +   +   D G PP +S     V+V D+NDN+P F +    F V E+     T+G I V D D  +NS + +S++ + ++    F +  +      N   S D E++++Y+F + A DG G  S ++TA VT+ + D ND+ P FI P  NYS F   +       +    V++   D    MN +  + +V  + KGLF I+Q  G IT       SD+G H + V A D G P
Sbjct:   33 EMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGIVLDAR----CFYEVEVAVLPDEIF--RLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQN---IFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNL--VSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATD--GGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTK-IALITVMDKDSEHNGRVTC-FTDHEVPF----RLRPVFSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDA---PPEFNLDQRTGILTAVKKLDREKQ----EKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILDVNDQ----FTIDPQSGVIRPNI--SFDRERQESYTFYVKAEDG-GRVSRSSTARVTINVVDVNDNKPIFIDPPSNYS-FEWVLPSTNPGTVVFKVVAI---DDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQP 759          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 265.003 bits (676), Expect = 6.590e-72
Identity = 238/764 (31.15%), Postives = 370/764 (48.43%), Query Frame = 3
Query:  387 KVTDNTKENSFISNLNSFDVYSTPYTQNKKFNLLSNTKANRLFHLH-SNGKLYS-AQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQ-NRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDY-VNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLE-NNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFP--NYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDH-KGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNP 2642
            ++ +N      + +LN   +     T   +F L+  T    L  +    G++++    IDRE+LC  +         C   + +AV  D I   R  + R  IEDINDNAP F T    I+I E+  + S +SLP A D D     +++Y+L ++     IF L+    P G    QLI  ++LDRE++  Y   +   D G P ++   ++ ++V D NDN P   +    +   E+      + ++ A D D  +NA++ F   N   V   A + F +   +G I +KE LD E    H+  V  ++  G    A ATVL+ V ++ND  P I I Y VN  N    + EN    TK +AL TV DKD    G+V C  +++E  F    R   + SN++ + T   LD E+   Y +++   D G PPL   +++ + VKDENDNAPV      ++SV EN   G  +T I+A D D G+N E++Y +   +        ++  TG L    K+DRE+     + +   +   D G PP +S     V+V D+NDN+P F +    F V E+     T+G I V D D  +NS + +S++ + ++    F +  +      N   S D E++++Y+F + A DG G  S ++TA VT+ + D ND+ P FI P  NYS F   +       +    V++   D    MN +  + +V  + KGLF I+Q  G IT       SD+G H + V A D G P
Sbjct:   33 EMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGIVLDAR----CFYEVEVAVLPDEIF--RLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQN---IFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNL--VSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATD--GGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTK-IALITVMDKDSEHNGRVTC-FTDHEVPF----RLRPVFSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDA---PPEFNLDQRTGILTAVKKLDREKQ----EKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILDVNDQ----FTIDPQSGVIRPNI--SFDRERQESYTFYVKAEDG-GRVSRSSTARVTINVVDVNDNKPIFIDPPSNYS-FEWVLPSTNPGTVVFKVVAI---DDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQP 759          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q6KEQ9|PC11X_PIG (Protocadherin-11 X-linked OS=Sus scrofa OX=9823 GN=PCDH11X PE=2 SV=1)

HSP 1 Score: 274.248 bits (700), Expect = 1.109e-74
Identity = 239/759 (31.49%), Postives = 371/759 (48.88%), Query Frame = 3
Query:  396 DNTKENSFISNLNSFDVYSTPYTQNKKFNLLSNTKANRLFHLH-SNGKLYS-AQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQ-NRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYV-NENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLE-NNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDH-KGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNP 2642
            +N      + +LN   +     T   +F L+  T    L  +    G++++    IDRE+LC  +    H    C   + +AV  D I   R  + R  IEDINDNAP F      I+I E+  + S ++LP   D D+    +++Y L +      IF L+    P G    QLI  ++LDRE++  Y   +   D G P ++   ++ ++V D NDN P   +    +   E+      + ++ A D D  +NAK+ F   N   +   A K F +   +G I +KE LD E    H+  V  S+  G +  A A VL+ V ++ND  P I I Y+ N  N    + EN    TK +AL TVTDKD    G V C  +++E  F +      + SN++ + T   LD E+   Y +++   D G PPL   +++ + VKDENDNAPV      ++SV EN   GT +T I+A D D G+N E+ Y +   +        ++  TG L    K+DRE+  +   SF V+    D G PP ++     V+V D+NDN+P F +    F V EN     T+G I V D D  +NS + +S++    + +  F +  +      N   S D EK+++Y+F + A DG G  S ++TA VT+ + D ND+ P F+ P+ SN++ +     S     +  +V  +D+   MN +  + +V  + KGLF IDQ  G IT       +D+G H + V A+D G P
Sbjct:   36 ENVLIGDLLKDLNLSLIPDRSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGIVVDAH----CFYEVEVAVLPDEIF--RLVKIRFLIEDINDNAPLFPATVINISIPENSAINSRYALPATIDPDTGINGVQNYHLIKGQ---SIFGLDVIETPEGEKMPQLIVQKELDREEKDTYVMKIKVEDGGFPQRSSTAILQVSVADTNDNRPVFKENEIEVSIPENAPVGSSVTQLHATDADIGENAKIHFYFSNL--ISNMAKKLFHLNSTTGLITIKEPLDREESPNHKLLVLASD--GGLTPARAMVLVNVTDINDNIPSIDIRYIINPINGTVVLSENAPLNTK-IALITVTDKDADHNGWVSC-FTDHEVPFRLR----PVFSNQFLLETAAYLDYESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQPFLSLSVPENNSPGTQLTKISAMDADSGRNAEINYLLGFDA---PSEFNLDHRTGILTAVKKLDREKQEK--YSFTVL--AKDNGMPPLMTNATVLVTVLDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGENSAVILSIL----DANDDFTIDPQTGVIQPNI--SFDREKQESYTFYVKAEDG-GRISRSSTAKVTINVVDVNDNKPVFVVPS-SNYS-FELVPPSTNPGTVVFTVVAIDNDTGMNAELRYSMVGGNTKGLFIIDQTSGNITLKEKCVFADLGLHRLVVKAKDLGQP 759          

HSP 2 Score: 157.532 bits (397), Expect = 1.886e-37
Identity = 155/546 (28.39%), Postives = 255/546 (46.70%), Query Frame = 3
Query: 1131 DENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLK-EKLDYER------DEQHRFY-VEVSNNAGHVDTATATVLIQVI--NLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKL-ENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISES-SDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFE-NYSI-----QFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFER-DNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPP--KESSILITIVI--DNSKPFS 2699
            D +    M FK+V     K       RIEE +G I+    ++D E+       + H FY VEV   A   D     V I+ +  ++ND  P      +N +     I EN    +++   AT+ D D G+ G  +  L   +++F +   ++        +  +  LDRE K  Y ++++ ED G P   + A+++V V D NDN PV K  E  VS+ EN P+G+ VT + A D D G+N ++ +  S   S++ KK   +NS TG +  +  +DRE+      +  +++  SD G  P  +R    V+V D NDN P  +  Y I        ++EN      +  I V DKD +    VS      +   PF L     N++ L T   LD+E  + Y+ K+LA+D  G      ++ + + ++DEND+AP F  P  S     +S  E+         +  +D+    N + ++ L  D    F +D   G +T  + +      K+  TV+A+D+G PP    +++L+T++   DNS  F+
Sbjct:   54 DRSLTTPMQFKLV----YKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGIVVDAHCFYEVEV---AVLPDEIFRLVKIRFLIEDINDNAPLFPATVINIS-----IPENSAINSRYALPATI-DPDTGINGVQNYHLIKGQSIFGLDVIETPEGEKMPQLIVQKELDREEKDTYVMKIKVEDGGFPQRSSTAILQVSVADTNDNRPVFKENEIEVSIPENAPVGSSVTQLHATDADIGENAKIHFYFSNLISNMAKKLFHLNSTTGLITIKEPLDREESP----NHKLLVLASDGGLTP--ARAMVLVNVTDINDNIPSIDIRYIINPINGTVVLSENAPLNTKIALITVTDKDADHNGWVSCF---TDHEVPFRLRPVFSNQFLLETAAYLDYESTREYAIKLLAADA-GKPPLNQSSMLLIKVKDENDNAPVFTQPFLS-----LSVPENNSPGTQLTKISAMDADSGRNAEINYLLGFDAPSEFNLDHRTGILTAVKKLDREKQEKYSFTVLAKDNGMPPLMTNATVLVTVLDQNDNSPVFT 571          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q6WYY1|PC11X_PANPA (Protocadherin-11 X-linked OS=Pan paniscus OX=9597 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 273.092 bits (697), Expect = 1.253e-73
Identity = 243/773 (31.44%), Postives = 372/773 (48.12%), Query Frame = 3
Query:  387 KVTDNTKENSFISNLNSFDVYSTPYTQNKKFNLLSNTKANRLFHLHSN-GKLYSAQT-IDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQ-NRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDY-VNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLE-NNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVLFERDNKY-YLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFP--NYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDH-KGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILI 2666
            ++ +N      + +LN   + +   T   +F L+  T    L  +  + G++++    IDRE+LC  +    H    C   + +A+  D I   R  + R  IEDINDNAP F      I+I E+  + S ++LP A D D     +++Y+L ++     IF L+    P G    QLI  ++LDRE++  Y   +   D G P ++   ++ ++V D NDN P   +T   +   E+      + ++ A D D  +NAK+ F   N   V   A + F +   +G I +KE LD E    H+  V  S+  G +  A A VL+ V ++ND  P I I Y VN  N    + EN    TK +AL TVTDKD    G+V C   +     EI  R   + SN++ + T   LD E+   Y +++   D G PPL   A++ + VKDENDNAPV       VS+ EN   G  +T ++A D D G N E+ Y +   +        ++  TG L    K+DRE++ + L      +   D G PP  S     VS+ D+NDN+P F +    F V EN     T+G I V D D  DNS + +S++   ++       F  D++   +    S D EK+++Y+F + A DG G  S +++A VT+ + D ND+ P FI P  NYS    Y     S     +   V  +D+   MN +  + +V  + + LF IDQ  G IT       +D+G H + V A D G P    S++I
Sbjct:   33 EMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEH----CFYEVEVAILPDEIF--RLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQ---NIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNL--VSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD--GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTK-IALITVTDKDADHNGRVTCFTDH-----EIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDA---PPEFSLDRRTGMLTVVKKLDREKEDKYL----FTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD-------FTIDSQTGVIRPNISFDREKQESYTFYVKAEDG-GRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYS----YELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVI 767          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q71M42|PC11X_PANTR (Protocadherin-11 X-linked OS=Pan troglodytes OX=9598 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 1.335e-73
Identity = 243/773 (31.44%), Postives = 372/773 (48.12%), Query Frame = 3
Query:  387 KVTDNTKENSFISNLNSFDVYSTPYTQNKKFNLLSNTKANRLFHLHSN-GKLYSAQT-IDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQ-NRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDY-VNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLE-NNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVLFERDNKY-YLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFP--NYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDH-KGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILI 2666
            ++ +N      + +LN   + +   T   +F L+  T    L  +  + G++++    IDRE+LC  +    H    C   + +A+  D I   R  + R  IEDINDNAP F      I+I E+  + S ++LP A D D     +++Y+L ++     IF L+    P G    QLI  ++LDRE++  Y   +   D G P ++   ++ ++V D NDN P   +T   +   E+      + ++ A D D  +NAK+ F   N   V   A + F +   +G I +KE LD E    H+  V  S+  G +  A A VL+ V ++ND  P I I Y VN  N    + EN    TK +AL TVTDKD    G+V C   +     EI  R   + SN++ + T   LD E+   Y +++   D G PPL   A++ + VKDENDNAPV       VS+ EN   G  +T ++A D D G N E+ Y +   +        ++  TG L    K+DRE++ + L      +   D G PP  S     VS+ D+NDN+P F +    F V EN     T+G I V D D  DNS + +S++   ++       F  D++   +    S D EK+++Y+F + A DG G  S +++A VT+ + D ND+ P FI P  NYS    Y     S     +   V  +D+   MN +  + +V  + + LF IDQ  G IT       +D+G H + V A D G P    S++I
Sbjct:   33 EMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEH----CFYEVEVAILPDEIF--RLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQ---NIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNL--VSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD--GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTK-IALITVTDKDADHNGRVTCFTDH-----EIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDA---PPEFSLDRRTGMLTVVKKLDREKEDKYL----FTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD-------FTIDSQTGVIRPNISFDREKQESYTFYVKAEDG-GRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYS----YELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVI 767          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q6X862|PC11X_GORGO (Protocadherin-11 X-linked OS=Gorilla gorilla gorilla OX=9595 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 2.969e-73
Identity = 243/773 (31.44%), Postives = 372/773 (48.12%), Query Frame = 3
Query:  387 KVTDNTKENSFISNLNSFDVYSTPYTQNKKFNLLSNTKANRLFHLHSN-GKLYSAQT-IDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQ-NRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDY-VNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLE-NNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVLFERDNKY-YLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFP--NYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDH-KGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILI 2666
            ++ +N      + +LN   + +   T   +F L+  T    L  +  + G++++    IDRE+LC  +    H    C   + +A+  D I   R  + R  IEDINDNAP F      I+I E+  + S ++LP A D D     +++Y+L ++     +F L+    P G    QLI  ++LDREK+  Y   +   D G P ++   ++ ++V D NDN P   +T   +   E+      + ++ A D D  +NAK+ F   N   V   A + F +   +G I +KE LD E    H+  V  S+  G +  A A VL+ V ++ND  P I I Y VN  N    + EN    TK +AL TVTDKD    G+V C   +     EI  R   + SN++ + T   LD E+   Y +++   D G PPL   A++ + VKDENDNAPV       VS+ EN   G  +T ++A D D G N E+ Y +   +        ++  TG L    K+DRE++ + L      +   D G PP  S     VS+ D+NDN+P F +    F V EN     T+G I V D D  DNS + +S++   ++       F  D++   +    S D EK+++Y+F + A DG G  S +++A VT+ + D ND+ P FI P  NYS    Y     S     +   V  +D+   MN +  + +V  + + LF IDQ  G IT       +D+G H + V A D G P    S++I
Sbjct:   33 EMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEH----CFYEVEVAILPDEIF--RLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQ---NMFGLDVIETPEGDKMPQLIVQKELDREKKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNL--VSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD--GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTK-IALITVTDKDADHNGRVTCFTDH-----EIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDA---PPEFSLDRRTGMLTVVKKLDREKEDKYL----FTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD-------FTIDSQTGVIRPNISFDREKQESYTFYVKAEDG-GRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYS----YELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVI 767          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q9BZA8|PC11Y_HUMAN (Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 GN=PCDH11Y PE=1 SV=1)

HSP 1 Score: 271.166 bits (692), Expect = 4.996e-73
Identity = 240/771 (31.13%), Postives = 374/771 (48.51%), Query Frame = 3
Query:  387 KVTDNTKENSFISNLNSFDVYSTPYTQNKKFNLLSNTKANRLFHLHSN-GKLYS-AQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQ-NRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDY-VNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLE-NNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVLFERDNKY-YLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDH-KGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILI 2666
            ++ +N    + + +LN   + +   T   +F L+  T    L  +  + G++++    IDRE+LC  +    H    C   + +A+  D I   R  + R  IEDINDNAP F      I+I E+  + S ++LP A D D     +++Y+L ++     IF L+    P G    QLI  ++LDRE++  Y   +   D G P ++   ++ ++V D NDN P   +T   +   E+      + ++ A D D  +NAK+ F   N   V   A + F +   +G I +KE LD E    H+  V  S+  G +  A A VL+ V ++ND  P I I Y VN  N    + EN    TK +AL TVTDKD    G+V C   +     EI  R   + SN++ +     LD E+   Y +++   D G PPL   A++ + VKDENDNAPV       VS+ EN   G  +  ++A D D G N E+ Y +   +        ++  TG L    K+DRE++ + L +    +   D G PP  S     VS+ D+NDN+P F +   +F V EN     T+G I V D D  DNS + +S++   ++       F  D++   +    S D EK+++Y+F + A DG G  S +++A VT+ + D ND+ P FI P Y N++ Y     S     +   V  +D+   MN +  + +V  + + LF IDQ  G IT       +D+G H + V A D G P    S++I
Sbjct:   65 EIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEH----CFYEVEVAILPDEIF--RLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQ---NIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNL--VSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD--GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTK-IALITVTDKDADHNGRVTCFTDH-----EIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDA---PPEFSLDRRTGMLTVVKKLDREKEDKYLFT----ILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD-------FTIDSQTGVIRPNISFDREKQESYTFYVKAEDG-GRVSRSSSAKVTINVVDVNDNKPVFIVPPY-NYS-YELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVI 799          
BLAST of Protocadherin vs. TrEMBL
Match: A0A0R3UIX6 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS7416 PE=4 SV=1)

HSP 1 Score: 343.584 bits (880), Expect = 3.672e-95
Identity = 284/971 (29.25%), Postives = 443/971 (45.62%), Query Frame = 3
Query:  297 EKIIKMKIVFGMILFSFGL----FRKCKSEPCDIKVTDNTKENSFIS-------NLNSFDVYSTPYTQNK-KFNLLSNTK-ANRLFHLHS-NGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEE-PRTFECRIQIEDINDNAPRFRTDKFT-INIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSL-------------------EQNRPTGSLNLQLIQKLDREKRAKYEFVLLAID---------RGN------------------PPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSN-----------------NAGHVDTATATVLIQVINLNDETPEIAIDYVNEN-------NKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHC-------------------RLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRE----TKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI----------KLENNVS-----VYENKPIGTLVTHITAKDIDEGKNGELTYSI--SESSDLTKK---YLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFE----RDNK--------YYLNTTRSLDWEKEKNYSFKILASDG-TGY-----KSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDS------MNGKCSFHLVND-----------HKGLFK------IDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNSKPFS 2699
            +++  M +V   +L +  +    FR   + P +  +TD+T  N  +        N ++F    +   +++ +F +    K  ++LF +   +G+LY+ + IDRE LC   +        C +   +A +  + +  P   + ++ + D ND+ P F    F    + ES  +G+ F LP+A D D+ QYS+  Y  E     PP +SL                     N+ TG L L+L + LD EKR  Y F + A+D          GN                  P    R      V         +    Y     ESK+   P+LK+ A D D   N+K+ +        +V   +YF+++  SG ++L++ LDYE   +  F V  ++                 +   + TATA V+I VI+ NDETP I +D+++          K A ++EN     +F+A    TD+D GL GQV+C                     + N + F++      I   +Y + TR  LDRE       Y ++++ C D G PP  +   + + V+DENDNAP I           LE++ +     V+EN P+G+LVT + A D+DEG+NG L+YSI  +E  D T     + +IN  TGD+ TR++IDRE     L    + + VSD G PP+ + +   + ++DENDN P F+    QF V EN  A Y +GEI V DKD+  ++++     P+    PF +++     DN+        + LNTTR LD E E  + F +LA+DG +GY      + TATATV V +E+END+ P  IFP   N T Y+S HE     +LT++  D D  ++      +       ++N              G F+      I+   G +  SR M   D G H+  V   D G PP+ SSI   +++DNS P S
Sbjct:    3 QQLPVMTLVTSFLLLNAPVVPTDFRIFGNSPNEFLLTDDTPSNHLVGRVQAPVENTDTFPSSGSITNRHQWRFQIFRPHKEPDQLFRIDPESGELYTIRLIDREALCPQFDEAD-----CVLDFQVAAQPQTTQGLPSFIDVKVLLVDRNDHVPEFPDPGFVNFTVPESAVIGTKFPLPLARDPDTSQYSVSAYTAEPG--LPPEWSLVVETSGSGEEMSMRPKMGSSTNKITG-LYLKLQKPLDHEKRKNYTFKIRALDGLEANEITPTGNRKDILHVFIYVEDINDNGPVFRPREKSYSGVPTNVQLSDWM--VTYTATVPESKWIKDPILKLEADDLDGPANSKIHYYFAPATSKQV--REYFKLDSVSGYLFLRKPLDYELQTEFSFRVTATDVKEESLRGNPTQSQPVQSPSTLHTATAQVVITVIDTNDETPAIEVDFISNGPSKSPLMTKYAEVEENA-PPPQFIASIQATDRDAGLSGQVNCIQQPVVNPSSIKAGLWSKPTAAENSSQFQLDEIRQEIGRVQYRLLTREALDREDTENGGAYRQVKIICTDAGQPPRTSSTFVNIRVRDENDNAPKIILRQPPDYLYGLESSETDMWPFVFENAPVGSLVTRVNASDLDEGENGRLSYSIEKTEQPDDTVNPFNFFQINEKTGDITTRIEIDREAFEPPLSCVTLKVKVSDNGVPPKSATQEIKIYIRDENDNGPVFQRQEYQFHVMENLPAGYAVGEILVTDKDEG-EIKLGFGMQPHG-PLPFTIWQSPSGADNEHKPYSMTLFILNTTRPLDREAEHAFRFTLLATDGPSGYGRSRIGTATATATVEVFVENENDNDPVIIFPQKQNKTFYLSCHEKKNFELLTINANDKDPSENPHIFELVKSAIEARMINQSSTSNFTKEEGEAGSFRVSDFLDIEPTTGIVFLSRDMKSEDKGVHIFKVQVTDGGVPPRSSSITFFVLVDNSSPRS 958          
BLAST of Protocadherin vs. TrEMBL
Match: A0A0R3W3Z8 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS4700 PE=4 SV=1)

HSP 1 Score: 336.265 bits (861), Expect = 1.026e-92
Identity = 287/953 (30.12%), Postives = 436/953 (45.75%), Query Frame = 3
Query:  321 VFGMILFSFGL----FRKCKSEPCDIKVTDNTKENSFISNLNS-------FDVYS--TPYTQNKKFNLLSNTK-ANRLFHLH-SNGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEE-PRTFECRIQIEDINDNAPRFRTDKFT-INIKESEPVGSLFSLPIATDDDSEQYSIRDYKL-----------------EENSI---FPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNP----PKTGRXXXXX-----------------XXXXXXXXXXHLSQTNYNIQY----EESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYV------EVSNNAG-----------HVDTATATVLIQVINLNDETPEIAIDYVN-ENN------KNAFIKENEDQKTKFVALATVTDKDKGLGGQVHC--------------RLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRE----TKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVS---------------VYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTK-----KYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVL----FERDN--------KYYLNTTRSLDWEKEKNYSFKILASDGTG----YKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSK------DSMNGKCSFHLV-----NDHKGLFKIDQNK---------GKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNSKPFS 2699
            +  +I F+  +    FR   + P +  +TD+T  +  +  + +       F   S  + + Q   F +    K   RLF +   +G+LY+ QTID E  C   E     ++ C ++  +  +S      P   + ++ I D ND+ P F    F  ++I ES  VGS F LP+A D D+ QYS+  Y                   EEN I    PP  SL  NR TG L L+L + LD E +  + F + A+D  +     P   R  I                        +  P  +   N+ + Y     ESK+   P+LK+ A D D   N+K+ +        +V   +YF +   +G ++L++ LDYE   +  F V      E S  +G           ++ TATA V+I V + NDE PEI +D+++ E N      K A I+EN     +F+A    TD+D GL GQV C               +++  + F++          +Y + TR  LDRE       Y ++++ C D G PP  +   + + ++D+NDN P I L                    VYEN P+G+LVT + A D+DEG+NG LT+S      L+         ++N  TGD+ T M+IDRE     L S  + + VSD G PP+ + +   + + DENDN P F+    QF V EN  + Y +GEI V DKD+  ++++S   + +    PF +    F  +N        ++ LNTTR LD E E N+ F +LA DG G     +S TATATV +I+E+END+ P  IFP   N T Y+S+ E     +LT++  D D        D + G     ++     N+ K + +I Q+          G +  SR M E D G HV  V   D G PP+ +SI   +++D+S P S
Sbjct:   11 IVALIFFNSAVISADFRAFGNLPNEFLLTDDTPADHLVGKVQAPLGSSITFPPASIISAHKQPWHFQIFRPHKFPGRLFRIDPESGELYTLQTIDHEAFCTGSE-----EEECTLTFQVTAQSKGTPSVPHFIDVKVLIVDRNDHVPEFPDPGFVNLSIPESTEVGSRFPLPLARDPDTRQYSVNAYVADPEIPSEWSLVTETANGEENFIHSRVPPS-SLSSNRITG-LYLKLQKPLDHETKKNFSFKIRALDGSDANDFAPIGNRKGILQVYIYVEDINDNGPVFRPQRKSYSLTPSKVQLGNWMVTYTATVPESKWIKDPILKLVADDLDGPANSKVGYYFAPATSKQV--QEYFNLNSVNGYLFLRKPLDYELHSEFSFRVIATDMPEESPRSGMMHSHPFQASSNLHTATAQVVITVTDTNDEAPEIEVDFISSEPNTSPLAIKYAEIEENA-APPQFIASIQATDRDAGLSGQVSCVQQPVVMLWPKPTTAMNSTSSPFQLDEIRQENGRVQYRLLTREALDREDTENGGAYRQVKIICADMGRPPRTSSTFVNIRIRDKNDNTPTINLRRLADQAYGLKSIEGDKWPFVYENAPVGSLVTRLNATDLDEGENGRLTFSFVADEPLSGTINPLSLFQVNEKTGDITTCMEIDREAYDPPLSSVVLKVKVSDNGVPPKSATQEVRIYILDENDNDPVFQRTEYQFHVMENLPSGYAIGEILVTDKDEG-EIKLSF-GMQSYGPLPFTITPSPFNSENEHGAHSMTRFILNTTRPLDREVEHNFKFTLLAMDGFGGHGRSRSGTATATVEIIVENENDNDPVIIFPQKQNKTFYLSWREKKNFELLTINANDKDPSENPHIFDLIKGHLDIQMINYSSENETKKIAEITQSSDFLDIEPTTGIVFLSRDMREEDKGVHVFKVQVTDAGVPPRSTSINFFVLVDDSSPRS 951          

HSP 2 Score: 96.6709 bits (239), Expect = 2.982e-16
Identity = 152/642 (23.68%), Postives = 260/642 (40.50%), Query Frame = 3
Query: 1197 NKYFRIEENSGNIYLKEKLDYE------RDEQHRFYVEVSNNAGHVDTATATVLIQV--INLNDETPE--------IAIDYVNENNKNAFIKENEDQKTKFVAL-ATVTDKDKGLGGQVHCRLSNNENVFEIHNR--DSSIPSNKYS---IRTRVTLDRETKGYYELQMECEDKGD-----PPLRAKALIKV--VVKDENDNAPV--------------IKLENNVSVY-----ENKPIGTLVTHITAKDIDEGKNGELTYSIS-ESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPP---------------QISRKAFDVSVKDENDNAPEFE-----------NYSIQF-QVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLP------------NEMSSPFVLFE--RDN---KYYLNTTRSLDWEKEKNYS----FKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFT---------KYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHK--------GLFKIDQNKGKITT----SRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNSKPFSIGQSNENNRDPNYVNKKFSGHFI 2768
             + FRI+  SG +Y  + +D+E       +E+     +V+  +    +    + ++V  ++ ND  PE        ++I    E      +    D  T+  ++ A V D +      +    +N E  F IH+R   SS+ SN+ +   ++ +  LD ETK  +  ++   D  D     P    K +++V   V+D NDN PV              ++L N +  Y     E+K I   +  + A D+D   N ++ Y  +  +S   ++Y  +NS  G L  R  +D E  SE   SF VI T   +  P                  +     ++V D ND APE E             +I++ ++ EN      +  I+  D+D     +VS V  P            N  SSPF L E  ++N   +Y L T  +LD E  +N       KI+ +D  G    T++  V + I D+ND+ P+      ++           K+   +E+A +  L   +   D  +  NG+ +F  V D           LF++++  G ITT     R   +  +   V+ V   D+G PPK ++  + I I           +EN+ DP +   ++  H +
Sbjct:   86 GRLFRIDPESGELYTLQTIDHEAFCTGSEEEECTLTFQVTAQSKGTPSVPHFIDVKVLIVDRNDHVPEFPDPGFVNLSIPESTEVGSRFPLPLARDPDTRQYSVNAYVADPEIPSEWSLVTETANGEENF-IHSRVPPSSLSSNRITGLYLKLQKPLDHETKKNFSFKIRALDGSDANDFAPIGNRKGILQVYIYVEDINDNGPVFRPQRKSYSLTPSKVQLGNWMVTYTATVPESKWIKDPILKLVADDLDGPANSKVGYYFAPATSKQVQEYFNLNSVNGYLFLRKPLDYELHSEF--SFRVIATDMPEESPRSGMMHSHPFQASSNLHTATAQVVITVTDTNDEAPEIEVDFISSEPNTSPLAIKYAEIEENAAPPQFIASIQATDRDAGLSGQVSCVQQPVVMLWPKPTTAMNSTSSPFQLDEIRQENGRVQYRLLTREALDREDTENGGAYRQVKIICAD-MGRPPRTSSTFVNIRIRDKNDNTPTINLRRLADQAYGLKSIEGDKWPFVYENAPVGSLVTRLNATDLDEGENGRLTFSFVADEPLSGTINPLSLFQVNEKTGDITTCMEIDREAYDPPLSSVVLKVKVSDNGVPPKSATQEVRIYI----------LDENDNDPVFQRTEYQFHVM 713          
BLAST of Protocadherin vs. TrEMBL
Match: A0A068YFN4 (Protocadherin 11 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000861900 PE=4 SV=1)

HSP 1 Score: 334.724 bits (857), Expect = 1.865e-92
Identity = 277/958 (28.91%), Postives = 437/958 (45.62%), Query Frame = 3
Query:  297 EKIIKMKIVFGMILFSFGL----FRKCKSEPCDIKVTDNTKENSFISNLN-------SFDVYS--TPYTQNKKFNLLSNTKA-NRLFHLH-SNGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDS-IEEPRTFECRIQIEDINDNAPRFRTDKFT-INIKESEPVGSLFSLPIATDDDSEQYSIRDYKLE-----ENSIFPPIFSLEQN------RPTGSLN------LQLIQKLDREKRAKYEFVLLAIDRGN----PPKTGRXXXXX-----------------XXXXXXXXXXHLSQTNYNIQYE----ESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYV------EVSNNAG-----------HVDTATATVLIQVINLNDETPEIAIDYVN-ENN------KNAFIKENEDQKTKFVALATVTDKDKGLGGQVHC--------------RLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRE----TKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVS---------------VYENKPIGTLVTHITAKDIDEGKNGELTYS--ISESSDLTKKYL---EINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERD------------NKYYLNTTRSLDWEKEKNYSFKILASDGTG----YKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSK------DSMNGKCSFHLVN--------------DHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNSKPFS 2699
            ++++ + +    +LF+F +    FR   + P +  + D+T  +  +  +        +F   S  + + Q   F +    K   RLF +   +G+LY+ Q ID E  C + E     +  C ++  +  +S S +  P   + ++ I D ND+ P F    F  +++ ES  VG+ F LP+A D D+ QYS+  Y  +     E S+     S E+N       P+ SLN      L+L + LD E + K+ F + A+D        P + R  +                        +  P     +N+ + Y     ESK+   P+LK+ A D D   N+K+ +       +     ++F +   +G ++L++ LDYE   ++ F V      E S  +G            + TATA V+I V + NDE PEI +D+++ E N      K A I+EN     +F+A    TD+D GL GQV C               +++  + F++          +Y + T+  LDRE       Y ++++ C D G PP  +   +K+ ++D+NDN P I L  +                 V+EN P+G+LVT + A D+DEG+NG LT+S  + E    T   L   +IN  TGD+ T M IDRE     L S  + + VSD G PP+ + +   + + DENDN P F+    QF V EN    Y +GEI V DKD+  ++++S   + +    PF ++                ++ LNTTR LD E E  + F +LA+DG G     ++ TATATV +++E+END+ P  IFP   N T Y+S+ E     +LT++  D D        D M G     ++N                     I+   G I  SR M E D G HV  V   D G PP+ SSI   +++D+S P S
Sbjct:    3 QQLLLLSLAVSFLLFNFAVISTDFRAFGNLPNEFILADDTPSDHMVGKVQPPLDSSITFPPTSIISAHRQPWHFQIFRPHKVPGRLFRIDPESGELYTLQIIDHEAFCTDPE-----ESECILAFQVTAQSKSTLSVPHFIDVKVLIVDRNDHVPEFPDPGFVNLSVSESTEVGARFPLPLARDPDTRQYSVNAYVADSEIPSEWSLVTETASGEENFIYSKVSPSSSLNRITGLYLKLQKSLDYETKKKFIFKIRALDGSEVNDFAPVSNRKDVLQVYIYVEDINDNGPVFRPQRKSYSLTPSKAQLSNWMVTYTATVPESKWIKDPILKLVADDLDGPSNSKVGYYFAPA--ISKQVQEHFNLNPLNGYLFLRKPLDYELQSEYSFRVIAIDMPEESPRSGMAHGQPFQTSPSLHTATAQVVITVTDTNDEAPEIEVDFISSEPNTSPLAIKYAEIEENA-APPQFIASIQATDRDGGLSGQVSCVQQPVMALWLRPTTAINSTNSPFQLDEIRQENGRVQYRLLTKKALDREDMENGGAYRQVKIICADMGQPPRTSSTFVKIRIRDKNDNTPTINLRRSSDYAYGLKSIEGDKWPFVFENAPVGSLVTRLNASDLDEGENGRLTFSFVVDEPPSGTISPLSLFQINEKTGDITTCMDIDREAYDPPLSSVVLKVKVSDNGTPPKYATQEVRIYILDENDNDPVFQRTEYQFHVMENLPTGYAVGEILVTDKDEG-EIKLSF-GMQSYGPLPFTIWPSPFHSGIEHGAYSMTRFILNTTRPLDREVENKFKFTLLATDGPGGHSKSRAGTATATVEIVVENENDNDPVIIFPQKQNKTFYLSWREKKNFELLTINANDKDPSENPHIFDLMRGPLDVQMINYSSENKTEKDAEVIQSSDFLDIEPTTGIIFLSRDMREEDKGVHVFKVQVTDAGVPPRSSSITFFVLVDDSSPRS 950          

HSP 2 Score: 82.0333 bits (201), Expect = 7.510e-12
Identity = 150/647 (23.18%), Postives = 256/647 (39.57%), Query Frame = 3
Query: 1176 QPVKVDANKYFRIEENSGNIYLKEKLDYER----DEQHRFYVEVSNNAGHVDTATAT----VLIQVINLNDETPE--------IAIDYVNENNKNAFIKENEDQKTKFVAL-ATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYS---IRTRVTLDRETKGYYELQMECEDKGD-----PPLRAKALIKV--VVKDENDNAPVIK--------------LENNVSVY-----ENKPIGTLVTHITAKDIDEGKNGELTYSISES-SDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVIL---------TVSDKGQPPQIS------RKAFDVSVKDENDNAPEFE-----------NYSIQF-QVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLP------------NEMSSPFVLFE--RDN---KYYLNTTRSLDWEKEKNYS----FKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFT---------KYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHK--------GLFKIDQNKGKITT----SRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNSKPFSIGQSNENNRDPNYVNKKFSGHFI 2768
            +P KV   + FRI+  SG +Y  + +D+E      E+    +     A    T +      V + +++ ND  PE        +++    E      +    D  T+  ++ A V D +      +    ++ E  F       S   N+ +   ++ + +LD ETK  +  ++   D  +     P    K +++V   V+D NDN PV +              L N +  Y     E+K I   +  + A D+D   N ++ Y  + + S   +++  +N   G L  R  +D E  SE   SF VI          +    GQP Q S           ++V D ND APE E             +I++ ++ EN      +  I+  D+D     +VS V  P            N  +SPF L E  ++N   +Y L T ++LD E  +N       KI+ +D  G    T++  V + I D+ND+ P+      S++          K+    E+A +  L   +   D  +  NG+ +F  V D           LF+I++  G ITT     R   +  +   V+ V   D+G PPK ++  + I I           +EN+ DP +   ++  H +
Sbjct:   80 RPHKV-PGRLFRIDPESGELYTLQIIDHEAFCTDPEESECILAFQVTAQSKSTLSVPHFIDVKVLIVDRNDHVPEFPDPGFVNLSVSESTEVGARFPLPLARDPDTRQYSVNAYVADSEIPSEWSLVTETASGEENFIYSKVSPSSSLNRITGLYLKLQKSLDYETKKKFIFKIRALDGSEVNDFAPVSNRKDVLQVYIYVEDINDNGPVFRPQRKSYSLTPSKAQLSNWMVTYTATVPESKWIKDPILKLVADDLDGPSNSKVGYYFAPAISKQVQEHFNLNPLNGYLFLRKPLDYELQSE--YSFRVIAIDMPEESPRSGMAHGQPFQTSPSLHTATAQVVITVTDTNDEAPEIEVDFISSEPNTSPLAIKYAEIEENAAPPQFIASIQATDRDGGLSGQVSCVQQPVMALWLRPTTAINSTNSPFQLDEIRQENGRVQYRLLTKKALDREDMENGGAYRQVKIICAD-MGQPPRTSSTFVKIRIRDKNDNTPTINLRRSSDYAYGLKSIEGDKWPFVFENAPVGSLVTRLNASDLDEGENGRLTFSFVVDEPPSGTISPLSLFQINEKTGDITTCMDIDREAYDPPLSSVVLKVKVSDNGTPPKYATQEVRIYI----------LDENDNDPVFQRTEYQFHVM 712          
BLAST of Protocadherin vs. TrEMBL
Match: A0A0R3TSV2 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS10747 PE=4 SV=1)

HSP 1 Score: 335.109 bits (858), Expect = 3.584e-92
Identity = 266/894 (29.75%), Postives = 411/894 (45.97%), Query Frame = 3
Query:  504 NRLFHLHSN-GKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEE-PRTFECRIQIEDINDNAPRFRTDKFT-INIKESEPVGSLFSLPIATDDDSEQYSIRDYKLE------------------ENSIF----PPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNP----PKTGRXXXXXX----------------XXXXXXXXXHLSQTN-----YNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYV-----------------EVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNEN-------NKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCR-------------------LSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRE----TKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVS---------------VYENKPIGTLVTHITAKDIDEGKNGELTYS-------ISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFE---RDN---------KYYLNTTRSLDWEKEKNYSFKILASD-GTGY---KSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDS------MNGKCSFHLVNDHK--------------GLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNSKPFSIGQSNEN 2720
            +RLF +  + G+LY++QTIDRE LC   +        C +S  +  ++ +    P   + ++ I+D ND+AP F    F  +++ ES  VG+ F LP+A+D D+ Q+S+  Y  E                  +N IF    P + S   ++ TG L L+L + LD E + K+ F + A+D        P   R  I                           P  +Q N     Y     ESK+   P+LK+ A D D   N+K+ +         V   +YF +   +G ++L++ LDYE   ++ F V                 +VS ++ ++  ATA V+I V + NDE PEI ID+++          K A I+EN     +F+A    TD+D G+ GQV C                    ++ + + F++          +Y + TR  LDRE       Y ++++ C D G PP  + A + + ++D+NDNAP I L                    VYEN P+G+L+T + A D+DEG+NG LT+S       I   + LT    +IN+ TGD+ T+++IDRE     L S  + +  SD G PP+ + +   + ++DENDN P F+    QF V EN  A Y +G+I V DKD+        +H    +  PF ++    +D+         ++ LNTTR LD E E  + F ++A+D GTG    K  +ATATV +I+E+END+ P  IFP   N T Y+S+ E     +LT++  D D  ++      M G     L+N  K                  I+   G +  SR M   D G H+  V   D G PP+ SSI   +++D+S P +  Q   N
Sbjct:   87 SRLFRIDPDTGELYTSQTIDREALCTEPDVV-----ECTLSFQVTAQTKTTSGVPHFIDIKVLIDDRNDHAPEFPDPGFVNLSVPESTEVGARFPLPLASDPDTRQFSVNAYVAEPEMPSEWSLVTETSGGETDNYIFSKVSPSMISSSVHKITG-LYLKLQKPLDHETKMKFSFKIRALDGSEANEYAPVVNRKDILQVYIYVEDINDNGPVFRPQGKPYPVAPPKAQINNWIITYTATVPESKWIKDPILKLVADDRDGPANSKVGYYFAPATSKHV--QEYFTLNPLNGYLFLRKPLDYELQSEYSFRVIATDMPEDNLRVGIVHGQVSPSSSNIHIATAQVVITVTDTNDEAPEIEIDFISSEPNASPMATKYAEIEENA-PPPQFIASIQATDRDAGMSGQVSCAQQQVLNPSSSLWPRPSQTSMNTSSSPFQLDEIRQENGRVQYRLLTREALDREDIENGGAYRQVKIVCTDMGRPPRASSAFVNIRIRDKNDNAPTINLRRPTDFMYSLKPSDGDKWPYVYENAPVGSLITRLNASDLDEGENGRLTFSFVADELPIGSVNPLT--LFQINAKTGDITTKVEIDREAYDPPLSSVLLRVKASDNGVPPKSATQDIRIYIRDENDNWPVFQRSEYQFHVMENLDAGYAVGDILVTDKDEGEIKLTFGMHTYGPL--PFTIWSCPYQDDGEHGSYSIYRFILNTTRPLDREVESAFKFTLIATDGGTGQGKSKFGSATATVEIIVENENDNDPVIIFPQKQNKTFYLSWREKKNFELLTINANDKDPSENPHIFELMKGMSDVQLINYSKENETKKDAEFTLSSDFLDIEPTTGIVFLSRDMRAEDKGIHIFKVQVTDAGVPPRSSSITFFVLVDDSSPRTPIQDGNN 967          
BLAST of Protocadherin vs. TrEMBL
Match: A0A0R3SLI4 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS5797 PE=4 SV=1)

HSP 1 Score: 333.954 bits (855), Expect = 7.678e-92
Identity = 269/891 (30.19%), Postives = 408/891 (45.79%), Query Frame = 3
Query:  504 NRLFHLHSN-GKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEE-PRTFECRIQIEDINDNAPRFRTDKFT-INIKESEPVGSLFSLPIATDDDSEQYSIRDYKLE------------------ENSIF----PPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGN----PPKTGRXXXXX-----------------XXXXXXXXXXHLSQTNYNIQY----EESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYV-----------------EVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVN-ENN------KNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVF-------------------------EIHNRDSSIPSNKYSIRTRVTLDRE----TKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVS---------------VYENKPIGTLVTHITAKDIDEGKNGELTYS-------ISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLF--------ERDN----KYYLNTTRSLDWEKEKNYSFKILASDGTG----YKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDS------MNGKCSFHLVN--------------DHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNSKP 2693
            +RLF +  + G+LY++QTIDRE LC   +        C +S  +  ++ +    P   + ++ I+D ND+ P F    F  +++ ES  VG+ F LP+A+D D+ Q+S+  Y  E                  +N IF    P + S   N+ TG L L+L + LD E + K+ F + A+D        P + R  I                           PP    +N+ + Y     ESK+   P+LK+   D D   N+K+ +         V   +YF +   +G ++L++ LDYE   ++ F V                 +VS ++ ++ TATA V+I V + NDE PEI +D+++ E N      K A I+EN     +F+A    TD+D G+ GQV C     + VF                         EI   +  +   +Y + TR  LDRE       Y ++++ C D G PP  +   + + ++D+NDNAP I L                    VYEN P+G+LVT + A D+DEG NG LT+S       +   + LT    +IN  TGD+ T+++IDRE     L S  + + VSD G PP+ + +   + ++DENDN P F+    QFQ+ EN  A Y  GEI V DKD+        +H    +  PF ++        E  +    ++ LNTTR LD E E ++ F ++A+DGT      K  +ATATV VI+E+END+ P  IFP   N T Y+S+ E     +LT++  D D  ++      M G     +VN                     I+   G +  SR M   D G HV  V   D G PP+ SSI   +++D+S P
Sbjct:   87 SRLFRIDPDTGELYTSQTIDREALCTEPDVV-----ECTLSFQVTAQTKTTSGVPHFIDIKVLIDDRNDHTPEFPDPGFVNLSVPESTEVGARFPLPLASDPDTRQFSVNAYVAEPEMPSEWSLVTETSGGESDNYIFSKVSPSMVSSPANKITG-LYLKLQKPLDHETKMKFSFKIRALDGSESNEYAPVSNRKDILQVYIYVEDINDNGPVFRPQGKPYPVAPPKAQISNWMVTYTATVPESKWIKDPILKLITDDIDGPANSKVSYYFAPATSKHV--QEYFTLNPLNGYLFLRKPLDYELQSEYSFRVIATDMPEDNLRGGVIHGQVSPSSSNIHTATAQVVITVTDTNDEAPEIEVDFISIEPNASPMATKYAEIEENA-PPPQFIASIQATDRDAGMSGQVSCV---QQQVFNPSSSLWPRPSKSSMNISSSPFQLDEIRQENGRV---QYRLLTREALDREDTENGGAYRQVKIICTDMGRPPRASSTFVNIRIRDKNDNAPTINLRRPTDFIYGLKPSDGDKWPYVYENAPVGSLVTRLNASDLDEGDNGRLTFSFVADELPVGSVNPLT--LFQINEKTGDITTKVEIDREAYDPPLSSVLLRVKVSDNGVPPKSATQDVRIYIRDENDNGPVFQRTEYQFQIMENLPAGYAAGEILVSDKDEGEIKLTFGMHTYGPL--PFTIWPCSYQGGGEHGSYSMYRFILNTTRPLDREVEHSFKFTLIATDGTTGQGKSKVGSATATVEVIVENENDNDPVIIFPQKQNKTFYLSWREKKNFELLTINANDKDPSENPHIFELMKGASDTQMVNYSNENDTKKDAEFTQSSDFLDIEPTTGIVFLSRDMRAEDKGIHVFKVQVTDAGVPPRSSSIAFFVLVDDSSP 958          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: ENSAMXT00000036470.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:10716691:10726912:1 gene:ENSAMXG00000037804.1 transcript:ENSAMXT00000036470.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 269.626 bits (688), Expect = 1.045e-74
Identity = 223/741 (30.09%), Postives = 363/741 (48.99%), Query Frame = 3
Query:  531 GKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGN-------IYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQ-VHCRLSNNE----NVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVS-VYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVLFERDNKYY-LNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNF----TKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKG--LFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNS 2687
            G L+    IDRE LC  ++ C           S+ +++ +    + F   + I DINDNAP F   K  +NI E   VG  F+LP+A D D+   ++++YKL  N  F    +++    +GS+ L L + LDRE ++    +L AID G PP +G   I I +LDVNDN P  SQ+ Y ++ +E+      +L + A D DE  N+++ + I+ +    + AN+YF +   SG        + L++ LD E+    +  +   +      + T  + I VI++ND TP     +  E  K + + EN    T  + L   TD D GL G+ V+  +S+ +    ++F I+       S    I  +  LDRE    +EL  + +DKG  P  +   + + V D ND+ PVI + +  S V E+   GT V  IT  D D GKNGE++  +  +     +    N ++      + ++   D E +  + V +  +DKG PP  S     V + D NDNAP F +    F V EN  +   +  +   D D  +N+Q+  SL++  N  SS   + + +     + + +S ++E+ K++ FK+ A+D +G    ++  TV V I DEND+ P  I P YS      T+ I Y  SAE       V  +D+    N   S+H + + KG  LF+I  + G+I T R MS++D+  H + +   DHG P   +++ + +V+  S
Sbjct:   79 GALFVTDRIDREALCSTIKKC-----------SMHIEAMAQNPLKLFRIEVHIMDINDNAPLFPVSKQILNITELSAVGEKFTLPLAEDPDTGSNAVKNYKLSPNEYFS--LNVQNGEDSGSVELVLQKALDRETQSVIHLILTAIDGGKPPLSGTTEIAILILDVNDNSPVFSQSLYKVKVKENAAFGTKVLSLSATDLDEGLNSEITYAIIRQG--TLSANEYFSLNVQSGGEQNISPQLVLQKALDREKQATVQLILTALDGGRPHRSGTLDLSINVIDVNDNTPA----FSKEMYKVSVL-ENTLPGTPVIKL-NATDLDAGLNGEIVYSLISHGKEKWADIFAIN-------SITGEITVKGPLDREDTAAFELHAQAQDKGSSPRASHCKVLIEVLDVNDSPPVISVTSLTSTVREDATTGTAVGLITIADNDIGKNGEVSAKVKGTGPFALQASYKNYYS------LVVNGPLDREDMPQYSVTILATDKGTPPLSSSIVLAVDIADVNDNAPRFSDIVTVFYVKENSPSGNIIATVTAQDPDVNENAQIVYSLINRKNMDSSWMSMVDINPVSGDIYSKQSFNYEEVKSFQFKVQATD-SGAPPLSSNVTVNVFIVDENDNRP-VILPPYSEAGSLNTENIPY--SAEAGYFVGKVRAIDADSGYNALLSYH-ITEPKGNNLFRIGSSSGEIRTKRRMSDNDLKTHPLVITVCDHGEPSLSATVSVDVVVAES 780          

HSP 2 Score: 93.2041 bits (230), Expect = 1.085e-18
Identity = 106/438 (24.20%), Postives = 181/438 (41.32%), Query Frame = 3
Query:  450 STPYTQNKKFNLLSNTKANRLFHLHSNGK-----LYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIE--DINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPP------IFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQV--HCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNA 1718
             TP  +    +L +      ++ L S+GK     +++  +I  E   I V+    ++D     L  A   D    PR   C++ IE  D+ND+ P       T  ++E    G+   L    D+D  +      K++    F         +SL  N P           LDRE   +Y   +LA D+G PP +  +V+ +++ DVNDN P  S        +E+  S   +  + A+D D N+NA++V+ ++N + +         I   SG+IY K+  +YE  +  +F V+ +++     ++  TV + +++ ND  P I   Y    + N        +   FV      D D G    +  H       N+F I        S+   IRT+  +       + L +   D G+P L A   + VVV +  D+ 
Sbjct:  369 GTPVIKLNATDLDAGLNGEIVYSLISHGKEKWADIFAINSITGE---ITVKGPLDREDTAAFELH-AQAQDKGSSPRASHCKVLIEVLDVNDSPPVISVTSLTSTVREDATTGTAVGLITIADNDIGKNGEVSAKVKGTGPFALQASYKNYYSLVVNGP-----------LDREDMPQYSVTILATDKGTPPLSSSIVLAVDIADVNDNAPRFSDIVTVFYVKENSPSGNIIATVTAQDPDVNENAQIVYSLINRKNMDSSWMSMVDINPVSGDIYSKQSFNYEEVKSFQFKVQATDSGAPPLSSNVTVNVFIVDENDNRPVILPPYSEAGSLNTENIPYSAEAGYFVGKVRAIDADSGYNALLSYHITEPKGNNLFRIG-------SSSGEIRTKRRMSDNDLKTHPLVITVCDHGEPSLSATVSVDVVVAESMDSV 784          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 266.159 bits (679), Expect = 4.133e-73
Identity = 238/793 (30.01%), Postives = 385/793 (48.55%), Query Frame = 3
Query:  330 MILFSFGLFRKCKSEPCDIKVTDNTKENSFISNLNS-FDVYSTP---YTQNKKFNLLSNTKANRLFHLH-SNGKLYS-AQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQ-NRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYV-NENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI-KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDH-KGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILI 2666
            ++L    L   C ++  D  V +   EN  I NL +  D+   P    +   +F  +  T    L  +  S G++++ A  IDRE LC    S    +  C   + +AV  D I   R  + R  IEDINDNAP F++    I+I E+  + + + +P A D D     I+ Y+L ++      F L+    P G    QLI  Q LDRE +  +   +   D GNPPK+   ++ + V DVNDN P    +   +   E+      + ++ A D D   NA++ F   N+  +     ++F I+ ++G I +K+ LD E +  H+  V  S+  G    + ATV++ V ++ND  P I   Y+ N  N    + EN    TK +AL TVTD+D  L G+V C   +     ++  R   + ++++ + T   LD ET   Y +++   D G PPL   A++ + +KDENDNAPV  + E  +S+ EN   GT +  ITA D D G N  + YS+   +        I+  +G L    ++DRE+  +   SF VI    D G  P  S     + V+D+NDN+P F +    F V EN     T+G I V D D  DN+ + +S+++  +     F++  +      N T   D E++ +Y+F + A D +G    T+ A VT+ + D ND+ P F+ P+ SN++  +    +   +++T  V  +D+   MN +  + ++    +GLF ID+  G IT    ++ +D G H + V  +D G P    SI +
Sbjct:   50 LVLILTCLVSLCWAQEKDYTVKEEQPENVRIGNLRTDLDLNLDPNIKLSSALQFKPVYKTGDVPLVRVEASTGEIFTTANRIDRERLC----SGVFNEKRCFYEIEVAVLPDEIF--RLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSV---SEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQ--ISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASD--GSATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTK-IALITVTDRDADLNGKVTCYTDH-----DVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDA---PDGFNIDPRSGILSVSKRLDREKQEK--YSFTVI--ARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDN----FIIDPKTGVIKPNIT--FDREQQSSYTFVVKAVD-SGLIQTTSYAKVTINVVDVNDNRPVFVIPS-SNYSYDLVPFTTNPGSVVT-RVFAIDNDTGMNAELQYSIIGGSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQPESLHSIAL 807          

HSP 2 Score: 100.908 bits (250), Expect = 5.582e-21
Identity = 109/374 (29.14%), Postives = 172/374 (45.99%), Query Frame = 3
Query: 1683 IKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNG----ELTYSISE-SSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVL-FERDNKYYLNTTRS-LDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSF---IFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKID---QNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI----DNSKPF---SIGQSNENNRDPN 2735
            I+ +++D NDNAP+ +    N+S+ EN  I       +A D D G NG    EL  S+SE   D+      I +  GD   ++ + +  D ET  +F + + V D G PP+ S     V+V D NDN P F++  ++  V EN     ++ ++   D D   N+Q+  S     N++S      F  D+   L T +  LD E    +   +LASDG+   S    ATV V + D ND+ PS       N  N T  +S +      I  ++V D D+   +NGK + +   DH   F++     ++  + T+  +      ++ I ++A D G PP  +S ++ I I    DN+  F    I  S   N DP 
Sbjct:  165 IRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSVSEFGLDI------IETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFS---FSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSR---ATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDA--DLNGKVTCY--TDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPG 522          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: dchs1b (dachsous cadherin-related 1b [Source:ZFIN;Acc:ZDB-GENE-050208-41])

HSP 1 Score: 268.855 bits (686), Expect = 1.004e-72
Identity = 214/685 (31.24%), Postives = 342/685 (49.93%), Query Frame = 3
Query:  666 TFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGS---LNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKY-YLNTTRSLDW-EKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLV-NDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGN--PPKESSILITIVIDNSKP 2693
            T E  I + DIND+AP F   K ++ I E   VG+ FSL  ATD D +Q + + Y ++E ++   +F LE  R T     L+L +   LDREKRA Y  +L A D G+P KTG++ +++ V D+ND+ P  +Q+ Y     ES      +L++ A D DE DN  ++++I   Q    D ++YF I+  SG I L + LDYE  + H   V+  +NA H +   A V I V + ND  P + I +++E+  +  I E   Q  ++VA  +V+D D G    V+  L   +  F +  +DS I    Y I     LDRE +  YEL++   D G PPLRA++   + V D NDN P+   +    ++ E    G+ V  +TA+D D G NG++ YSI         +  I+  TG + T  ++D     ET  +  V +  +D G+PP  S    ++S++D NDN P F +      + EN  A     E+   D D  S   V+        SSP   F  + +   + T+ +LD  E   ++ F + A+DG G  S   +A V V ++D ND+ P+F +P   N+   +S   +   +++ V+  D D  +  NGK ++  V       F ++++ G I+ SR++         + + A+D G    P  + + I++V  +  P
Sbjct:  127 TVEVSITVNDINDHAPVFPKKKASLKIPEQTAVGTKFSLEPATDADKDQLTTQGYLIKEGNVGQ-VFRLETKRATNKVLYLDLVVNGVLDREKRASYSLLLEAFDGGSPKKTGQMTLDVTVQDINDHAPIFNQSRYRAIISESLPQGSNILQVFASDADEGDNGLVLYEINRRQS---DPDRYFVIDPRSGIITLNKPLDYEVRKVHELVVQARDNASHPEITNAFVTIHVRDFNDNQPTMTIIFLSEDG-SPRISEGA-QPGQYVARISVSDPDYGEYSNVNVSLEGGDGKFALTTKDSII----YLIYVDQVLDREERDSYELRVMATDSGTPPLRAESSFTIQVTDVNDNPPLFDQQAYKQTIPEVVYPGSFVLQVTARDKDHGPNGDVLYSILPDRGTHSDWFTIDPVTGIITTATQLDY----ETYPNPSVKVVATDGGKPPLSSTALVEISLQDINDNEPVFGSSVYNVSIKENTAAGTCFLEVTASDADGGSFGAVAYSLGSGAGSSPPTRFSINKETGQICTSAALDRDEGADSFEFTVTAADGGGLSS---SAVVKVSLQDINDNRPTF-YP--VNYAVSLSSQSAPGTSVIRVTAHDPDGGE--NGKVTYRTVPGGGSNFFTLNKDTGVISLSRSLHGKANSVIAMVITAQDGGGLTAPVNARVNISVVAGSVAP 789          

HSP 2 Score: 190.274 bits (482), Expect = 3.798e-48
Identity = 214/824 (25.97%), Postives = 353/824 (42.84%), Query Frame = 3
Query:  348 GLFRKCKSEPCDIKVTDNTKENSFISNLNSFDVYSTPYTQNKKFNLLSNTKAN---------RLFHLHSNGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPR--TFECRIQIEDINDNAPRFR----TDKFTINIKESEPVGSLFSLPIATDDDSEQ-----YSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGA-KDEDEND---NAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSN-NAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNR--DSSIPSNKYSIRTRVTLDR-----ETKGYYELQMECEDKGDPPLR--AKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAE-IAILTVSVGDLDSKDSMNGKCSFHL-VNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI----DNSKPFS 2699
            G  +K  S    + VTD    +  +S    F            F  +S T  +         RL H   N ++ S QT +     ++  +   ++      L + V+ D    PR  T    I + D NDNAP F       +  I ++E  P GSL     A D D  +     YS+   + E  S+ P    L  + P           L R ++++Y   + A DRG PP++   V+ I +L  +   P  +  +  +   E     +P   IG+ +  D  D   + ++ + +V       D +  F ++  +G++YL  +LDYE+   +   +EV + +  +  T    + I V + ND  PE   D V        + EN  Q    +      DKD G G        N+E  + I +R  D S       I   +TL +     ET   + +    +   DP  R       ++ V DENDNAP+      VSV E++P+G ++ ++ A+D D+G+NG ++Y I   +        +N +TG L     +DRE+      S+ + +   D G P   + +   V V D ND AP FE    + QV ENQ A  T+  +   D+D  +  RV+   +  +    F++        ++ T+ LD E++ +Y+  + A DG G   + A ATV + + DEND+AP F    YS     +   E+ E + +  +   D DS DS  G   + + V D  G F++D + G ++TSR +       + + V+A+D G P   S+  + I +    DNS  F+
Sbjct: 1088 GRMKKTGSATVRVSVTDENDNSPRLSQERVFLAVRENLPTGTGFGRVSATDRDAGLNSRLTYRLLHTDRNFQINS-QTGE-----VSTRAALDREHQSSYQLVVVVQ-DGGTPPRSATGTAHITVLDENDNAPIFSHMMPGKELLIQVQEGLPAGSLLGTLQAKDPDEGENSTIFYSLSGSRAERFSLNPNTGELRSSSP-----------LRRAEKSEYSITVSASDRGAPPQSSSCVLRIQILGSSRAAPKPNTLSMTLNSVEGA---KPGSVIGSVRSHDHRDVVLDGQVTYLVVG----GTDKDGTFMVDRLTGDVYLARELDYEKGALYTLNIEVEDFSKAYPSTYMIQLDITVQDSNDHAPEFPEDPVT-----IVVPENM-QPGSSIYTFQAADKD-GSG-------PNSEVRYSIQHRYPDRSDLLTLDPISGVLTLGQALDHEETSSLFLVVRGTDSAVDPNQRRWGSVTARIFVTDENDNAPIFSSPTAVSVMEDQPVGFVLLYVMARDADQGENGRVSYRIQTGN--AGGRFSLNPNTGSLSILKAMDREEQ----DSYNLTIIAEDHGTPQHSTTQVLSVQVIDVNDEAPWFEKSEYEVQVRENQPAGTTVLTVSATDRDQGTNGRVTYGDVTVDG---FIIAPETG--VISLTKVLDREQQDHYTVTVYAKDG-GMPPNFAKATVHITVLDENDNAPVFGRLQYS-----LELPENLEPVELFIIKATDQDSGDS--GHLEYRITVGDPDGDFQLDSSSGALSTSRPLDRERRDSYSLEVVAQDRGTPSLSSTATVEITVLDVNDNSPTFT 1853          

HSP 3 Score: 180.259 bits (456), Expect = 3.939e-45
Identity = 168/624 (26.92%), Postives = 285/624 (45.67%), Query Frame = 3
Query:  552 TIDREELCINVE-SCCHKKDPCDISLSIAVKSDSIEEPRTFECR--IQIEDINDNAPRFRTD-KFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKY-FRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVD-TATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIK-----LENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDD---NSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSF 2381
            T+D E   +       H+  P   SL + V++ S   P   + R  I I D+NDN P F      ++ + E   +GS+     A D DS Q     + L  +      FS+E+    GS  ++LI  L  +   +Y+  +LA D G P ++    + ++V   +D  P      Y ++ +E+       L++ A   D+  N      +++ + ++ D +   F I  +SG +++K  LD E  + +   V  ++ +G +  T +ATV + V + ND +P ++ + V        ++EN    T F    + TD+D GL  ++  RL + +  F+I+       S    + TR  LDRE +  Y+L +  +D G PP  A     + V DENDNAP+        E  + V E  P G+L+  + AKD DEG+N  + YS+S S     +   +N +TG+L++   + R + SE    + + ++ SD+G PPQ S     + +   +  AP+    S+     E  +    +G +R HD  D   + Q+   LV    +    F++       YL   R LD+EK   Y+  I   D +     T    + + ++D NDHAP F
Sbjct:  840 TVDSETGALRTSLPLDHEARP---SLELEVQASSGSPPAFGQTRVTITIGDVNDNTPAFLPSYSESLLLPEVTKIGSVVYRVQAEDRDSGQNGRISFHLLASG-GQRAFSVER----GSGEIRLISSLSYDSVPRYDLQVLARDGGVPQRSATFTLVVHVQAEDDQGPAFDTLTYRVELKENTPLNTRFLQVRALSRDQLKNGSSPAALLSYR-LRPDGDAAGFGIVPDSGWLFVKSALDREAKDIYLLTVLATSGSGRMKKTGSATVRVSVTDENDNSPRLSQERVF-----LAVRENLPTGTGF-GRVSATDRDAGLNSRLTYRLLHTDRNFQIN-------SQTGEVSTRAALDREHQSSYQLVVVVQDGGTPPRSATGTAHITVLDENDNAPIFSHMMPGKELLIQVQEGLPAGSLLGTLQAKDPDEGENSTIFYSLSGSR---AERFSLNPNTGELRSSSPLRRAEKSE----YSITVSASDRGAPPQSSSCVLRIQILGSSRAAPKPNTLSMTLNSVEGAKPGSVIGSVRSHDHRDVVLDGQV-TYLVVGGTDKDGTFMVDRLTGDVYL--ARELDYEKGALYTLNIEVEDFSKAYPSTYMIQLDITVQDSNDHAPEF 1431          

HSP 4 Score: 178.333 bits (451), Expect = 1.498e-44
Identity = 198/778 (25.45%), Postives = 342/778 (43.96%), Query Frame = 3
Query:  396 DNTKENSFISNLNSFDVYSTPYTQNKKFNLLSNTKANRLFHLHS-NGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTF--ECRIQIEDINDNAPRFRTDKFTINIKES-EPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSM-----QP----LLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI-KLENNVSVYEN-KPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQ-DSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIF-PNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI 2678
            +  K  S I ++ S D           + ++  T  +  F +    G +Y A+ +D E+  +              +L+I V+  S   P T+  +  I ++D ND+AP F  D  TI + E+ +P  S+++   A  D S   S   Y ++    +P    L    P   + L L Q LD E+ +    V+   D    P   R       +        ++  N N     S  ++     QP    LL + A+D D+ +N ++ ++I        +A   F +  N+G++ + + +D E  + +   +   ++     + T  + +QVI++NDE P     +  ++     ++EN+   T  + + + TD+D+G  G+V       +  F I      I   K        LDRE + +Y + +  +D G PP  AKA + + V DENDNAPV  +L+ ++ + EN +P+   +  I A D D G +G L Y I+          +++S +G L T   +DRE+ DS +L+     +   D+G P   S    +++V D NDN+P F + S    V+E+     +L ++   D D+    ++ L  L +E    F +     +  + T   LD EK  +YSF++ A D +       TA VTV I D ND+AP FI  P   N +   S   +    + T+   D D     NG   +      +G F I+   G+I T+  +S     +  + V A D G+P + S  ++ I +
Sbjct: 1334 EGAKPGSVIGSVRSHDHRDVVLDGQVTYLVVGGTDKDGTFMVDRLTGDVYLARELDYEKGAL-------------YTLNIEVEDFSKAYPSTYMIQLDITVQDSNDHAPEFPEDPVTIVVPENMQPGSSIYTFQAADKDGSGPNSEVRYSIQHR--YPDRSDLLTLDPISGV-LTLGQALDHEETSSLFLVVRGTDSAVDPNQRRWGSVTARI-------FVTDENDNAPIFSSPTAVSVMEDQPVGFVLLYVMARDADQGENGRVSYRIQTG-----NAGGRFSLNPNTGSLSILKAMDREEQDSYNLTIIAEDHGTPQHSTTQVLSVQVIDVNDEAP-----WFEKSEYEVQVRENQPAGTTVLTV-SATDRDQGTNGRVTYGDVTVDG-FIIAPETGVISLTK-------VLDREQQDHYTVTVYAKDGGMPPNFAKATVHITVLDENDNAPVFGRLQYSLELPENLEPVELFI--IKATDQDSGDSGHLEYRITVGD--PDGDFQLDSSSGALSTSRPLDRERRDSYSLE-----VVAQDRGTPSLSSTATVEITVLDVNDNSPTFTSSSYTVDVSEDAAVGSSLLDVTAKDADEGQNGQI-LYFLSSEARGDFTVDPDTGR--IVTAAPLDREKRASYSFQVCAVDLSPATPRNTTAQVTVTILDVNDNAPFFIQDPLIINVS---SRSVATNHVVATMKAEDKDF--GANGSVFYRFAMPVRG-FSINSLTGEIQTTELLSSLTQSQRTLIVEAMDQGSPAQSSLGVVIIYV 2051          

HSP 5 Score: 157.532 bits (397), Expect = 3.762e-38
Identity = 183/739 (24.76%), Postives = 322/739 (43.57%), Query Frame = 3
Query:  501 ANRLFHLHSN-GKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDD---SEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQP--LLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVAL-ATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDP--PLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGT--LVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLK-TRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHK-GLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI 2678
            A   F L+ N G L   + +DREE           +D  ++++ IA    + +   T    +Q+ D+ND AP F   ++ + ++E++P G+      ATD D   + + +  D  ++   I P          TG ++L  +  LDRE++  Y   + A D G PP   +  ++I VLD NDN P   +  Y+++  E   +++P  L  I A D+D  D+  + ++I    P     +  F+++ +SG +     LD ER + +   V   +      ++TATV I V+++ND +P          + +  +  +ED       L  T  D D+G  GQ+   LS+          D ++  +   I T   LDRE +  Y  Q+ C     P  P    A + V + D NDNAP    +  +    ++ + T  +V  + A+D D G NG + Y  +    +  +   INS TG+++ T +     Q   TL     I+   D+G P Q S     + VK+++     F   +    + EN      + + +    D         +   N   S F +     + +++++  LD+E        + A       S ++   V +I++D ND+ P F   NY  + +    ++S    I+ V   D+D     NG+ ++ + +  + GLFKID   G ITT+  M      +  + + A D G+P    S  +T++I
Sbjct: 1585 AGGRFSLNPNTGSLSILKAMDREE-----------QDSYNLTI-IAEDHGTPQHSTTQVLSVQVIDVNDEAPWFEKSEYEVQVRENQPAGTTVLTVSATDRDQGTNGRVTYGDVTVDGFIIAP---------ETGVISLTKV--LDREQQDHYTVTVYAKDGGMPPNFAKATVHITVLDENDNAPVFGRLQYSLELPE---NLEPVELFIIKATDQDSGDSGHLEYRITVGDP-----DGDFQLDSSSGALSTSRPLDRERRDSYSLEVVAQDRGTPSLSSTATVEITVLDVNDNSPTF-------TSSSYTVDVSEDAAVGSSLLDVTAKDADEGQNGQILYFLSSEA------RGDFTVDPDTGRIVTAAPLDREKRASYSFQV-CAVDLSPATPRNTTAQVTVTILDVNDNAPFFIQDPLIINVSSRSVATNHVVATMKAEDKDFGANGSVFYRFA----MPVRGFSINSLTGEIQTTELLSSLTQSQRTL-----IVEAMDQGSPAQSSLGVVIIYVKEQDYQGIRFSRTTRDVSIQENAAKGTAVAQAQAQYPDGTRGGIAYSIFSGNRQQS-FRISSSTGEIWVHSSTGLDFEDTPRLRLVVKAE----TASSSSFMAVNLILQDVNDNLPRFQLQNYVAYMREARGYDS---PIIQVVAEDVDQ--GPNGQVTYSIQSSGRSGLFKIDPLSGSITTAAIMDREIWMQTKLVITATDRGSPKLAGSATLTVII 2259          

HSP 6 Score: 147.902 bits (372), Expect = 3.173e-35
Identity = 177/679 (26.07%), Postives = 287/679 (42.27%), Query Frame = 3
Query:  681 IQIEDINDNAPR----FRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIR-------TRVTLDR-ETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKY-YLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLV-NDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITI 2672
            I + D NDN P     F ++  +  I E    G   +    +D D  +YS  +  LE        F+L        L + + Q LDRE+R  YE  ++A D G PP        I V DVNDNPP   Q  Y     E  +    +L++ A+D+D   N  +++ I+ ++    D   +F I+  +G I    +LDYE        V  ++      ++TA V I + ++ND  P         +  N  IKEN    T F+ + T +D D G  G V   L +            S P  ++SI        T   LDR E    +E  +   D G   L + A++KV ++D NDN P     N  VS+      GT V  +TA D D G+NG++TY           +  +N  TG     + + R    +      +++T  D G          ++SV   +   P FE     F V+E+      +G +R + +     L    +        P   F  D++   L T+  LD E   +   ++ AS G+          VT+ I D ND+ P+F+ P+YS   + +   E  +I  +   V   D     NG+ SFHL+ +  +  F +++  G+I    ++S   + ++ + V+ARD G P + ++  + +
Sbjct:  351 IHVRDFNDNQPTMTIIFLSEDGSPRISEGAQPGQYVARISVSDPDYGEYSNVNVSLEGGD---GKFALTTKDSIIYL-IYVDQVLDREERDSYELRVMATDSGTPPLRAESSFTIQVTDVNDNPPLFDQQAYKQTIPEVVYPGSFVLQVTARDKDHGPNGDVLYSILPDRGTHSD---WFTIDPVTGIITTATQLDYETYPNPSVKVVATDGGKPPLSSTALVEISLQDINDNEP-----VFGSSVYNVSIKENTAAGTCFLEV-TASDADGGSFGAVAYSLGSGAG---------SSPPTRFSINKETGQICTSAALDRDEGADSFEFTVTAADGGG--LSSSAVVKVSLQDINDNRPTFYPVNYAVSLSSQSAPGTSVIRVTAHDPDGGENGKVTYRTVPGGG--SNFFTLNKDTG----VISLSRSLHGKANSVIAMVITAQDGGGLTAPVNARVNISVVAGSVAPPVFEQAQYFFTVSEDVLRGTEVGVVRANSR----SLATKDISYTISSGDPDGYFTVDSETGALRTSLPLDHEARPSLELEVQASSGS--PPAFGQTRVTITIGDVNDNTPAFL-PSYS---ESLLLPEVTKIGSVVYRVQAEDRDSGQNGRISFHLLASGGQRAFSVERGSGEIRLISSLSYDSVPRYDLQVLARDGGVPQRSATFTLVV 989          

HSP 7 Score: 134.42 bits (337), Expect = 4.300e-31
Identity = 178/745 (23.89%), Postives = 310/745 (41.61%), Query Frame = 3
Query:  531 GKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEEN-SIF----PPIFSLEQNRPTGSL-NLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYL--KEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRL--SNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKG-LFKID-----------QNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSI--LITIVIDNSKP 2693
            G++ +A  +DRE+         +    C + LS A   ++     T +  + I D+NDNAP F  D   IN+          S  +AT+         D     N S+F     P+     N  TG +   +L+  L + +R     ++ A+D+G+P ++   V+ I V + +      S+T  ++  +E+      + +  A+  D      + + I +      +  + FRI  ++G I++     LD+E   + R  V+    +     A   +L  V   ND  P   +      N  A+++E     +  + +    D D+G  GQV   +  S    +F+I     SI        T   +DRE     +L +   D+G P L   A + V++ D NDN+P I L   V V EN  IGT +T +T  D+D G    L+YS+   +    K+  I+ ++G +     +D E+ S     + + +  SD       S     V V D NDN P F     Q  + E+      +  +   D+D     RV+   L +     F +   +   ++      D E+  + S  I ASD  G    ++ ATV + + D ND+AP F   + S +   +S  +     ILT+   D+D     +G   F + + + G  F+I+           Q  G +  +  +    M ++ +T++  D G P + SS+  +IT++  N  P
Sbjct: 1906 GRIVTAAPLDREK------RASYSFQVCAVDLSPATPRNT-----TAQVTVTILDVNDNAPFFIQDPLIINVS---------SRSVATNHVVATMKAEDKDFGANGSVFYRFAMPVRGFSINSLTGEIQTTELLSSLTQSQRT---LIVEAMDQGSPAQSSLGVVIIYVKEQDYQGIRFSRTTRDVSIQENAAKGTAVAQAQAQYPD-GTRGGIAYSIFSG-----NRQQSFRISSSTGEIWVHSSTGLDFEDTPRLRLVVKAETASSSSFMAVNLILQDV---NDNLPRFQL-----QNYVAYMREARGYDSPIIQV-VAEDVDQGPNGQVTYSIQSSGRSGLFKIDPLSGSI-------TTAAIMDREIWMQTKLVITATDRGSPKLAGSATLTVIIVDLNDNSPTIPLPREVRVPENSLIGTEITMVTGNDVDSGP--VLSYSLRLDTPSQGKF-GIHRYSGRVFLTAPLDFEERSW----YTLTVQASDSKHQ---SEANVTVLVGDMNDNVPTFTQDLYQVTLPEHSPPGSAVVTVTATDRDSGENGRVTYRVLSSSREG-FYIDPNNGTLFIGQKVEFDPER-PSVSVVIEASD-RGKPPLSSIATVQIQLTDVNDNAPMF---HQSEYRATVSEDQLPGATILTLEAVDVDLSQENSG-FDFAIASGNVGNAFQIESSVRFIEGHGFQTVGTLILAEQLDFELMSRYNLTIVVSDRGVPQRSSSVPAVITVIDVNDNP 2588          

HSP 8 Score: 132.109 bits (331), Expect = 2.163e-30
Identity = 172/724 (23.76%), Postives = 309/724 (42.68%), Query Frame = 3
Query:  624 LSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCR-LSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI-KLENNVSVYENKPIGTLVTHITAKDIDEGK-NGELTYSISESSDLTKKYLE-----INSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSL-VHLPNEMSSPFVLFERDN-KYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVN---DHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNSKPFSIGQSNENNRDPNYVNKKFS 2756
            L + VK+++          + ++D+NDN PRF+   +   ++E+    S     +A D D        Y ++ +S    +F ++    +GS+    I  +DRE   + + V+ A DRG+P   G   + + ++D+NDN P +         E S    +  +  G    D +    + + +  + P    +   F I   SG ++L   LD+E    +   V+ S++  H   A  TVL+   ++ND  P    D          + E+    +  V + T TD+D G  G+V  R LS++   F I   + ++      I  +V  D E +    + +E  D+G PPL + A +++ + D NDNAP+  + E   +V E++  G  +  + A D+D  + N    ++I+  +      +E     I  H       + +  + D E +  + + + VSD+G P + S     ++V D NDN P F +      ++E   A   +  +   D+D      +   +   +EM     LF  D     L   R LD E + ++   I ASDG G   H A A + V ++D ND+ P F        T  I  ++ A  A+  +   D D+   M G   + +V+     K  F +DQN G++ + +      +       +A D GN    +++ + + I          + E+  DP + +  FS
Sbjct: 2133 LRLVVKAETASSSSFMAVNLILQDVNDNLPRFQLQNYVAYMREARGYDSPIIQVVAEDVDQGPNGQVTYSIQ-SSGRSGLFKIDPL--SGSITTAAI--MDREIWMQTKLVITATDRGSPKLAGSATLTVIIVDLNDNSPTIPLPREVRVPENSLIGTEITMVTG---NDVDSGPVLSYSLRLDTP----SQGKFGIHRYSGRVFLTAPLDFEERSWYTLTVQASDSK-HQSEANVTVLVG--DMNDNVPTFTQDLYQ-----VTLPEHSPPGSAVVTV-TATDRDSGENGRVTYRVLSSSREGFYIDPNNGTL-----FIGQKVEFDPE-RPSVSVVIEASDRGKPPLSSIATVQIQLTDVNDNAPMFHQSEYRATVSEDQLPGATILTLEAVDVDLSQENSGFDFAIASGNVGNAFQIESSVRFIEGHGFQTVGTLILAEQLDFELMSRYNLTIVVSDRGVPQRSSSVPAVITVIDVNDNPPVFSHAEYVVALSEGAAAGTEILRLSATDQDSAPHAEIQYSISSGDEME----LFSVDQWTGALRLQRPLDRETQPSHVVIIQASDGHG---HFALAPINVEVKDINDNRPYFPI---QTMTASIRENQPANSAVTVLHAIDQDT--GMYGILKYFMVDRSSQGKEFFAVDQNTGEVRSRQAFDFEKVNSFHFMALAVDAGN--NSATVTVQVYI----------TGEDEYDPAFTSSAFS 2805          

HSP 9 Score: 121.709 bits (304), Expect = 3.269e-27
Identity = 153/630 (24.29%), Postives = 277/630 (43.97%), Query Frame = 3
Query:  375 PCDIKVTDNTKENSFISNLNSFDVYSTPYTQNKKFNLLSNTKANRLFHLHS-NGKLYSAQTIDREE-----LCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDRE-KRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDED-ENDNAKMVFKIVNEQPVKVDANKYFRIE-----------ENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIA-IDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPF 2201
            P +++V +N+   + I+ +   DV S P      ++L  +T +   F +H  +G+++    +D EE     L +      H+ +                        + + D+NDN P F  D + + + E  P GS      ATD DS +     Y++  +S     F ++ N  T    L + QK++ + +R     V+ A DRG PP +    + I + DVNDN P   Q+ Y     E +     +L + A D D   +N+   F I +      +    F+IE           +  G + L E+LD+E   ++   + VS+      +++   +I VI++ND  P  +  +YV        + E     T+ + L + TD+D     ++   +S+ + + E+ + D        ++R +  LDRET+  + + ++  D       A A I V VKD NDN P   ++    S+ EN+P  + VT + A D D G  G L Y + + S   K++  ++ +TG++++R   D E+    + SF  +    D G           ++ +DE D  P F + +  F+V E  +   ++G+++  D+D      + L   PN  +SP+
Sbjct: 2272 PREVRVPENSLIGTEITMVTGNDVDSGPVL---SYSLRLDTPSQGKFGIHRYSGRVFLTAPLDFEERSWYTLTVQASDSKHQSEA--------------------NVTVLVGDMNDNVPTFTQDLYQVTLPEHSPPGSAVVTVTATDRDSGENGRVTYRVLSSS--REGFYIDPNNGT----LFIGQKVEFDPERPSVSVVIEASDRGKPPLSSIATVQIQLTDVNDNAPMFHQSEYRATVSEDQLPGATILTLEAVDVDLSQENSGFDFAIASG-----NVGNAFQIESSVRFIEGHGFQTVGTLILAEQLDFELMSRYNLTIVVSDRGVPQRSSSVPAVITVIDVNDNPPVFSHAEYV------VALSEGAAAGTEILRL-SATDQDSAPHAEIQYSISSGDEM-ELFSVDQW----TGALRLQRPLDRETQPSHVVIIQASDGHG--HFALAPINVEVKDINDNRPYFPIQTMTASIRENQPANSAVTVLHAIDQDTGMYGILKYFMVDRSSQGKEFFAVDQNTGEVRSRQAFDFEK----VNSFHFMALAVDAGNNSATVTVQVYITGEDEYD--PAFTSSAFSFEVPEGAKKGQSIGQVQAVDEDGGVD-GIVLYSFPN--TSPY 2844          

HSP 10 Score: 64.6994 bits (156), Expect = 7.910e-10
Identity = 51/189 (26.98%), Postives = 94/189 (49.74%), Query Frame = 3
Query:  681 IQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDY-KLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLK 1244
            ++++DINDN P F     T +I+E++P  S  ++  A D D+  Y I  Y  ++ +S     F+++QN  TG +  +  Q  D EK   + F+ LA+D GN   T  + + + +   ++  P  + + ++ +  E     Q + ++ A DED   +  +++   N  P       YF + + +G IYLK
Sbjct: 2682 VEVKDINDNRPYFPIQTMTASIRENQPANSAVTVLHAIDQDTGMYGILKYFMVDRSSQGKEFFAVDQN--TGEVRSR--QAFDFEKVNSFHFMALAVDAGNNSAT--VTVQVYITGEDEYDPAFTSSAFSFEVPEGAKKGQSIGQVQAVDEDGGVDGIVLYSFPNTSP-------YFDVNKTTGVIYLK 2857          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 265.774 bits (678), Expect = 1.429e-72
Identity = 238/793 (30.01%), Postives = 384/793 (48.42%), Query Frame = 3
Query:  330 MILFSFGLFRKCKSEPCDIKVTDNTKENSFISNLNS-FDVYSTP---YTQNKKFNLLSNTKANRLFHLH-SNGKLYS-AQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQ-NRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYV-NENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI-KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDH-KGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILI 2666
            ++L    L   C ++  D  V +   EN  I NL +  D+   P    +   +F  +  T    L  +  S G++++ A  IDRE LC    S    +  C   + +AV  D I   R  + R  IEDINDNAP F++    I+I E+  + + + +P A D D     I+ Y+L +       F L+    P G    QLI  Q LDRE +  +   +   D GNPPK+   ++ + V DVNDN P    +   +   E+      + ++ A D D   NA++ F   N+  +     ++F I+ ++G I +K+ LD E +  H+  V  S+  G    + ATV++ V ++ND  P I   Y+ N  N    + EN    TK +AL TVTD+D  L G+V C   +     ++  R   + ++++ + T   LD ET   Y +++   D G PPL   A++ + +KDENDNAPV  + E  +S+ EN   GT +  ITA D D G N  + YS+   +        I+  +G L    ++DRE+  +   SF VI    D G  P  S     + V+D+NDN+P F +    F V EN     T+G I V D D  DN+ + +S+++  +     F++  +      N T   D E++ +Y+F + A D +G    T+ A VT+ + D ND+ P F+ P+ SN++  +    +   +++T  V  +D+   MN +  + ++    +GLF ID+  G IT    ++ +D G H + V  +D G P    SI +
Sbjct:   10 LVLILTCLVSLCWAQEKDYTVKEEQPENVRIGNLRTDLDLNLDPNIKLSSALQFKPVYKTGDVPLVRVEASTGEIFTTANRIDRERLC----SGVFNEKRCFYEIEVAVLPDEIF--RLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKVGALE--FGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQ--ISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASD--GSATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTK-IALITVTDRDADLNGKVTCYTDH-----DVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDA---PDGFNIDPRSGILSVSKRLDREKQEK--YSFTVI--ARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDN----FIIDPKTGVIKPNIT--FDREQQSSYTFVVKAVD-SGLIQTTSYAKVTINVVDVNDNRPVFVIPS-SNYSYDLVPFTTNPGSVVT-RVFAIDNDTGMNAELQYSIIGGSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQPESLHSIAL 768          

HSP 2 Score: 101.293 bits (251), Expect = 4.441e-21
Identity = 105/369 (28.46%), Postives = 168/369 (45.53%), Query Frame = 3
Query: 1683 IKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVL-FERDNKYYLNTTRS-LDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSF---IFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKID---QNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI----DNSKPF---SIGQSNENNRDPN 2735
            I+ +++D NDNAP+ +    N+S+ EN  I       +A D D G NG   Y + +   L      I +  GD   ++ + +  D ET  +F + + V D G PP+ S     V+V D NDN P F++  ++  V EN     ++ ++   D D   N+Q+  S     N++S      F  D+   L T +  LD E    +   +LASDG+   S    ATV V + D ND+ PS       N  N T  +S +      I  ++V D D+   +NGK + +   DH   F++     ++  + T+  +      ++ I ++A D G PP  +S ++ I I    DN+  F    I  S   N DP 
Sbjct:  125 IRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKVGALEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFS---FSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSR---ATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDA--DLNGKVTCY--TDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPG 483          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 265.388 bits (677), Expect = 2.557e-72
Identity = 238/793 (30.01%), Postives = 385/793 (48.55%), Query Frame = 3
Query:  330 MILFSFGLFRKCKSEPCDIKVTDNTKENSFISNLNS-FDVYSTP---YTQNKKFNLLSNTKANRLFHLH-SNGKLYS-AQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQ-NRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYV-NENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI-KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDH-KGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILI 2666
            ++L    L   C ++  D  V +   EN  I NL +  D+   P    +   +F  +  T    L  +  S G++++ A  IDRE LC    S    +  C   + +AV  D I   R  + R  IEDINDNAP F++    I+I E+  + + + +P A D D     I+ Y+L ++      F L+    P G    QLI  Q LDRE +  +   +   D GNPPK+   ++ + V DVNDN P    +   +   E+      + ++ A D D   NA++ F   N+  +     ++F I+ ++G I +K+ LD E +  H+  V  S+  G    + ATV++ V ++ND  P I   Y+ N  N    + EN    TK +AL TVTD+D  L G+V C   +     ++  R   + ++++ + T   LD ET   Y +++   D G PPL   A++ + +KDENDNAPV  + E  +S+ EN   GT +  ITA D D G N  + YS+   +        I+  +G L    ++DRE+  +   SF VI    D G  P  S     + V+D+NDN+P F +    F V EN     T+G I V D D  DN+ + +S+++  +     F++  +      N T   D E++ +Y+F + A D +G    T+ A VT+ + D ND+ P F+ P+ SN++  +    +   +++T  V  +D+   MN +  + ++    +GLF ID+  G IT    ++ +D G H + V  +D G P    SI +
Sbjct:   50 LVLILTCLVSLCWAQEKDYTVKEEQPENVRIGNLRTDLDLNLDPNIKLSSALQFKPVYKTGDVPLVRVEASTGEIFTTANRIDRERLC----SGVFNEKRCFYEIEVAVLPDEIF--RLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSV---SEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQ--ISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASD--GSATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTK-IALITVTDRDADLNGKVTCYTDH-----DVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDA---PDGFNIDPRSGILSVSKRLDREKQEK--YSFTVI--ARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDN----FIIDPKTGVIKPNIT--FDREQQSSYTFVVKAVD-SGLIQTTSYAKVTINVVDVNDNRPVFVIPS-SNYSYDLVPFTTNPGSVVT-RVFAIDNDTGMNAELQYSIIGGSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQPESLHSIAL 807          

HSP 2 Score: 100.908 bits (250), Expect = 6.213e-21
Identity = 109/374 (29.14%), Postives = 172/374 (45.99%), Query Frame = 3
Query: 1683 IKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNG----ELTYSISE-SSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVL-FERDNKYYLNTTRS-LDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSF---IFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKID---QNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI----DNSKPF---SIGQSNENNRDPN 2735
            I+ +++D NDNAP+ +    N+S+ EN  I       +A D D G NG    EL  S+SE   D+      I +  GD   ++ + +  D ET  +F + + V D G PP+ S     V+V D NDN P F++  ++  V EN     ++ ++   D D   N+Q+  S     N++S      F  D+   L T +  LD E    +   +LASDG+   S    ATV V + D ND+ PS       N  N T  +S +      I  ++V D D+   +NGK + +   DH   F++     ++  + T+  +      ++ I ++A D G PP  +S ++ I I    DN+  F    I  S   N DP 
Sbjct:  165 IRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSVSEFGLDI------IETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFS---NQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSR---ATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDA--DLNGKVTCY--TDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPG 522          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 229.565 bits (584), Expect = 3.282e-62
Identity = 229/775 (29.55%), Postives = 362/775 (46.71%), Query Frame = 3
Query:  387 KVTDNTKENSFISNLNSFDVYSTPYTQNKKFNLL---SNTKANRLFHLHS-NGKLYSA-QTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTF----ECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLN------LQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKI---VNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAI-DYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVLFERD-NKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLV--NDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHG 2636
            +V +  +E +FI N  S D+    Y     + ++   +   A  L  ++   G+L++A + +DRE LC          D C + + + V      +P  F    E RI +EDINDNAP F     T+++ E+ P G  F +  A D DSE   +R Y+L  +   P   S  +   T + N      L + + LDRE+R  YE  L A+D G+PP +G  V+ INV D NDN P   Q   N++  E+      ++++ A D D   NA++V+++              + FR+++NSG + +   L+ E    +R  +  ++       ATATV + V ++ND +P I I D V   N   +I E        VAL TV+D D G  G V C + N E  F++  +  + P N+Y + TR TLD ETK  Y +Q++  D G   L     + + + D NDNAPV       VSV EN  IG  +  ++A D D  KN E+ Y +   +        ++  TG +    ++DRE+ +    ++   +   D+G P         V+V D NDN P F      F V EN     T+G + V D D  +N ++R+S++   N       LF  D     + +    D E+   Y  ++ A+DG G    ++T  V + + D ND++P  + P  +   K++         +  VS  D D++  +N +  +H+V  N H  LF ID   G IT    ++E+  G H + V   D G
Sbjct:   42 RVAEELREGAFIGN-PSVDLRLADYNLELTYKVMLSKAEDAAPPLVRVNPRTGELFAAGRKMDREALC----GGQDPGDECHVDVQVGVLP---VQPGPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSD--PATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLP-VALITVSDPDIGANGAVTCYIYNPEVPFQL--KKLTYP-NQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDA---PTMFHMDPETGIISLTEQLDREKKA----NYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDNRQ-----LFSIDPESGMIRSNVGFDREQRHYYVLEVQATDG-GEPVRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTLPGTIVTEVSAVDNDAE--INAELRYHIVGGNPHN-LFHIDPVIGNITLMEPLTETHHGLHRLVVRVSDIG 786          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 227.254 bits (578), Expect = 1.078e-61
Identity = 206/752 (27.39%), Postives = 342/752 (45.48%), Query Frame = 3
Query:  528 NGKLYSAQTIDREELCINVESCCHKKDPC-DISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENS-----IFPPIFSLEQNRPTGSLN---------------LQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXX-XHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLK--EKLDYERDEQHRFYVEVSNNAGHVD-TATATVLIQVINLNDETPE---IAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI----KLENNVSVYE-----NKPIGTLVTHITAKDIDEGKNGELTYSISE--SSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYS------IQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDN-KYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYI-SYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDH-KGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGN 2639
            +G+L  A  +DRE LC+     C        + ++   K       R  + ++ + DIND+AP FR     ++I ESE VG    LP A D D+   SI+ Y++   S     + P  FSL ++                      L+L ++LDRE    YE +L   D GNP  +G +++ I V+D NDN    +      ++  E       ++++ A D D   N  + +   + +   +       ++  +G + ++  EKLD E    HR  V V+ + G +  +A+ TV +++ + ND  P    IA+      +    I EN    T  V L +V+D D G  G V  RL      F      +S    ++ ++T   LD E    Y + +   D+G P L     + + V D NDN PV      +E +V+VYE     N P GT+V ++ A D D G NG +T+++SE    +   +   +N  TG L     +DRE+       + + +   D G P + +R    V+V DENDNAP F   S       QF V E       +G +   D D+    RV+L +L  E    ++    D     + T   LD E    Y   + A D +G  + +A+  V++ + D ND+AP    PN ++  K++ ++  +  +  ++V+  D+D+ D  NG+  + ++  + KG+F ++ + G ++ +RT+S  D G H + V  RD G 
Sbjct:   80 SGELSVALRLDREALCMEEPDACRSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGP--FSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSF-HTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVV-VARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVV-LISVSDPDLGSSGTVDVRLE-----FPTGAELASPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKR----MRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVAL-NLVREAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVD-SGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVTANDIDAGD--NGRPLYEIIGGNPKGIFLLNADSGALSLARTVSSLDEGLHRLVVRVRDRGG 813          

HSP 2 Score: 138.658 bits (348), Expect = 2.161e-33
Identity = 118/416 (28.37%), Postives = 196/416 (47.12%), Query Frame = 3
Query: 1566 SNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI--KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISE--SSDLTKKYLEINSHTGDLKTR--MKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQ--------FQVTENQQALYTLGEIRVHDKDDNSQLRVSL-VHLPN--EMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASD-GTGYKSHTATATVTVIIEDENDHAPSFIFPNY--SNFTKY-ISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKG-----LFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI----DNSKPFSIGQSNENN 2723
             ++  +  R  LDRE    YEL +  ED G+P L    L+ +VV D NDNAPV        V + E+  +GT V  + A D D G NG + YS     +S  T+  L ++  TG +  R   K+DR    ET+    +++   D GQ  + +     V + D+NDNAP FE  ++Q         ++ EN  +   +  I V D D  S   V + +  P   E++SP        ++ L TTR LD+E+ + Y+  +LA+D GT   S      ++V+  D ND+ P F+ P     +   Y +S  E+     + +++   D+    NG  +F L     G     LF ++   G++T +  +      ++ ++V A D G+P +++  ++ + +    DN+  F +G SN  N
Sbjct:  219 GHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDR----ETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASP-----NKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVV--DINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTF-VGVSNSTN 622          

HSP 3 Score: 112.464 bits (280), Expect = 2.303e-25
Identity = 135/540 (25.00%), Postives = 216/540 (40.00%), Query Frame = 3
Query:  384 IKVTDNTKENSFISNLNSFDVYSTP-----YTQNKKFNLLSNTKANRLFHLHSNGK-----LYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIE--DINDNAPRFRTDKF--------TINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHL---------SQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYEN----KPIGTLV-THITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDL 1901
            +++T+++K  + +  L + D  + P     Y+ + K   L+   A     LH +G      + +A+ +DRE + +      H+         + V  D  +  R+    + +E  D NDNAP F              + I E+ P G+   L   +D D       D +LE    FP    L        L L+  + LD E+  +Y   +LA DRG P K  +L+  I  +   ++   +             Y +   E+  +   +L + A D D   N  + F + +E        + F +   +G + L   LD E+  ++   VE  +       A A V + V++ ND  P       + N    F  E E     +V   + +D D+G   +V   L        I     + P     +RT V LDRE +  YEL +   D G P L A   + + V D NDNAPVI   N    +++     P G LV   +TA DID G NG   Y I   +   K    +N+ +G L
Sbjct:  280 VRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAA-----LHVDGTTGLVTVRNAEKLDRETMPV------HRL--------VVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLE----FPTGAELASPNKVQFL-LKTTRLLDYEEAQQYNVSVLAADRGTP-KLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTL-SELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDT-PGGV--VRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLYEIIGGN--PKGIFLLNADSGAL 788          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 202.601 bits (514), Expect = 9.318e-54
Identity = 177/638 (27.74%), Postives = 284/638 (44.51%), Query Frame = 3
Query:  510 LFHLH-SNGKLYSAQTIDREELCINVESCCHKKDP-CDISLSIAVKSDSIEEPRTF----ECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQK--LDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKN-AFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISES---SDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNA-----PEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKN-YSFKILASDGTGYKSHTATATVTVIIEDEND 2366
            L H+  ++G + + + IDRE+ C    SC  + D  C +             PR         +++ DIND+AP F   +  + I ES  +G+   L  A D D    ++R Y L+EN  F       + R  G+   +L+ K  LDRE+  +Y   L A D G+PP++G  ++ I VLD NDN P  +QT+ N+   E       LL + A D DE  N ++V+      PV  +  + F+++  +G + LK +LD+E + ++   ++  +       A   VL+ V ++ND  PEI +D++ ++  +  F+ E    ++ FV L TV+D D    G V C L  + +   +  RD       Y + T  +LDRE    Y L +E  D G PP  A     V + DENDN P         S+ EN   G  VT +TA D D   NG + Y++ ES         Y+ IN  +G +       R  D E + S    +   D G PP ++     V + DENDNA     P   N +   ++  +    Y +  +R  D D  +   +S   +     + F +     + + N     D       +S  ++  D  G  + +ATA + + +    D
Sbjct:   74 LVHVEEADGTVSAREVIDREQQCGQAPSCVIRFDVLCTL-------------PRGLFQLVHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFGLAL---RARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSF--SSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYES-FVGLVTVSDIDSAENGLVACHLRGHPHFKLLPYRD------DYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYAL----RPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERNLFRINRLGGEVFTNAASVTDAAASATRHSLVVMVRD-RGSPALSATAAIEIRVGAHGD 681          

HSP 2 Score: 146.747 bits (369), Expect = 5.465e-36
Identity = 140/545 (25.69%), Postives = 243/545 (44.59%), Query Frame = 3
Query: 1116 GAKDEDENDNAKMVFKI-VNEQ-----PVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSN--NENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLE-------NNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGD--LKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFV---LFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLV-NDHKGLFKIDQNKGKITT---SRTMSESDMGKHVITVIARDHGNPPKESSILITIVI 2678
            GA+D D   NA   + +  NE+       + D  KY         + +K +LD E++ ++   +   +      + T  V I V++ ND +P  A     + + N  ++E+    T  + L   TD D+G  G+V    S+  +  V  +   D    + K S++ +  LD E    YE+ ++  D G   + A   + V V+D NDNAP IKL+       + V V E     + V  +T  DID  +NG +   +         + ++  +  D  + T   +DREQ    +  + ++L  SD G PP+++ + F V + DENDN P F   + +  + EN      +  +   D D      ++   + +E++   V   +    +   +   R LD+E   + +F++ A D  G       ATV+V I DEND+AP    P   N T  +     A +  L   V   DS    NG+ S+ +V  + + LF+I++  G++ T   S T + +   +H + V+ RD G+P   ++  I I +
Sbjct:  159 GARDLDVGGNALRAYHLDENERFGLALRARTDGAKY-------AELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFA-----QTSCNVTVREDATPGTVLLTL-NATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPK--TGKLSLKGQ--LDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLR-----GHPHFKLLPYRDDYVVVTNSSLDREQ----MADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARD-DGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERNLFRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDRGSPALSATAAIEIRV 676          

HSP 3 Score: 139.428 bits (350), Expect = 9.055e-34
Identity = 141/511 (27.59%), Postives = 228/511 (44.62%), Query Frame = 3
Query: 1212 IEENSGNIYLKEKLDYERDEQH------RFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI-KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDL-TKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFE-NYSIQFQ-----VTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKG------LFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI 2678
            +EE  G +  +E +D E+          RF V  +   G      A V  +++++ND  P+ A      +  +  I E+    T+ V L    D D G        L  NE  F +  R  +  +    +  +  LDRE +G Y LQ+   D GDPP     L+++ V D NDN+PV  +   NV+V E+   GT++  + A D+DEG NGE+ YS S   D   ++  +++  TG L  + ++D E +SE    + + +   D G     +     V V+D NDNAPE + ++ +Q +     V+E       +G + V D D  +N  +   L   P+     F L    + Y + T  SLD E+  +Y   + ASDG G     A    TV + DEND+ P F   + S +   +  + S    + TV+  D D++   NG  ++++V              I+ + G I   R +    M      V ARD G PP  ++  +++ I
Sbjct:   77 VEEADGTVSAREVIDREQQCGQAPSCVIRFDVLCTLPRGLFQLVHAEV--ELLDINDHAPDFA-----RSEMHVEISESVALGTR-VPLEGARDLDVGGNALRAYHLDENER-FGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSE----YEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPH-----FKLLPYRDDYVVVTNSSLDREQMADYFLVLEASDG-GTPPRVAARQFTVRLLDENDNEPRF---HRSTYEASLLENNSPGAYVTTVTAWDADAEH--NGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRI 563          

HSP 4 Score: 58.151 bits (139), Expect = 1.074e-8
Identity = 82/333 (24.62%), Postives = 143/333 (42.94%), Query Frame = 3
Query: 1746 SVYENKPIGTLVTHITAKDIDEGKNGE---LTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQS----FPVILTVSDKGQPPQISRKAF-----DVSVKDENDNAPEFENYSIQFQVTENQQALYT---LGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFER-DNKYY--LNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVN----DHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHG--NPPKESSILITI 2672
            ++YE +P GTLV  ++  D  +G+  E     + +    D +  ++E     G +  R  IDREQ      S    F V+ T         + R  F     +V + D ND+AP+F    +  +++E+  AL T   L   R  D   N+ LR    HL         L  R D   Y  L     LD E+E  Y+ ++ A DG G    + T  V + + D ND++P F     +  +  ++  E A    + +++   D  +  NG+  +   +    + + LF++D   GK++    +      ++ I++ ARD G  + P    +L+ +
Sbjct:   34 ALYEEQPAGTLVGRLS--DDLQGRVAEHPSRHFRLMRRDDFSLVHVE--EADGTVSAREVIDREQQCGQAPSCVIRFDVLCT---------LPRGLFQLVHAEVELLDINDHAPDFARSEMHVEISES-VALGTRVPLEGARDLDVGGNA-LRA--YHLDENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDG-GDPPRSGTTLVRITVLDSNDNSPVF-----AQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHV 343          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004042.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 188.348 bits (477), Expect = 2.507e-48
Identity = 187/697 (26.83%), Postives = 306/697 (43.90%), Query Frame = 3
Query:  657 EPR---TFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQ---TNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTM---------SESDMGKHVITVIARDHGNPP--KESSILITIVIDNS 2687
            EPR   T    + +ED NDN PRF   +    + E  P+GS  +L  ATD D+   +I  Y+L         FS+  N  TG    Q+I    LDRE R  Y   + A+D G  P  G       V+ V D   H  +     Y      S  +   +  + A+D D   N  + F +         A+  F ++   G I+    L   RD+     V VS+      +A  TV ++  +   E P  A        ++   +E++   T    +A  + +     G V   L++  N+ ++   D    S + S+     LD E + +YEL +E  D G PP  A   ++V V D NDNAP          V EN P  T+V  +TA D D G NG++ YSI + +        +N ++G++++   +DRE     + S+ + +  +D+G P Q       +SV DENDN+P F        V E+    + +  +   D D+     ++   L  + S PF +     +  +  +R L+ E    Y+ K+ ASD     + T +  VT++++D ND+AP F    Y     YI + E +E   L   V   D+ D  NG+  F + +  +  F++ ++ G+I + R +         S +++ K+   V A D G PP   ++++ I IV+ N+
Sbjct:    3 EPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGDGH---FSV--NPSTG----QIITTASLDREGRESYVLEVTALDGG--PTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGS------ASAGFSVDPRRGVIHAARALQGPRDDL-TLTVRVSDGGAPPRSAVTTVTVRFRDAG-EFPRFA-----PGPRSFSFREDQPPGTTITVVAARSSRRA---GPVSYHLASGGNLGDVFAVDPQ--SGEVSVHR--ALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVV-LTAVDKDSGINGQVDYSIIDGN--IGNVFRVNPNSGEIRSVSTLDREN----VASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQI-FSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLL--DPSLPFSIHPSTGE--ITVSRRLNREDRSGYAVKVRASD----PAWTVSTDVTIVVDDVNDNAPRFGQTAY-----YIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTEN-FRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNA 646          

HSP 2 Score: 167.548 bits (423), Expect = 6.200e-42
Identity = 178/697 (25.54%), Postives = 301/697 (43.19%), Query Frame = 3
Query:  513 FHLHSNGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIE--DINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKE--NEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGY------YELQMECEDKGDPPLRAKALIKVVVKDENDNAP-VIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITT 2570
            +HL S G L     +D +   ++V      +      L +  + DS   P +   +++++  DINDNAP F + +F   + E+ P  ++  L  A D DS      DY + + +I   +F +  N    S  ++ +  LDRE  A YE  + A DRG+P +   + + I+V D NDN P  +Q  ++    E      P+L++   D DE  NA + F ++       D +  F I  ++G I +  +L+ E    +   V  S+ A  V T    V I V ++ND  P           + A+  E     +    VA  + +D D G  GQV   + +    F +  RDS      +S+R     D    G       Y   +   D+G PPL + A + + +   N NAP  ++   +  V      GT +  ++A D D   NG++ YS+   +    +  ++++  G L  R  +  +  S     F V +   D+G+PP  SR    +SV +EN  AP F +  ++  + EN  A  +L  +   D D      +       + S  F +        L     LD+E EK Y+  + A+DG G+++ T  + V++ + D ND+ P     N S++   I  +  +   +L +   D DS    N    + L +    LF ++Q  G +TT
Sbjct:  267 YHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEAR-DSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVL-TAVDKDSGINGQVDYSIIDGNIGN-VFRVNPN----SGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQI-FSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLL-------DPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASDPAWTVST---DVTIVVDDVNDNAPRF--------GQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFRV-GRDSG---EIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGN--ASRRFDVDAG-GFLHLRASLAGDAGS----IFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLL--VGELDYETEKLYNLSVCAADG-GWQAKTECSGVSISVTDVNDNPPML---NASDYYPVIPENAPSGTTVLVMDAVDADSPS--NAVTMYSLDDGEADLFVLNQKTGVLTT 918          

HSP 3 Score: 138.272 bits (347), Expect = 5.176e-33
Identity = 159/692 (22.98%), Postives = 271/692 (39.16%), Query Frame = 3
Query:  681 IQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEES----KFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKV--------DANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRL--SNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFE--RDNKYYLNTTRSLDWEKEKN---------YSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGK-HVITVIARDHGNPPKESSILITIVI 2678
            + + D+ND+ PRF    +      S P G+      A D D+      D +   +      FS++  R      +    +  +  R      +   D G PP++                   + T   +++ ++    +F+  P      +D+       +V    + +   V        +    F ++  SG + +   LD+E    +   VE  ++     +A   + + V+++ND  PE        ++   + K  E+   + + + T  DKD G+ GQV   +   N  NVF ++        N   IR+  TLDRE    YEL ++  D+G P       + + V DENDN+P      +  V E+  +G  V  ++  D DEG N  +T+S+ + S        I+  TG++    +++RE  S     + V +  SD   P         + V D NDNAP F   +   +  E  +    +  +   D DD +  +V        M S    F   RD+   +++ R L +              YSF + A D  G    ++ ATVT+ I   N +AP F+   YS     ++    A   IL +S  D D    +NG+ ++ +V  +    + D + G     R     D G    +TV ARD G PP  S     I +
Sbjct:  118 VAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNG--DLRFSLSGSASAGFSVDPRR-----GVIHAARALQGPRDDLTLTVRVSDGGAPPRS-------------------AVTTVTVRFRDAGEFPRFAPGPRSFSFREDQPPGTTITVVAARSSRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEF-------SSSRFWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSIIDGNIGNVFRVN-------PNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPS----LPFSIHPSTGEITVSRRLNREDRS----GYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFF-----MRSQTENFRVGRDSGE-IHSVRPLRYRDPAGGGSGANLNKYSFVVTAMD-RGRPPLSSDATVTINIVVPNANAPRFLRERYST---PVAATVRAGTRILDMSAVDPDRD--VNGQIAYSVVGGNASR-RFDVDAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISV 745          

HSP 4 Score: 137.117 bits (344), Expect = 1.238e-32
Identity = 148/564 (26.24%), Postives = 231/564 (40.96%), Query Frame = 3
Query:  681 IQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLS---QTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHV---DTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKN-GELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEK--EKNYSFKILASDGTGYKSHTATATVTV 2345
            I + D+NDN P      +   I E+ P G+   +  A D DS   ++  Y L++      +F L Q   TG L  Q    LD E +  YE  + A    N P T         + +     +     Q  YN    ES     P+  + A D D   +  + + +  E       +K F + E++G I +  +LD ER+      V ++ NAG +   D     V + + + ND  P +    +        + E     T  V + +  D D   G +    L  + N      R  SI ++   I     LDRE+   Y L +   D G+PP     ++ V ++D NDN P + L ++  V EN+P G  V ++ A D D   N G  T+ +  S    + Y  ++S +G LKT   IDREQ  E    F + + ++D G PP  S     +SV D+NDN  E  +  +      +      +G++R  D D + +    L       S PF +F     +  NT R +   +  E  +   +  SDG   K   AT T  V
Sbjct:  848 ISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEA--DLFVLNQK--TGVLTTQGF--LDYETKQTYELTVRAF---NYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGES-----RSKGFSVNEHTGEIIVSSQLDREREASATLRV-IAKNAGSIRGFDVDEVLVNVAITDAND--PPVFSSALYHGR----VSEAASVGTHVVGV-SAHDFDSPPGWRTFSFLIQSGNA----GRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFL-LTSSAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSS-SGLLKTARPIDREQKPE----FHLPVAIADAGSPPLTSTVTLHLSVLDQNDNPSEARDVRVHVNYFGSPFPGGFIGDVRPRDPDISDRFNCDLT------SGPFNVF----SFQPNTCRLISQPRSAEGRFELSVRGSDG---KHSPATTTARV 1366          

HSP 5 Score: 131.724 bits (330), Expect = 5.088e-31
Identity = 166/704 (23.58%), Postives = 289/704 (41.05%), Query Frame = 3
Query:  681 IQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAP-VIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQD-SETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRV-SLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVND---HKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSIL--ITIVIDNSKPFSIGQSNENNRDPNYVNKKFSGHFI 2768
            I I   N NAPRF  ++++  +  +   G+      A D D +      Y +   +      S   +   G   L L   L  +  + +   + A DRG PP + R    I+V + N   P  +     +   E+  +   L ++ A D D   N  +V+ I +      D +  F I   SG++ L  +LDYE ++ +   V  ++      T  + V I V ++ND  P      +N ++    I EN    T  + +  V D D          L + E    + N+ + +      + T+  LD ETK  YEL +   +  D    + A + V +   N+  P  ++ E N  V E+ P+G  V  + A D D G +G + Y +   S    K   +N HTG++    ++DRE++ S TL+   VI   +   +   +     +V++ D ND  P F +     +V+E       +  +  HD D     R  S +         F +    +   +     LD E    Y+  ++A D  G    T T  V V +ED ND+ P F+  + +  T+    ++ A + +L +  GD D   +  G  +F L+      +G F +  + G + T+R +      +  + V   D G+PP  S++   ++++  N  P    ++ +     NY    F G FI
Sbjct:  639 INIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNA-----SRRFDVDAGGF-LHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASG-----DGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPP-----MLNASDYYPVIPENAPSGTTVLVMDAV-DADSPSNAVTMYSLDDGEADLFVLNQKTGV------LTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGES--RSKGFSVNEHTGEIIVSSQLDREREASATLR---VIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSI--NAHTGLIVVASPLDRESVPLYNLTVVAVD-MGEPPATGTTVVVVALEDVNDNGP-FLLTSSAKVTE----NQPAGMTVLNLEAGDPDLPPN-KGPYTFQLLGSDPAWRGYFSL-SSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNP---SEARDVRVHVNYFGSPFPGGFI 1300          

HSP 6 Score: 121.709 bits (304), Expect = 6.980e-28
Identity = 159/692 (22.98%), Postives = 279/692 (40.32%), Query Frame = 3
Query:  681 IQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDD--------------SEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSS----IPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVY-ENKPIGTLVTHITAKDIDEGKNGELTYSISES-SDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTA-TATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIA--ILTVSVGDLDSKDSMNGKCSFHLVNDHKG-LFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDN 2684
            I ++D+NDNAPRF    + I   E     +L +   A+D D              +E + +     E +S+ P    L    P G  +   + K        Y FV+ A+DRG PP +    + IN++  N N P   +  Y+     +  +   +L + A D D + N ++ + +V       +A++ F ++   G ++L+  L  +        VE  +      ++ AT +I V   N   P  A   +  +     + EN    +  +A  T TD D G+ G +         V+ I + D S    I      +     LD ET+  Y L +   D G       + + + V D NDN P++   +   V  EN P GT V  + A D D   N    YS+ +  +DL      +N  TG L T+  +D E    T Q++ + +   +       S     V +   N+  P F      F V+E+      +G +   D+D      V  +      S  F + E   +  +++   LD E+E + + +++A +    +        V V I D ND       P +S+   +    E+A +   ++ VS  D DS        SF + + + G  F I+ + G I  +  +    +  + +TV+A D G PP   + ++ + +++
Sbjct:  527 IVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFRVGRDSGEIHSVRP----LRYRDPAGGGSGANLNK--------YSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGG-----NASRRFDVDAG-GFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELS-----LPENHPAGSS-LARVTATDTDAGVNGAI---------VYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADL----FVLNQKTGVLTTQGFLDYE----TKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSS--QLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDP------PVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWR-TFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALED 1168          

HSP 7 Score: 102.834 bits (255), Expect = 3.767e-22
Identity = 94/360 (26.11%), Postives = 154/360 (42.78%), Query Frame = 3
Query: 1650 KGDPPLRAKALIKVVVKDENDNAPVI-KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKA-FDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDD--NSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDH--KGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI----DNSKPFS 2699
             G+P L     + V+V+DENDN P     E   +V E+ PIG+ V  + A D D G N  ++Y +         +  +N  TG + T   +DRE      +S+ + +T  D G  P +S  A   V+V D ND+ P F N         +  A   +  +   D D   N  LR SL       S+ F +  R  +  ++  R+L   ++ + +  +  SDG G    +A  TVTV   D  +      FP ++   +  S+ E          V    S+ +  G  S+HL +      +F +D   G+++  R +       + + V ARD G PP  + + + + +    DN+  FS
Sbjct:    1 AGEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGG----DGHFSVNPSTGQIITTASLDREGR----ESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLS---GSASAGFSVDPR--RGVIHAARALQGPRD-DLTLTVRVSDG-GAPPRSAVTTVTVRFRDAGE------FPRFAPGPRSFSFREDQPPGTTITVVAARSSRRA--GPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFS 337          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004043.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 188.348 bits (477), Expect = 2.520e-48
Identity = 187/697 (26.83%), Postives = 306/697 (43.90%), Query Frame = 3
Query:  657 EPR---TFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQ---TNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTM---------SESDMGKHVITVIARDHGNPP--KESSILITIVIDNS 2687
            EPR   T    + +ED NDN PRF   +    + E  P+GS  +L  ATD D+   +I  Y+L         FS+  N  TG    Q+I    LDRE R  Y   + A+D G  P  G       V+ V D   H  +     Y      S  +   +  + A+D D   N  + F +         A+  F ++   G I+    L   RD+     V VS+      +A  TV ++  +   E P  A        ++   +E++   T    +A  + +     G V   L++  N+ ++   D    S + S+     LD E + +YEL +E  D G PP  A   ++V V D NDNAP          V EN P  T+V  +TA D D G NG++ YSI + +        +N ++G++++   +DRE     + S+ + +  +D+G P Q       +SV DENDN+P F        V E+    + +  +   D D+     ++   L  + S PF +     +  +  +R L+ E    Y+ K+ ASD     + T +  VT++++D ND+AP F    Y     YI + E +E   L   V   D+ D  NG+  F + +  +  F++ ++ G+I + R +         S +++ K+   V A D G PP   ++++ I IV+ N+
Sbjct:    3 EPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGDGH---FSV--NPSTG----QIITTASLDREGRESYVLEVTALDGG--PTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGS------ASAGFSVDPRRGVIHAARALQGPRDDL-TLTVRVSDGGAPPRSAVTTVTVRFRDAG-EFPRFA-----PGPRSFSFREDQPPGTTITVVAARSSRRA---GPVSYHLASGGNLGDVFAVDPQ--SGEVSVHR--ALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVV-LTAVDKDSGINGQVDYSIIDGN--IGNVFRVNPNSGEIRSVSTLDREN----VASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQI-FSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLL--DPSLPFSIHPSTGE--ITVSRRLNREDRSGYAVKVRASD----PAWTVSTDVTIVVDDVNDNAPRFGQTAY-----YIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTEN-FRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNA 646          

HSP 2 Score: 167.548 bits (423), Expect = 7.023e-42
Identity = 178/697 (25.54%), Postives = 301/697 (43.19%), Query Frame = 3
Query:  513 FHLHSNGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIE--DINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKE--NEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGY------YELQMECEDKGDPPLRAKALIKVVVKDENDNAP-VIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITT 2570
            +HL S G L     +D +   ++V      +      L +  + DS   P +   +++++  DINDNAP F + +F   + E+ P  ++  L  A D DS      DY + + +I   +F +  N    S  ++ +  LDRE  A YE  + A DRG+P +   + + I+V D NDN P  +Q  ++    E      P+L++   D DE  NA + F ++       D +  F I  ++G I +  +L+ E    +   V  S+ A  V T    V I V ++ND  P           + A+  E     +    VA  + +D D G  GQV   + +    F +  RDS      +S+R     D    G       Y   +   D+G PPL + A + + +   N NAP  ++   +  V      GT +  ++A D D   NG++ YS+   +    +  ++++  G L  R  +  +  S     F V +   D+G+PP  SR    +SV +EN  AP F +  ++  + EN  A  +L  +   D D      +       + S  F +        L     LD+E EK Y+  + A+DG G+++ T  + V++ + D ND+ P     N S++   I  +  +   +L +   D DS    N    + L +    LF ++Q  G +TT
Sbjct:  267 YHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEAR-DSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVL-TAVDKDSGINGQVDYSIIDGNIGN-VFRVNPN----SGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQI-FSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLL-------DPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASDPAWTVST---DVTIVVDDVNDNAPRF--------GQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFRV-GRDSG---EIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGN--ASRRFDVDAG-GFLHLRASLAGDAGS----IFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLL--VGELDYETEKLYNLSVCAADG-GWQAKTECSGVSISVTDVNDNPPML---NASDYYPVIPENAPSGTTVLVMDAVDADSPS--NAVTMYSLDDGEADLFVLNQKTGVLTT 918          

HSP 3 Score: 138.272 bits (347), Expect = 6.065e-33
Identity = 159/692 (22.98%), Postives = 271/692 (39.16%), Query Frame = 3
Query:  681 IQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEES----KFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKV--------DANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRL--SNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFE--RDNKYYLNTTRSLDWEKEKN---------YSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGK-HVITVIARDHGNPPKESSILITIVI 2678
            + + D+ND+ PRF    +      S P G+      A D D+      D +   +      FS++  R      +    +  +  R      +   D G PP++                   + T   +++ ++    +F+  P      +D+       +V    + +   V        +    F ++  SG + +   LD+E    +   VE  ++     +A   + + V+++ND  PE        ++   + K  E+   + + + T  DKD G+ GQV   +   N  NVF ++        N   IR+  TLDRE    YEL ++  D+G P       + + V DENDN+P      +  V E+  +G  V  ++  D DEG N  +T+S+ + S        I+  TG++    +++RE  S     + V +  SD   P         + V D NDNAP F   +   +  E  +    +  +   D DD +  +V        M S    F   RD+   +++ R L +              YSF + A D  G    ++ ATVT+ I   N +AP F+   YS     ++    A   IL +S  D D    +NG+ ++ +V  +    + D + G     R     D G    +TV ARD G PP  S     I +
Sbjct:  118 VAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNG--DLRFSLSGSASAGFSVDPRR-----GVIHAARALQGPRDDLTLTVRVSDGGAPPRS-------------------AVTTVTVRFRDAGEFPRFAPGPRSFSFREDQPPGTTITVVAARSSRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEF-------SSSRFWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSIIDGNIGNVFRVN-------PNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPS----LPFSIHPSTGEITVSRRLNREDRS----GYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFF-----MRSQTENFRVGRDSGE-IHSVRPLRYRDPAGGGSGANLNKYSFVVTAMD-RGRPPLSSDATVTINIVVPNANAPRFLRERYST---PVAATVRAGTRILDMSAVDPDRD--VNGQIAYSVVGGNASR-RFDVDAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISV 745          

HSP 4 Score: 137.117 bits (344), Expect = 1.379e-32
Identity = 148/564 (26.24%), Postives = 231/564 (40.96%), Query Frame = 3
Query:  681 IQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLS---QTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHV---DTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKN-GELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEK--EKNYSFKILASDGTGYKSHTATATVTV 2345
            I + D+NDN P      +   I E+ P G+   +  A D DS   ++  Y L++      +F L Q   TG L  Q    LD E +  YE  + A    N P T         + +     +     Q  YN    ES     P+  + A D D   +  + + +  E       +K F + E++G I +  +LD ER+      V ++ NAG +   D     V + + + ND  P +    +        + E     T  V + +  D D   G +    L  + N      R  SI ++   I     LDRE+   Y L +   D G+PP     ++ V ++D NDN P + L ++  V EN+P G  V ++ A D D   N G  T+ +  S    + Y  ++S +G LKT   IDREQ  E    F + + ++D G PP  S     +SV D+NDN  E  +  +      +      +G++R  D D + +    L       S PF +F     +  NT R +   +  E  +   +  SDG   K   AT T  V
Sbjct:  848 ISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEA--DLFVLNQK--TGVLTTQGF--LDYETKQTYELTVRAF---NYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGES-----RSKGFSVNEHTGEIIVSSQLDREREASATLRV-IAKNAGSIRGFDVDEVLVNVAITDAND--PPVFSSALYHGR----VSEAASVGTHVVGV-SAHDFDSPPGWRTFSFLIQSGNA----GRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFL-LTSSAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSS-SGLLKTARPIDREQKPE----FHLPVAIADAGSPPLTSTVTLHLSVLDQNDNPSEARDVRVHVNYFGSPFPGGFIGDVRPRDPDISDRFNCDLT------SGPFNVF----SFQPNTCRLISQPRSAEGRFELSVRGSDG---KHSPATTTARV 1366          

HSP 5 Score: 131.724 bits (330), Expect = 5.620e-31
Identity = 166/704 (23.58%), Postives = 289/704 (41.05%), Query Frame = 3
Query:  681 IQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAP-VIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQD-SETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRV-SLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVND---HKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSIL--ITIVIDNSKPFSIGQSNENNRDPNYVNKKFSGHFI 2768
            I I   N NAPRF  ++++  +  +   G+      A D D +      Y +   +      S   +   G   L L   L  +  + +   + A DRG PP + R    I+V + N   P  +     +   E+  +   L ++ A D D   N  +V+ I +      D +  F I   SG++ L  +LDYE ++ +   V  ++      T  + V I V ++ND  P      +N ++    I EN    T  + +  V D D          L + E    + N+ + +      + T+  LD ETK  YEL +   +  D    + A + V +   N+  P  ++ E N  V E+ P+G  V  + A D D G +G + Y +   S    K   +N HTG++    ++DRE++ S TL+   VI   +   +   +     +V++ D ND  P F +     +V+E       +  +  HD D     R  S +         F +    +   +     LD E    Y+  ++A D  G    T T  V V +ED ND+ P F+  + +  T+    ++ A + +L +  GD D   +  G  +F L+      +G F +  + G + T+R +      +  + V   D G+PP  S++   ++++  N  P    ++ +     NY    F G FI
Sbjct:  639 INIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNA-----SRRFDVDAGGF-LHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASG-----DGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPP-----MLNASDYYPVIPENAPSGTTVLVMDAV-DADSPSNAVTMYSLDDGEADLFVLNQKTGV------LTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGES--RSKGFSVNEHTGEIIVSSQLDREREASATLR---VIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSI--NAHTGLIVVASPLDRESVPLYNLTVVAVD-MGEPPATGTTVVVVALEDVNDNGP-FLLTSSAKVTE----NQPAGMTVLNLEAGDPDLPPN-KGPYTFQLLGSDPAWRGYFSL-SSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNP---SEARDVRVHVNYFGSPFPGGFI 1300          

HSP 6 Score: 121.324 bits (303), Expect = 7.582e-28
Identity = 159/692 (22.98%), Postives = 279/692 (40.32%), Query Frame = 3
Query:  681 IQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDD--------------SEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSS----IPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVY-ENKPIGTLVTHITAKDIDEGKNGELTYSISES-SDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTA-TATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIA--ILTVSVGDLDSKDSMNGKCSFHLVNDHKG-LFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDN 2684
            I ++D+NDNAPRF    + I   E     +L +   A+D D              +E + +     E +S+ P    L    P G  +   + K        Y FV+ A+DRG PP +    + IN++  N N P   +  Y+     +  +   +L + A D D + N ++ + +V       +A++ F ++   G ++L+  L  +        VE  +      ++ AT +I V   N   P  A   +  +     + EN    +  +A  T TD D G+ G +         V+ I + D S    I      +     LD ET+  Y L +   D G       + + + V D NDN P++   +   V  EN P GT V  + A D D   N    YS+ +  +DL      +N  TG L T+  +D E    T Q++ + +   +       S     V +   N+  P F      F V+E+      +G +   D+D      V  +      S  F + E   +  +++   LD E+E + + +++A +    +        V V I D ND       P +S+   +    E+A +   ++ VS  D DS        SF + + + G  F I+ + G I  +  +    +  + +TV+A D G PP   + ++ + +++
Sbjct:  527 IVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFRVGRDSGEIHSVRP----LRYRDPAGGGSGANLNK--------YSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGG-----NASRRFDVDAG-GFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELS-----LPENHPAGSS-LARVTATDTDAGVNGAI---------VYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADL----FVLNQKTGVLTTQGFLDYE----TKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSS--QLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDP------PVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWR-TFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALED 1168          

HSP 7 Score: 102.834 bits (255), Expect = 4.092e-22
Identity = 94/360 (26.11%), Postives = 154/360 (42.78%), Query Frame = 3
Query: 1650 KGDPPLRAKALIKVVVKDENDNAPVI-KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKA-FDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDD--NSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDH--KGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI----DNSKPFS 2699
             G+P L     + V+V+DENDN P     E   +V E+ PIG+ V  + A D D G N  ++Y +         +  +N  TG + T   +DRE      +S+ + +T  D G  P +S  A   V+V D ND+ P F N         +  A   +  +   D D   N  LR SL       S+ F +  R  +  ++  R+L   ++ + +  +  SDG G    +A  TVTV   D  +      FP ++   +  S+ E          V    S+ +  G  S+HL +      +F +D   G+++  R +       + + V ARD G PP  + + + + +    DN+  FS
Sbjct:    1 AGEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGG----DGHFSVNPSTGQIITTASLDREGR----ESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLS---GSASAGFSVDPR--RGVIHAARALQGPRD-DLTLTVRVSDG-GAPPRSAVTTVTVRFRDAGE------FPRFAPGPRSFSFREDQPPGTTITVVAARSSRRA--GPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFS 337          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 213.772 bits (543), Expect = 4.823e-56
Identity = 194/686 (28.28%), Postives = 320/686 (46.65%), Query Frame = 3
Query:  666 TFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQV-HCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKG-LFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKE----SSILITIVIDNSKPFSIG 2705
            T +  I IED+ND++P F    ++  I ES  +GS      ATD DS      +Y+L   ++    F+++ N    S ++++  +LDRE    Y   + A D G+  ++         L   ++   + Q  Y  +  ES      + ++ A D D++ N  + + + +   V       F I  ++G I LK +LDYE+  Q+   V   +      ++   V + V ++ND  P+ A     ++     + EN       V   T TD D G  G++ +  LS NEN+    +R +        I TRV LDRET   Y L +  +D       A   + + + DENDN P     +  ++ E+ P GT V  +TA D D G NG +TY+I   +       +++  +G L  R  +DRE    T+ S+ +++  SD G P Q    +  VSV D NDNAP FE      ++ E+     T+ +++V DKD+ S   ++L  L  E S  F +   D+  ++ +   LD+E    Y   + A DG G  S +ATA V + I + ND+ PSF+ P      +  S  E  ++AI T  V  L++ DS     +F +V  + G  FKIDQ+ G I+ ++ +       + + V A + G+  +     ++I +  V DN+  F+ G
Sbjct:  461 TAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNV-KGAFNIDAN----SGSIRVSSELDRETTPSYSLQVEARDGGSTSRS-SSTRVTIALQDINDNSPIFQGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDV-------FSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFA-----KSLYTCTVGENLAAGVA-VCYVTATDADSGANGKISYSILSGNENMAFAMDRFTG------EITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQ--GNSFQLDPRSGILSVRSTLDRE----TIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITL-SLSGEGSDNFTI---DSTGFVLSKTPLDYETTAAYQLTVTARDG-GSPSKSATAQVKITIINVNDNVPSFVSP-----AQVTSIPE--DVAINT-HVVKLNATDSDGTPLTFDIVEGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPG 1102          

HSP 2 Score: 188.348 bits (477), Expect = 3.329e-48
Identity = 199/741 (26.86%), Postives = 343/741 (46.29%), Query Frame = 3
Query:  528 NGKL-YSAQTIDREELCINVESCCHKKDPCD----ISLSIAVKSDSIEEP-RTFECRIQIE--DINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRL--SNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKD---SMNGKCSFHLVNDHKG-LFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKE--SSILITI--VIDNSKPF 2696
            N +L YS  + D     ++ +     K   D     S  +A+++     P R+ +  ++IE  D+NDN P F + ++T ++ E   +G+      A+D D+   +   Y     +     F+L+    TG + +   + LD E+R+ Y   L   DRG+PP T    + INV D+NDNPP  S + Y  + +E+  +     ++ A D D + N  +VF I+     K + +  F I+ ++G I + +  DYE   ++   V+  +    V   TA V I + ++ND +P       + +N +  I E+    +  V + T TD D G  G++  RL   N +  F I        +N  SIR    LDRET   Y LQ+E  D G     +   + + ++D NDN+P+ +      V E+   G  +  + A D D+  NG++ Y++S+++D+      IN+ TG +  + ++D E+ ++    + V +T  D G P + S     V V D NDN P+F        V EN  A   +  +   D D  +  ++S   L    +  F +     +  + T   LD E   +YS  I A DG+  +   AT TV + I DEND+ P+F  P+  N          +E +     VG L + D     NG  ++ +++ ++G  F++D   G ++   T+    +  + + V A D G+P +   +SI +++  V DN+  F
Sbjct:  200 NARLSYSLVSGDTSYFTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHA-FTLDA--VTGVVTVS--RSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT---QVSATDRDSSTNGALVFGII-----KGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSP-----VFSPSNYSKQIPESTVIGSTVVTV-TATDLDSGPRGRLEYRLISGNVKGAFNID-------ANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDV----FSINTSTGLITLKTQLDYEKKTQ----YMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGE--ITTRVPLDRETIASYSLTINADDGSLVRFMAAT-TVNISIADENDNQPTFTGPSRFNI---------SEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRF 894          

HSP 3 Score: 182.185 bits (461), Expect = 2.836e-46
Identity = 198/778 (25.45%), Postives = 350/778 (44.99%), Query Frame = 3
Query:  360 KCKSEPCDIKVTDNTKENSFISNLNSFDVYSTPYTQNKKFNLLSNTKANRLFHLHSNGKLYSAQTIDREELCINVESCCHKKDPCDISLSI-AVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLE--ENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQV-HCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNV-SVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI 2678
            +  S P D+ +      N+ +  LN+ D   TP T    F+++     +      S+G +  A+ +DRE                + +L + A ++ S  E       I++ D+NDNAP F    +  ++ E+ P+G   +   ATD D  + +   Y+L   + S F      E N  TG +  +  + LDRE +A Y   + A+D G P ++    I + + D+NDN P  SQ+ Y +   E+  +   +L++ A D D   N ++ + I++      +    FRI+  +G I +   +D E    +   +   ++      +TA V I V + ND +P  A      N  +  I E     ++ VA+ T TD+D+G   QV +  +  + + F I+  +  +   K        ++RET   Y L +   D+G P + +   + VVV D NDN PV   ++ + SV EN    T V  + A D D G N  L YSI   +D  +K  +INS +G + T   +D E+ S+    + + +T +D       ++    + V + ND  P F   +    V EN     ++ ++   D+D    L  S+V    + S  F + +R     ++T   LD E    Y+ ++  +D  G    +    VT+ I DEND++P F      + +   S  E++  +  +  +   D+ +  N + +++L  +    F I  + G IT ++ +   +   + + + ARDHG PP+ SSI I + +
Sbjct: 1002 QVTSIPEDVAI------NTHVVKLNATDSDGTPLT----FDIVEGNAGSSFKIDQSSGLISVAKRLDRETTA-------------NYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKF------EVNPATGLVTTK--RPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISG-----NHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFA-----SNETSYGIDEGVSIGSR-VAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKE-------INRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGND--EKRFKINSTSGVIMTTTPLDFEEKSQ----YGLEVTATDS---KYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVG--GKDSDKFSIDQRSG--IISTADVLDRELVSLYAIQVRVTDA-GNPPLSNLTWVTIKILDENDNSPKF-----DSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDA--FMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTV 1709          

HSP 4 Score: 176.407 bits (446), Expect = 1.636e-44
Identity = 173/667 (25.94%), Postives = 311/667 (46.63%), Query Frame = 3
Query:  666 TFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKL-EENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRL--SNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRS-------LDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGL-FKIDQNKGKITTSRTMSESDMGKHVITVIARD 2630
            TF   I ++D+NDNAP F    +   + E   VGS+     A D D    +   Y L   ++ +  + S    R  G+         DRE +A Y+  L A D G+P ++G+  + I +LDVNDN P  S   Y    +E       ++ + A D+D  +NA + +   +      + N  F ++  +G + +   LD+E+   +   + V++      T T+ +LI V ++ND  P       + +   + +KEN    T+  A    TD+D    G +   +   N++ VF I      I   K       + D E K  Y+L ++  D+G P     A + + ++D ND++PV    N +  + E+  IG+ V  +TA D+D G  G L Y +   +   K    I++++G ++   ++DR    ET  S+ + +   D G   + S     ++++D NDN+P F+   + F+V+E+    + +G++   D DD+S   V            + L +  + + +NT+         LD+EK+  Y   + A DG G  S ++   V V+++D ND+ P F     S +T  +  + +A +A+  V+  D DS    NGK S+ +++ ++ + F +D+  G+ITT   +    +  + +T+ A D
Sbjct:  151 TFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVDSQGVIRTKGA--------FDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSG-----NTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPP-----VFSPSAYQSRVKENTPAGTQVSA----TDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAK-------SPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGN--VKGAFNIDANSGSIRVSSELDR----ETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYV-FRVSESSSPGHQIGQVAATDADDSSNGDVR-----------YALSDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDG-GTPSRSSLTVVKVMVDDVNDNPPQFA---KSLYTCTVGENLAAGVAVCYVTATDADS--GANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADD 764          

HSP 5 Score: 171.014 bits (432), Expect = 8.195e-43
Identity = 208/745 (27.92%), Postives = 336/745 (45.10%), Query Frame = 3
Query:  504 NRLFHLHSNGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVK-SDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATD-DDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQV-HCRLSNNE-NVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNV---SVYENKPIGTLVTHITAKDIDEGKNGELTYSIS-ESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYL-NTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI----DNSKPFS 2699
             RL +   +G +  A  ID     I V S   ++     SL +  +   S     +    I ++DINDN+P F+   +   + ES   G       ATD DDS    +R Y L +N+    +FS+  N  TG + L+   +LD EK+ +Y   + A D G P ++   V+ + V DVNDNPP  +++ Y     E+  +   +  + A D D   N K+ + I++      + N  F ++  +G I  +  LD E    +   +   + +     A  TV I + + ND  P     +   +  N  I E+    T+ V   T TD+D G  G V +  +S N+ N F++  R     S   S+R+  TLDRET   Y L ++  D G P     A I V V D NDNAP  + E ++    + E+  + + V  +  +D DEG NG +T S+S E SD       I+S TG + ++  +D E    T  ++ + +T  D G P + +     +++ + NDN P F + +    + E+      + ++   D D  + L   +V   N  SS    F+ D    L +  + LD E   NY+  + A++ TG +  +     T+ + D ND+AP F   N  ++ K  S HE+  I      V   D  +  N K ++ L       F+++   G +TT R +   D   + + V A DHG P + +   IT+ I    DNS  FS
Sbjct:  511 GRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQ-GPYVFRVSESSSPGHQIGQVAATDADDSSNGDVR-YALSDNT---DVFSI--NTSTGLITLK--TQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSG-----NENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPT----FTGPSRFN--ISEDSPTGTR-VGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPR-----SGILSVRS--TLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAP--RFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSD----NFTIDS-TGFVLSKTPLDYE----TTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSD-GTPLTFDIVE-GNAGSS----FKIDQSSGLISVAKRLDRETTANYTLVVRATE-TGSQGESVYNNATIRVLDVNDNAPVF---NPGSYAK--SLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFS 1204          

HSP 6 Score: 162.925 bits (411), Expect = 2.445e-40
Identity = 184/726 (25.34%), Postives = 311/726 (42.84%), Query Frame = 3
Query:  477 FNLLSNTKANRLFHLHSNGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPR---TFECRIQIEDINDNAPRFRTDKFTINIKESEPVGS-LFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQK-LDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEI-AIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLS-NNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARD 2630
            + ++S  + N       +G L    T+DRE +                S ++ VK+     P+   T    + + D+NDNAPRF    F+  I+E   V S +  + +   D+    +I      E S          N    S    L +  LD E  A Y+  + A D G+P K+    + I +++VNDN P            E       ++K+ A D   +D   + F IV     + +A   F+I+++SG I + ++LD E    +   V  +      ++      I+V+++ND  P      Y    ++N  I +        VA  T TD+D+G   +V   LS  + + FE++      P+    + T+  LDRE +  Y L++   D G P   A A I + + D NDN+P        ++V EN   G+ +  + A D D G NG +TYSI   +        I+S TG +     +DRE     L S+ + ++  D G PP +S     ++V DENDN+P F +    + + E       +  +   D+D+ S  +V    +    +S F +   +    L   + ++ E    Y+  I ASD  G    T+   +TV++ D ND+ P F   N  ++   +  + +   ++LTV+  D D   +   + S    ND K  FKI+   G I T+  +   +  ++ + V A D
Sbjct:  826 YAIISGNQGNSFQLDPRSGILSVRSTLDRETIP---------------SYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGS---------DNFTIDSTGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATD---SDGTPLTFDIV-----EGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQT-------VAKVTATDRDEGENAKVTYELSVGDTSKFEVN------PATGL-VTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNH--GNAFRIDSTTGRITVVGVVDREA----LASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQV-FYSIVRGDTSAFAINAMNG--VLTVKKEINRETVPTYTLTIRASD-RGSPMMTSDKELTVVVNDVNDNPPVF---NSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEK-RFKINSTSGVIMTTTPLDFEEKSQYGLEVTATD 1491          

HSP 7 Score: 162.925 bits (411), Expect = 2.508e-40
Identity = 187/671 (27.87%), Postives = 295/671 (43.96%), Query Frame = 3
Query:  477 FNLLSNTKANRLFHLHSNGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEP--RTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSN-NENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI-KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYY-LNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLD 2474
            ++++S    N      + G++     +DRE L                +L+I+ K DS   P   T    I + D NDN+P F +++ +  I E   +GS  ++  ATD D    +   Y +         F++  N   G L ++  ++++RE    Y   + A DRG+P  T    + + V DVNDNPP  +  +Y     E+      +L + A D D   NA + + I++         K F+I   SG I     LD+E   Q+   V  +++     TA   V I+VINLND TP        + N  A ++EN    T  V ++  +D+D   G   +  +   + + F I  R S I      I T   LDRE    Y +Q+   D G+PPL     + + + DENDN+P       + S+ EN    +    + A D DEG N  +TY++S           I + +G +     +DRE  S    ++ + +   D G PPQ S     V+V D ND+ P   + S++  V ENQ     +  I   D D      ++   L NE  S F L   DN    ++T   LD E++  Y+ +I  +D  G  S ++ A V + + DE+D+ P F  P   N T   S    A  +I+ V+  D+D
Sbjct: 1240 YSIISGNHGNAFRIDSTTGRITVVGVVDREALA-------------SYNLTISAK-DSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDT--SAFAI--NAMNGVLTVK--KEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGND-----EKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSKY---TAKTNVTIRVINLNDITPAF-----TQQNYTASVRENSPTSTSVVKVS-ASDRDS-FGSLSYSIVGGKDSDKFSIDQR-SGI------ISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSR-----NDAFMIGASSGVITLAQPLDRENKS----TYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTL---DNTTGDISTKVPLDREQQAVYTLRIGVAD-KGNPSLSSVADVIIDVIDEDDNCPRF-QPTEYNVTISESLPRGA--SIVQVTARDID 1852          

HSP 8 Score: 150.599 bits (379), Expect = 1.493e-36
Identity = 176/677 (26.00%), Postives = 292/677 (43.13%), Query Frame = 3
Query:  681 IQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPP--KTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLS----NNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASD-GTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLV-NDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITI-VID 2681
            + I D+NDN+P+F   K+T+ + E+   GS     +A+D D+       Y +   +     F ++    TG   + ++  +DRE  A Y   + A D G PP   T  + I +   + N      ++T+Y I    S  S   ++   A D DE  NA++ + IV            F I   +G + +K++++ E    +   +  S+    + T+   + + V ++ND  P       N  +    ++EN  Q T  +   TV   D  +G     R S    N+E  F+I+       S    I T   LD E K  Y L++   D       AK  + + V + ND  P    +N   SV EN P  T V  ++A D D    G L+YSI    D  K    I+  +G + T   +DRE     +  + + + V+D G PP  +     + + DENDN+P+F++ S    + EN        ++   D D+ +  R++     N+    F++        L   + LD E +  Y   I A D GT  ++ + T  VTVI  D NDH P     N S+    +  ++  E  ++ +   D D+   +N + +F L+ N+HK +F +D   G I+T   +       + + +   D GNP   S   + I VID
Sbjct: 1191 LTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGN-HGNAFRIDST--TG--RITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVT--ATDRDEGSNAQVFYSIVRGD------TSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPP-----VFNSQSYIGSVRENSAQSTSVL---TVAADDSDVGANAVLRYSIISGNDEKRFKIN-------STSGVIMTTTPLDFEEKSQYGLEVTATDS---KYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRD--SFGSLSYSIVGGKDSDK--FSIDQRSGIISTADVLDRE----LVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDA---FMIGASSGVITL--AQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVI--DINDHRP---LINSSSLRGSVRENQPKETHVMRILASDADT--GLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVID 1816          

HSP 9 Score: 145.206 bits (365), Expect = 7.626e-35
Identity = 142/502 (28.29%), Postives = 225/502 (44.82%), Query Frame = 3
Query: 1206 FRIEENSGNIYLK-EKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAF-IKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDP---PLRAKALIKVVVKDENDNAPVIKLE-NNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLV-NDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDN 2684
            F I+ ++G+I     K D E + ++R  V   + A         V+I V + ND  PE  +      N   F I+EN       VA+ T TD+D G    +   L + EN F ++++          IRT   LD ETK  Y +++   D       PL       + V D NDNAP   L      VYE+  +G++V  +TA D+D G N  L+YS+         Y  ++S  G ++T+   DR    ET  S+ V L   D G P +  +   ++ + D NDN P F +      V E+      +  +   DKD  +N+ LR S        +  F L        +  +RSLD+E+  +Y+  +  +D  G    T T+ + + + D ND+ P F      + + Y S  +    A   VS  D DS  S NG   F ++  +  G+F ID + G I+ +++    +  ++ +TV ARD G P K  +  +TI I++
Sbjct:   12 FTIDSSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPL------NSYVFNIREN--TPAAQVAIVTATDRDSGTNAAITYSLFSGENKFMMNSKTG-------EIRTVTPLDHETKDSYTMRISAFDGKHTTFVPL-------ITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGD---TSYFTVDSQ-GVIRTKGAFDR----ETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTS--GNTNHAFTLDAVTG--VVTVSRSLDFEQRSSYALGLSVTD-RGSPPLTDTSHLLINVNDINDNPPVF------SPSAYQSRVKENTPAGTQVSATDRDS--STNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIED 470          

HSP 10 Score: 108.997 bits (271), Expect = 8.232e-24
Identity = 113/409 (27.63%), Postives = 190/409 (46.45%), Query Frame = 3
Query: 1518 NNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNV-SVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDRE-QDSETLQSFPVILTVSDKGQPPQISRKAFD---------VSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPP--KESSILITI--VIDNSKPFS 2699
            N++ +F I +   SI +      T    DRE++  Y L +  +D  +   + + ++ + VKDENDNAP   L + V ++ EN P    V  +TA D D G N  +TYS+    +   K++ +NS TG+++T   +D E +DS T+                +IS  AFD         ++V D NDNAP F     +  V E+      + ++   D D     R+S   +  + S     F  D++  + T  + D E + +Y   + A DG G  S +  ATV + I D ND+ P F   + + +T  +    +   A++TV+  D D+ ++ + + SF   N +   F +D   G +T SR++       + + +   D G+PP    S +LI +  + DN   FS
Sbjct:    7 NDQGMFTIDSSTGSITT------TGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTP-AAQVAIVTATDRDSGTNAAITYSLFSGEN---KFM-MNSKTGEIRTVTPLDHETKDSYTM----------------RIS--AFDGKHTTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTS----YFTVDSQGVIRTKGAFDRETKASYQVALRAQDG-GSPSRSGQATVEIEILDVNDNRPVF---SSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHA-FTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFS 377          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 210.305 bits (534), Expect = 4.883e-55
Identity = 191/683 (27.96%), Postives = 315/683 (46.12%), Query Frame = 3
Query:  669 FECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNR-PTGSLNLQLIQK-LDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSN--NENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFV----LFERDNKYYLNTTRS-LDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLV-NDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDN 2684
               ++Q++DINDN PRF T  +T+ I+ES  V +   +  ATD D+      DY +         FSL     PTGS    + +K LDRE    Y+  + A DRG P   G  +INI +LD ND+ P  +Q +Y     E+      +L++ A D D   N  + + I  +    + +N  F ++ ++G I  K+ LD+E    + F V  S+         ATV I V++ ND +P++ I Y+  +N +  I+         +A   VTDKD     Q   +++N  +E  F++           Y I+ +  LDRE   +Y L +   DKG P       + + V D NDN+P         ++ E    G+ V  + A D DEG NG ++YSI+  +DL   + +++  +G + T   +DREQ    + S  + +T  D G  P+       V++ D NDN P F   S +  ++E      T+ ++   D D     R++      E+SS       LFE + +  +  T+S LD E +  YSF +LA D  G     ++  V + I D ND+AP F    Y  F   +      ++  +T +    D+ +  N   S+ ++  ++ G F ID + G I+T  ++         + + A+D GN     + ++ + + N
Sbjct:   79 ISVQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGD-NTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWD---AIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFL------GFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDL--GWFQVDFQSGLVTTAKPLDREQ----VSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITY-----EISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKD-HGDPQLMSSVKVELTISDINDNAPVFYPVEY--FASIMENEPPGKLLQVTAT----DADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLN 733          

HSP 2 Score: 163.696 bits (413), Expect = 1.215e-40
Identity = 177/678 (26.11%), Postives = 303/678 (44.69%), Query Frame = 3
Query:  681 IQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEI-AIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQ---QALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNF---TKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHL-VNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNS 2687
            I + D+NDN+P F ++ +T NI E    GS      ATD D        Y +   +    +   + +  +G +     + LDRE+ +     + A D G+ PKTG   + + ++D NDN P   +++Y     E       +L++ A D D  DN ++ ++I +        N  F +   +G ++ K +LD E    + F V   ++      ++  V + + ++ND  P    ++Y       A I ENE    K + + T TD D+G    +   +    N     N + SI S+   I T  +LD E + ++ L +  +D G+      A++ V V ++ DN PV   E  N +VYEN P GTLV  + A   D  KNG ++Y+I  S D T  +L ++S  G +K    +DRE+ ++ L    VI  V      P  ++   ++ V D NDNAP+F   S+   +       Q +Y    + + D   N  +R  L       ++  +L+       +   R L    E  Y+ ++LASD      H   +T+T+ I    +H P F   +Y      ++ +SY     +A+        D     NG+  + +   + +GLF I    GK+   +++ ++  G + + V A D G P   +S+ +TI I +S
Sbjct:  413 IDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGN---DLGWFQVDFQSGLVTTA--KPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSD---AQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYF------ASIMENEPPG-KLLQV-TATDADEGTNAVISYDIIGGNN-----NGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKD--KNGSISYAIV-SGDPTNLFL-VDSTGGIIKINGDMDREEKAQYL--LAVIARVGTV--KPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDL-DAGKNGLVRYQLTS-----NAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQH---STMTIHITLSINHPPKFTLSSYVTHVLASQPLSYQFFYVVAV--------DQDSGKNGQLFYSIPQGNEEGLFGIFPG-GKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDS 1043          

HSP 3 Score: 143.28 bits (360), Expect = 2.600e-34
Identity = 181/696 (26.01%), Postives = 291/696 (41.81%), Query Frame = 3
Query:  528 NGKLYSAQTIDREEL---CINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSE-----QYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQP---LLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNN-ENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENN-VSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDD--NSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITT 2570
            +G + +A+ +DRE++    I + +  H   P   S ++ V                I D NDN PRF    +   I E   +G+      ATD DS       Y I     + N +F      E N  TG L  +   +LDRE ++ Y F +LA D G+P    +L+ ++ V     +    +   Y ++Y  S    +P   LL++ A D DE  NA + + I+       + N  F I+ ++G I     LD+E +E     +   +        TA V + V+N  D  P    +  N      F       K   V     T KDK  G   +  +S +  N+F + +    I  N         +DRE K  Y L +        PL A+A + + V D NDNAP     +  V +     +G +V +  A D+D GKNG + Y ++ +++     L INS +G +K   K+    +++    + V +  SD G PPQ S     +++    ++ P+F   S    V  +Q   Y    +   D+D   N QL  S+     E    F +F    K Y+   +SL    + +Y   + A+DG G  S +A+  VT+ I+D NDH   F+    + F   ++ + S    + T+    LD   + +   S      H   F +D   G+ITT
Sbjct:  479 SGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVT---------------IIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLF------ELNTQTGVLWTK--SQLDRETKSLYSFTVLAKDHGDP----QLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLLQVTATDADEGTNAVISYDIIGG-----NNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYN------FTVYENVPKGTLVGRVYATTKDKN-GSISYAIVSGDPTNLFLVDSTGGIIKING-------DMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAE---GLLWINSTSGVIKLARKLTDGDETQ----YTVQVLASDSGSPPQHSTMTIHITLSI--NHPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEE--GLFGIFP-GGKLYIR--KSLLQALKGSYDLIVRATDG-GVPSFSASVPVTIYIQDSNDHRSLFV---NNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESH---FAVDVRSGQITT 1107          

HSP 4 Score: 135.576 bits (340), Expect = 5.624e-32
Identity = 161/707 (22.77%), Postives = 301/707 (42.57%), Query Frame = 3
Query:  636 VKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKL---EENSIFPPIFSLEQNRPTGSLNLQ--LIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYE---RDEQHRFYV---EVSNNAGHVDTATATVLIQVINLNDETP-------EIAIDYVNENNKNAF----IKENEDQKTKFV-ALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI-KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWE----KEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITI 2672
            + SDS   P+     I I    ++ P+F    +  ++  S+P+   F   +A D DS +     Y +    E  +F  IF      P G L ++  L+Q L    +  Y+ ++ A D G P  +  + + I + D ND+        +     E+      +  + A   D +    +V+ +++ +        +F ++  SG I  + +LD E   ++     Y+   E   N   +    A V++ V +LND  P        I +  ++      F    +  +E    KF  +L + T  DK                F I++    +  +K       TLDRET   Y L ++  D  +  L + A I++ V D ND  PV  + +  V++ E+  IG+LV ++ A D D G+NG + YSIS  +       ++ S TG    R+ + +  D ET Q + + +T  D G  P  S     V+V D NDNAP F    +   V EN    + +G     D+D  +   ++        S  F +     +  + T  ++D E       ++   ++A+D  G    +   ++TV + DEND++P F+ P         +    + + ++T++  D D     NGK ++ +++ + G F +  + G++     + ++    + +T+ A D G P +++  ++++
Sbjct:  919 LASDSGSPPQHSTMTIHITLSINHPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFG-IF------PGGKLYIRKSLLQAL----KGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSE-------SHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDK----------------FFINSSTGELHLSK-------TLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGN--LAAMFDVESATG----RLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCE--ITTIAAIDLETMPAGRDSFQLVVMATD-QGSPKLSTRKSITVQVTDENDNSPGFVSPP--------AAAAGSSLNVMTITAEDPDRNS--NGKVTYSIISGNNGYFNLHPSTGQLQMIHQIPDNPT-IYQLTIQASDGGQPSRQTQTVVSV 1564          

HSP 5 Score: 122.865 bits (307), Expect = 4.057e-28
Identity = 156/620 (25.16%), Postives = 267/620 (43.06%), Query Frame = 3
Query:  528 NGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKE-SEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKF-VALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRET----KGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTL-VTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEK-EKNYSFKILASDGTGYKSHTATATVTVIIEDEN 2363
            +G++ +   +DREEL  N  S  +      I  + A+ +D+  +       + + D+NDNAP F    + I + E S P   +F +  A D D    +   Y L   +     F    N  TG L+L   + LDRE  + Y  V+ A D  N        I I V D ND  P   +++Y +   E       ++ + A D+D   N  + + I N     +     F +E  +G + + + LD+E  + +   +   ++     ++T  V + V+++ND  P      V        +   E+  T F V   T +D+D G    +   + +     +  ++  S+ S    I T   +D ET    +  ++L +   D+G P L  +  I V V DENDN+P       VS        +L V  ITA+D D   NG++TYSI   ++    Y  ++  TG L+   +I    D+ T+  + + +  SD GQP + ++    V  +      P F +   Q  VTEN+ A  ++  + V      S L  ++ +     SS        +   + TTR +D E    +++  + A D  G  + T++ATVT+ ++D N
Sbjct: 1102 SGQITTRVRLDREELIKNTGSNVY------IMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIK-AMDADEGDNAKFFYSLVSGTGMDKFF---INSSTGELHLS--KTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAM-----FDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVT-------LTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYS-----QTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGF-----VSPPAAAAGSSLNVMTITAEDPDRNSNGKVTYSIISGNN---GYFNLHPSTGQLQMIHQI---PDNPTI--YQLTIQASDGGQPSRQTQTVVSVFKEGPIGGGPTFSSADYQGSVTENKVAGTSV--VTVLAAYPQSSLNGNIEYYLTSDSSKGGFEVVKSTGVVKTTRGIDREGMGASFNLVVYAVDKQGPSARTSSATVTITVQDVN 1677          

HSP 6 Score: 64.3142 bits (155), Expect = 3.648e-10
Identity = 81/316 (25.63%), Postives = 124/316 (39.24%), Query Frame = 3
Query: 1749 VYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSE-TLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFE----RDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVND---HKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITI 2672
            V E +P GT V  +      EG               + K    NS+TG + T  +IDRE  ++ +LQ    + T++   QP  +      V V D NDN P F       ++ E+     T       D D  +   V       + ++ F L        +   + T + LD E    Y   I A+D  G  +      + + I DENDHAP F     +++   I+ +    ++IL VS  D DS    NG   + +  D      +F +D + G I T + +       +   VIA D G P K     +TI
Sbjct:   16 VQEEQPPGTYVGKVDGASAFEG---------------SPKQFGFNSNTGVISTTARIDRETTTQISLQ----LRTLNPSNQPISV-----QVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATD-RGTPALMGYCLINITILDENDHAPVF---TQNSYLGSIAENTKPGVSILRVSAADRDSGS--NGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTI 301          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 187.578 bits (475), Expect = 7.110e-48
Identity = 197/695 (28.35%), Postives = 326/695 (46.91%), Query Frame = 3
Query:  660 PRTFECRIQIEDINDNAPRF-RTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPT-GSLNLQLIQ-----KLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSN-NAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENV----FEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYL---EINSHTGDLKTRMKIDREQDSETLQSFPVILT--VSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKG--LFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI 2678
            P+++   + ++D+NDN+P F R     + + E++         IA D D    S + Y +   ++   +F L   R T G L   L+       +DRE+   Y   + A D GNP   G L ++I V D NDN P  S  +Y+    E+      +L++ A D+D   NA++ + I        D    F I   +G I    +LDYE    +   V+  +  + H  +++A V I+V+++ND  P I + Y    +    + EN    T+ VA  +V+D D G  G+V+  L   +      F++ N +S I   +       +LDRET  ++ L+  C DKGDPP   +   ++ V D ND AP          V+EN  + TLV  + A D D G N EL Y+I+ +++ ++ YL    I+  +G + T   +DREQ  +      V+LT  V D+G PP     +  V++ D NDN P F   S    + EN  +   + ++   D D  +NS +  S++  PN   +PF L  R  K  +  +R+LD E + +Y+F++ A+DG G    +  ATV V + D ND+ P F   +YS     + Y E+  I      +  +D +DS     +  ++       +F +D   G IT ++ +       +++TV A D G     +  ++ I +
Sbjct:   39 PKSYTVLVYVQDLNDNSPSFVRGTSAKLVVFENDK--DFRQKLIAVDSDFGSNSTQSYTIVSGNV-GNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHS----DPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQ--VTENATIGTQ-VARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQ-------SLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTE-SRSYLHWFAIDPSSGMITTATDLDREQIPQ------VVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSIL-TPN---TPFFLDPR--KGLVTNSRTLDHEVQSSYTFQVAATDGGG---RSCNATVHVSLTDLNDNQPVFDPSSYS-----VEYFENTRIGQSICQLKAID-RDSPKFAITRFIIEQGNADEVFSVD-GSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITV 693          

HSP 2 Score: 187.578 bits (475), Expect = 8.800e-48
Identity = 193/698 (27.65%), Postives = 332/698 (47.56%), Query Frame = 3
Query:  633 AVKSDSIEEPRTFE--CRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLE---ENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEI-AIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRV-TLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI-KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERD-NKYYLNTTRSLDW-EKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHL---VNDHK-GLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDN 2684
            AV  D  + PRT E   RI + D+ND AP+F    +   + E+  V +L ++  A D D    S   Y +    E+  +   F+++   P+  + +     LDRE+  +    +L  DRG+PP +    + +N+ D NDN P+ +Q++YN    E+  S  P++++ A+D D  +N+ +++ I+         N  F ++   G +     LD+E    + F V  ++  G   +  ATV + + +LND  P      Y  E  +N  I ++       +      D+D         + +    + E  N D     +   + T    LDRET+  Y L ++  D G      KA++ + V D ND  P+  K E N ++ E+    +++ H+ A   D+G N E+ YSIS+ +  T   + INS TG L  + ++D E+    + S  + +   DKG PP        ++V D NDN+P+F + SI  ++ E+    +T   + V D D     RVS   L N    P  LF  D N   L+ T+ +D+    ++Y+  + A DG G    ++TA + + + D ND++P  +F N+S +T ++      +  I+ V   D+DS +  NG+ S+     V+  K GL    +N GKI     +   D+ ++ + VIA DHG P + SS  + +++D+
Sbjct:  359 AVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAID---PSSGM-ITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTP-------NTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGR--SCNATVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQS-------ICQLKAIDRDS-------PKFAITRFIIEQGNADEVFSVDGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGN--TDNIVLINS-TGTLYLQSEVDHEK----IPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSN----PGTLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDG-GSPPRSSTAMLELKVVDVNDYSP--VFGNWS-YTAHVLETTPPDSNIIEVVATDVDSGE--NGRISYAFDSKVDTSKFGL----RNGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDD 1008          

HSP 3 Score: 173.711 bits (439), Expect = 1.289e-43
Identity = 173/659 (26.25%), Postives = 306/659 (46.43%), Query Frame = 3
Query:  675 CRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFV-ALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIK-LENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIA--ILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGN 2639
              + + D+NDN P F    +++   E+  +G       A D DS +++I  + +E+ +    +FS++     GS  + L + LDRE +  Y   + A+D G      + ++NI VLDVND PP  S+  YN   +E   ++  +  + A   D+  NA++V+ I      K + +    I  ++G +YL+ ++D+E+       V+  +         A V I VI++ND +P+        N+ +  ++  ED          +V D D G+ G+V   L +N     + N DS+  +   S+   +      + Y  L ++ +D G PP  + A++++ V D ND +PV         V E  P  + +  + A D+D G+NG ++Y+     D +K  L    + G +  + K+DRE     ++ + + +   D G P + S     V V D NDN P F+  S  F V EN+     LG +   D D+ S   V+  +  +   + F++ ++  K  + T++ LD E + +Y F I+A+DG G         VTVI+ D ND +P F    YS     ++ +E   +   +LT+   D D +   N   ++ +V   K  F ++Q  G +T    +      +H++ V+A D G 
Sbjct:  585 VHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNA-DEVFSVD-----GSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSIS-----KGNTDNIVLIN-STGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQF-------NSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGT--LFNLDSN--TGALSLTKLIDYGNSARSY-TLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLR---NGGKIFIKSKLDRED----IEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVT--YRFDTQVAQFIVDKQTGK--ITTSQVLDREAKASYVFSIVATDG-GSSPRVDKTQVTVIVRDVNDCSPKFSKNKYS-----VTVNEDLPVGSSLLTLIATD-DDQQGPNSDITYMIVAGPKA-FSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGG 1200          

HSP 4 Score: 160.999 bits (406), Expect = 1.197e-39
Identity = 190/741 (25.64%), Postives = 327/741 (44.13%), Query Frame = 3
Query:  636 VKSDSIEEPRT--FECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYS--IRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXH-LSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLK--EKLDYERDEQHRFYVEVSNNAGHVDTATATVL-IQVINLNDETPEIAIDYVNENNKNAFIKENEDQ-KTKFVALATVTDKDKGLGGQVHCRL--SNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDE----------------------------GKNGELTYS--ISESSDLTKKYLEINSHTGDLKTRMKID-REQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHL-VNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI----DNSKPFSIGQSNE 2717
            +  D  ++P+      RI+IED N++AP+F    + ++I  +    +L ++  ATD D+++ +     Y+L+++     +F +E N  TGS+            + ++   ++A D G+PP  G  ++ I + ++ D+PP  L+QT   +   E+      +  + A+    + +A++ + I++      +  + F ++  +G I +   + LDYE  +  R ++ V+   G V      +L I VI+ ND +P       + +N  A + E+    K +FV   T TD D G  G+V   +   N   VF I +    I + K        LDRET   ++L +   D G PP      +KVVV D NDN P+    + V++ E+   G +VT + A D D+                            G N ++ YS  I+ S  +  K   I++ TG +  R  ID R +DS      PV     D+G PPQ +     + +  E    P+FE  S   +V EN     ++  +RV   D+ + L +  +    E S+ F + +R     +N  + LD+E ++ +   + A D T   S      V + + D ND  P F    Y        + E   +  + V+V   D     NG+  F +   D KG F ID+  G I T R +    +  H ++V A D G+PP  + + +TI +    DN   F +   N+
Sbjct: 1825 IAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESN--TGSVRTS--AGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRAR---ASSDAQVTYSIISG-----NKGRAFYVDPFTGVISVASADALDYESTKNFRLHL-VATPQGWVSLNGYMILDINVIDRNDNSPAF-----HPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGEITTAKL-------LDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYK---IDADTGVISARRTIDVRIRDS--FIQIPV--QAMDQGVPPQRALVYVRIIITRE----PKFELPSYFGKVPENAMMGTSVLTVRV--TDNAAGLPLGRISYNIENSNYFRIGQRSGVISVN--KPLDYETKRRFLLVVSAIDDTA-PSKPVRVPVYINVSDVNDEKPVFGQSGY-----MAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPND 2519          

HSP 5 Score: 155.992 bits (393), Expect = 4.264e-38
Identity = 204/738 (27.64%), Postives = 329/738 (44.58%), Query Frame = 3
Query:  531 GKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQI--EDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQ-YSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQP-LLKIG-------AKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSN-NAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKG---DPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTR-MKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPN--EMSSPFVLFERDNKYYLNTTRS-LDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHK-GLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDN 2684
            GK+ ++Q +DRE     V S               V +D    PR  + ++ +   D+ND +P+F  +K+++ + E  PVGS     IATDDD +   S   Y +      P  FSL  N+ TG L L  +  LDRE   ++   ++A D+G          ++  +   +        NY +   E+ F   P  L IG       A D D+ DN K+ +KIVN      + +  F+I E +G I     LD+E   ++   V  ++       T+   V I V + ND  P       ++N    +I EN    T    +    D D GL  ++   + +       H +   I S    I+T   +DRE    Y L++   D+       L   A +K++++D NDNAP     N   V E++P    VT ITA D D G+ G + Y I  S D  K  L       DLKT  +K+    D E +  + + ++ +D G PP  S + F+V V D NDN PEF        V+EN+    ++ ++  +D+D  S   ++   +P+  EM      F  D    L  T S LD EK+  Y   + A+ G  Y    ++ +V + + D ND+ P FI P     T  +  +  A + I T++V DLD  +  N K  + +++ +  G F I ++ G+++T+  +       + ++V A+D   P   +   ITI I++
Sbjct: 1069 GKITTSQVLDREAKASYVFSI--------------VATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAG---PKAFSL--NQVTGVLTL--VSPLDREVTHRHILHVVASDKGG-------NQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNG-----NTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTF-----DKNPIITWIYENVPINTNVTTIK-AHDDDSGLNSRIWYTIDSQSP--RAHFK---INSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIV-SPDTGKFSL-------DLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTY-SIPSGVEMDK----FSIDKHSGLIVTNSILDREKKDTYFLTVHAT-GVSYPFRVSSTSVRINVMDRNDNPPKFISP---VVTLKVPENSPARL-IYTLTVQDLDYGN--NTKVLYSIMSGNTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIED 1742          

HSP 6 Score: 148.673 bits (374), Expect = 7.786e-36
Identity = 189/731 (25.85%), Postives = 322/731 (44.05%), Query Frame = 3
Query:  513 FHLHSNGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDEND-NAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVL-IQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRL--SNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAK-ALIKVVVKDENDNAPVIKLENNVS-VYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKG---QPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKY-YLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVND-HKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITI 2672
            F L + GK++    +DRE+    +E    K         IA+   +     + + ++ ++D+NDN P F+   +   +KE+EPV +      A+D D        Y+ +       +     ++ TG +     Q LDRE +A Y F ++A D G+ P+  +  + + V DVND  P  S+  Y++   E       LL + A D+D+   N+ + + IV          K F + + +G + L   LD E   +H  +V  S+  G+    T T + I V+++ND  P     ++NE      + E     +   A+  V D D+G  G+V  ++   N +  F+I N  + +      I T   LD E    Y L++   D G    +    L+ + V+D NDN P       ++ +YEN PI T VT I A D D G N  + Y+I   S   + + +INS TG ++T   IDRE+ SE    + + +  +D+    Q    +     + ++D NDNAP+F + ++ + V E++   + +  I   D D      V    +  +       F  D K   L    SLD+E    Y+  I A+D  G    T+     V++ D ND+ P F       F   +S ++    +++ V+  D DS    N + ++ + +      F ID++ G I T+  +       + +TV A     P + SS  + I
Sbjct:  960 FGLRNGGKIFIKSKLDRED----IEEYNLKV--------IAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQ-----VAQFIVDKQTGKITTS--QVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVA-------GPKAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPV----FINETTFKT-VPEKLPIGSVVAAVLAV-DSDQGDNGKVRYKIVNGNTDGTFKI-NETTGV------ISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQS--PRAHFKINSETGLIQTTHPIDREEISE----YSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTY-VMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGK----FSLDLKTGVLKLIGSLDYEDVPQYTLHISATD-LGSPPLTSYQLFNVVVVDVNDNPPEF---TRDLFIGTVSENKPTGTSVVKVTAYDRDS--GSNAELTYSIPSGVEMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRI 1634          

HSP 7 Score: 143.665 bits (361), Expect = 2.369e-34
Identity = 172/698 (24.64%), Postives = 311/698 (44.56%), Query Frame = 3
Query:  513 FHLHS-NGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEP----RTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRL--SNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLE-NNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFEN--YSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKG-LFKIDQNKGKITTS 2573
            F ++S  G + +   IDREE+              + SL +     +  E      T   +I I+D+NDNAP+F +   T  + E EP     +   A D D+ Q    +Y++    + P       +  TG L  +LI  LD E   +Y   + A D G+PP T   + N+ V+DVNDNPP  ++  +     E+K +   ++K+ A D D   NA++ + I    P  V+ +K F I+++SG I     LD E+ + +   V  +  +     ++ +V I V++ ND  P+     V        +K  E+   + +   TV D D G   +V   +   N +  F I      +        T   LDRETK  Y+L ++ +D   P   A A I + ++D+NDN PV +    + ++ E  P GT + ++TA D D G NG + Y++S     T     I+S TG + +  +     ++   Q +       D+GQ P+++     + ++D+N++AP+F    Y +      +  AL T+      D D ++  +V+   L +  +S  +     N   + T+       +  ++  I+A D  G         V ++I +  D  P F+    +     +S  E++++     +V    ++ S + + ++ +++ +KG  F +D   G I+ +
Sbjct: 1378 FKINSETGLIQTTHPIDREEIS-------------EYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTY-VMEDEPFNFQVTSITALDPDTGQGGNVEYRI----VSPDTGKFSLDLKTGVL--KLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSI----PSGVEMDK-FSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVT-------LKVPENSPARLIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRSTGEL-------STTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSND---TYGVYSIDSRTGIVYSAARF----ETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTY-RLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAED-HGSPPLRGYGIVQIVIGNIQDDPPRFL----NQTPARVSIPENSKVGSYITTV---RARASSDAQVTYSIISGNKGRAFYVDPFTGVISVA 2020          

HSP 8 Score: 117.087 bits (292), Expect = 3.191e-26
Identity = 142/601 (23.63%), Postives = 261/601 (43.43%), Query Frame = 3
Query:  477 FNLLSNTKANRLFHLHSNGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVK-SDSIEEPRTFECRIQI--EDINDNAPRFRTDKFT-INIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLE---QNRPTGSLNL-----------QLIQKLDREK-----------RAKYEFVLL---AIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRL--SNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLE--NNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLV 2171
            +++ +  +A       + G++ +A+ +DRE                  S  + ++ +DS   P++  C++++   D+NDN P F  D  + +NI+E    G++ +  +AT  D+++ S   Y L+  S  P I  L     ++ +GS              Q+  K+D +            R +  F+ +   A+D+G PP+  R ++ + ++   +    L   +Y  +  E+      +L +        DNA  +   +      ++ + YFRI + SG I + + LDYE   +    V   ++          V I V ++NDE P        ++   A   E     T  V ++   DKD G  G+V   +   +++  F I +R + +      IRT+  LD ET   + + +   D+G PP+     + + V D NDN PV ++   N+V V EN P+ + +  I A D D G N  L++++   +   +    I+  +G L T +  D E  +  +  + + +  +D G PP  S     V+V DE++  P F     +F V  N +    +G++   D+D   Q RV  V
Sbjct: 2106 YSIWTGNEAGVFTIDSTTGEITTAKLLDRETTA---------------SFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLF--DPLSEVNIREDTRTGAVVTSVVAT--DTDKESRLTYNLKSAST-PGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQ--RALVYVRIIITREPKFELP--SYFGKVPENAMMGTSVLTVRV-----TDNAAGL--PLGRISYNIENSNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFG-----QSGYMAQWSEGIPVGTIVVNVSAA-DKDSGANGRVWFAIQSGDDKGSFAI-DRKTGV------IRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTG--QGLFLIDKFSGWLTTNITFDYENTA--VYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFV 2658          

HSP 9 Score: 117.087 bits (292), Expect = 3.218e-26
Identity = 166/673 (24.67%), Postives = 275/673 (40.86%), Query Frame = 3
Query:  681 IQIEDINDNAPRFRTDKFTINIKESEPVGSL---FSLPI-ATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGR-----------------------------XXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNA--KMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYE-RDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLG-GQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVY-ENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSI-QFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKY--YLNTTRSLDWEKEK--NYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIA--ILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKI 2564
            I + D NDN+P F        +  +E  G+    F + + ATD DS       Y +   +    +F+++    TG +     + LDRE  A ++ V+   D G PPK+                                   +    V  +    S+  YN++   +      +L++ A D+D   NA  K  F I N   +       ++I+ ++G I  +  +D   RD   +  V+  +    V    A V +++I   +   E+   Y  +  +NA +  +       V    VTD   GL  G++   + N+ N F I  R   I  NK        LD ETK  + L +   D   P    +  + + V D ND  PV      ++ + E  P+GT+V +++A D D G NG + ++I    D  K    I+  TG ++T+    R  D ET+++  V +  +D+G PP  +  +  + V D NDN P F        QV EN      L EI   D+D  +  R+S   +       F++    +K+  +L T  + D+E      YS  I A+D  G    ++  T+ V + DE+++ PSF   +Y           +A+I   +  V+  D DS D   G+  F   N      K++   G I
Sbjct: 2055 INVIDRNDNSPAFHPSNMLAQL--AEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGN-EAGVFTIDST--TGEITTA--KLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTP--GIAILRVSATDQDSGSNAQIKYSFPITNSDQID------YKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQG--VPPQRALVYVRIIITREPKFELP-SYFGKVPENAMMGTS-------VLTVRVTDNAAGLPLGRISYNIENS-NYFRIGQRSGVISVNK-------PLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDD--KGSFAIDRKTGVIRTQ----RALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLI----DKFSGWLTTNITFDYENTAVYQYSLTIKATDA-GNPPLSSNITIIVNVADEDEYDPSFNRMDYK-----FDVPGNAKIGDFVGQVTATDRDSGD--QGRVFFVFYNPTSNALKMNATTGII 2676          

HSP 10 Score: 115.931 bits (289), Expect = 7.244e-26
Identity = 171/706 (24.22%), Postives = 290/706 (41.08%), Query Frame = 3
Query:  675 CRIQIEDINDNAPRFRTDK-FTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRP------TGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQP--LLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVA---LATVTDKDKGLG---------GQVHCRLSNNEN----------VFEIHNRDS---SIPSNKYSIRTRVTLD-RETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVS-VYENKPIGTLVTHITAKDIDEG-KNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVND-HKGLFKIDQNKGKITTSRTMSESDMG--KHVITVIARDHGNPPKESSILITI 2672
             +I I +I D+ PRF       ++I E+  VGS  +            ++R     +  +   I S  + R       TG +++     LD E    +   L+A  +G     G ++++INV+D NDN P    +N   Q  E   + +P  ++K+ A D D   N K+ + I       V     F I+  +G I   + LD E        +  +++     +    V + V +LND  P    D ++E N        ED +T  V    +AT TDK+  L          G    R+S  +            F I N D     I ++   I  R T+D R    + ++ ++  D+G PP RA   +++++  E    P  +L +    V EN  +GT V  +   D   G   G ++Y+I  S+     Y  I   +G     + +++  D ET + F ++++  D   P +  R    ++V D ND  P F       Q +E       +  +   DKD  +  RV       +    F +  +     + T R+LD E  K +   + A+D      HT   +VT+ + D ND+ P F  P  ++    +   E+  +      +   D     N + SF ++    +GLF ID+  G +TT+ T    +    ++ +T+ A D GNPP  S+I I +
Sbjct: 1948 VQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYIT------------TVRARASSDAQVTYSIISGNKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGV-----FTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPP--LFDPLSEVNIR------EDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITRE----PKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENSN-----YFRIGQRSG----VISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTG--VIRTQRALDHETIKTHHVSVRATDEGSPPMHT-DVSVTIRVLDLNDNPPVFRVPGPND----VQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIV 2608          

HSP 11 Score: 110.153 bits (274), Expect = 4.114e-24
Identity = 183/771 (23.74%), Postives = 304/771 (39.43%), Query Frame = 3
Query:  471 KKFNLLSNTKANRLFHLHS----NGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRT---FECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNI----QYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGN----IYLKEKLDYERDEQHRFYVEVSNNAGHVDTAT-ATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSS--------IPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI----DNSKPF 2696
            + + ++S    N +F L S    +G LY+       +L +N  S    ++  D S  + + +     P         I +ED NDN P F    ++  I E+  VG+      A+D D    +   Y +E +S    IF +    PT  + +  + +LD E +  Y  V+ A D+G+  +     I    +   ++   +   +Y +    Q  E+      + ++   D D   N ++   +          + YF ++ +  N    I + + LD E  + H F   V  + G     T  +  I V ++ND  P+      + +     + EN    T  VA+    D+D G         SN+E V+ I N   S        I  +   I T   LDRE      L +   D+G PPL     + V + D NDN P     + N S++EN P G+ V  + A+D D G+N  + YSI   +  T  +L+        K  +   R  D E   S+   +  +D G   +       VS+ D NDN P F+  S   +  EN +   ++ +++  D+D     + ++     E  +   +F  D    +   + LD E + NY   + A DG G  S    A V + + D ND  P F    Y NFT  I  H  A   I  V    +      N +  + +   +     +  + G +     +    +    +TV A+D G PP      +TI +    DNS  F
Sbjct:   92 QSYTIVSGNVGN-VFKLISKRDTDGDLYA-------DLVVNASSIGVDRERLD-SYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIH---PTTGVIVNNV-RLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEG-------GDGYFSMKFDVLNDESIIAVGQSLDRETHD-HFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKF-----DRHTYETRVWENATVNT-LVAIVNAVDQDFG---------SNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPN--TPFFLDPR------KGLVTNSRTLDHEVQSSYTFQVAATDGGG--RSCNATVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRD---SPKFAITRFIIEQGNADEVFSVDGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDS-VNKAIVNITVLDVNDEPPIFSKAEY-NFT--IQEHSQALSVIGHVHA--ISRDKGTNAEVVYSISKGNTDNIVLINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQF 807          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO30364 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T100])

HSP 1 Score: 173.326 bits (438), Expect = 1.636e-43
Identity = 191/744 (25.67%), Postives = 316/744 (42.47%), Query Frame = 3
Query:  462 TQNKKFNLLSNTKANRLFHLHSNGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI-KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD-DNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRS--LDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHK-GLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI 2678
            T   K   L     + + +  +NG  Y   TID     I   +   +++     L +  K          +  +Q+ED+NDN P F    +TI   E  P G+      A D D    +   Y + EN        +  N  TG ++L   Q LDRE    + F + A D G P K+    + I ++D+NDN P  + T+Y     E++ +  P+L + A D+D   NAK+ + +      +      F I+ ++GNI  +E L+ E    +   +   ++A      T  V+I V + ND  P+         +  AF    + +    V     TD+D     +V   +S+            S+      I T  TLDRE    Y L +  +D G P L +   + + ++D NDN P+  K   NV++ E+  + T V  + A D DEG NG+ TY I+     T     I+++TG +  + K+D E+ S     + + ++  D G PP       ++ V D +DNAP F       ++ EN    + +  +   D D + S  RV          S F++ E+     LN T S  L+ E    Y  ++ A          +     + + D ND+AP F   +Y   +         +  ILTV   D D  +S  G+  F +V+ ++ G+F++D   G +T +R +   D   + + V+A D G P   SS+ + I +
Sbjct: 1209 TNVTKITALDKDIGDTISYSIANGDPYGLFTIDNVTGEIRTVAELDRENVTQYELFVQAKDSVNLVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSIVENVTD----YVTVNAITGVISLGSSQ-LDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGVLYTR------FAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFT------QSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLMF-----SVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGD--TDDVFYIDANTGLITIKAKLDYEKTS----LYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVR-SVLEDTGPITDATILTVKAQDGDEGES--GEIIFTIVSGNENGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITV 1921          

HSP 2 Score: 140.969 bits (354), Expect = 1.320e-33
Identity = 187/754 (24.80%), Postives = 314/754 (41.64%), Query Frame = 3
Query:  486 LSNTKANRLFHLHS-NGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEP---RTF-ECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNE--NVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVK--DENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLK-TRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGL-FKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKES--SILITI--VIDNSKPFS 2699
            L+N   +  F +++  G++  A  IDRE          H       +  + V+++   EP   +TF E  I ++D NDN P+F    +   I E+ PVGS  ++            + D K+  +++          RP  S          REKR      +  I+  +P                       ++ Y +   ES      + ++ A D DE  NA ++F   N    K      F +  ++G+I +   LD E    +   V  +N        T  V I V ++ D+ P     Y N ++    + EN    T    +  +T  DK +G  +   ++N +   +F I N    I       RT   LDRE    YEL ++ +D  +       L+KVVV+  D NDN PV  +    +  +E  P GT +  + A D D G N  + YSI E+      Y+ +N+ TG +     ++DRE +    + F   +  +D G P + S  +  + + D NDN+P F N      V ENQ A   +  +   DKD  +  ++S V L   + + F +    +   + T   L+ E+  +Y+  + A D +  ++   T  V + + D NDH P F    Y+      S  E  ++      V   D   + N +  +++ + +  L F +++  G I+T+ T+       + + + A+DHG P  ES  S++ITI  V DN   FS
Sbjct:  959 LTNGNKDDAFSINNVTGEITVAGVIDRE--------AVH-------TFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQFSFTGYEGEIAENSPVGSTITM------------VPDQKISSSTL----------RPRSSPRAPAALLTAREKRP-----ITLINDESP--------------------LFEKSMYYVNVSESASRGIVIGRVTATDRDEGINA-IIFYSSNGAEAK------FYVSRSTGDIIVDSPLDREFKNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKP-----YFNSSSLTVKLSENASIGTN---VTKITALDKDIGDTISYSIANGDPYGLFTIDNVTGEI-------RTVAELDRENVTQYELFVQAKDSVN---LVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSIVEN---VTDYVTVNAITGVISLGSSQLDREVE----EYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYV-LSGVLYTRFAI--DPDTGNITTREPLNREETGSYTLTLRAVD-SAIRAREGTTRVIITVTDANDHVPQFTQSGYA-----FSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFS 1609          

HSP 3 Score: 139.813 bits (351), Expect = 3.056e-33
Identity = 176/678 (25.96%), Postives = 292/678 (43.07%), Query Frame = 3
Query:  696 INDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENV--FEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVY----ENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHL-VNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITI----VIDNSKPF 2696
            IND +P F    + +N+ ES   G +     ATD D    +I  Y    N      +    +R TG + +     LDRE +  Y   + A +     +     ++I V DV D+ P+ + ++  ++  E+      + KI A D+D  D   + + I N  P  +     F I+  +G I    +LD E   Q+  +V+  ++   V +    V++QV ++ND  P  ++          +  E  ++  +  ++  V   D  +G       S  ENV  +   N  + + S   S      LDRE + Y+   +   D G P   + A + + + D NDN+PV    NN   Y    EN+P GT V  +TA D D G N +L+Y +   S +      I+  TG++ TR  ++RE+      S+ + L   D     +       ++V D ND+ P+F      F V E+ +  +T+G +   D+D N   RV         S  F + E      ++TT +LD E+  +Y+  I A D  G  +  +  +V + IED ND+ P F    Y+     ++  ES  +    V V   D  +  NG+ ++ +   D   +F ID N G IT    +       + +TV A+D G PP   +  + I    V DN+  F
Sbjct: 1082 INDESPLFEKSMYYVNVSESASRGIVIGRVTATDRDEGINAIIFYS--SNGAEAKFYV---SRSTGDIIVD--SPLDREFKNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKDIGDT--ISYSIANGDPYGL-----FTIDNVTGEIRTVAELDRENVTQYELFVQAKDSVNLV-SDLLKVVVQVEDVNDNPPVFSMP--------GYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSIVENVTDYVTVNAITGVISLGSS-----QLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVF---NNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVL---SGVLYTRFAIDPDTGNITTREPLNREETG----SYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLMFSVNETTGI--ISTTSTLDREQNASYTLIITAKD-HGIPALESNTSVMITIEDVNDNKPLFSKSVYN-----VTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVF 1713          

HSP 4 Score: 130.183 bits (326), Expect = 2.648e-30
Identity = 215/835 (25.75%), Postives = 352/835 (42.16%), Query Frame = 3
Query:  372 EPCDIKVTDNTKENSFISNLNSFDVYSTPYTQNK-KFNLLSNTKANR--LFHLHS-NGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECR----IQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKL-EENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLL--KIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNN-------------------AGHVDT-----ATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLR-AKALIKVVVKDENDNAP-VIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEF-ENYSIQFQVTENQ-QALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSF-IFPNYSNFTKYISYHES-AEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTM----------SESDMGKHVITVIARDHGNP---PKESSILITIVI----DNSKPF 2696
            +P   K+ +N +  + I  +++ D  S   +Q + KF   SN  A +   F L+S NG+L     +D E                  S  + V ++ +  P+  E R    I++ DI+D  PRF    +   I+E+ P+GS      A D D    +   Y++   NS    +F+++ N  TG + +     +D EK   +   + A +  +P     + + + V+DVNDN P   Q+ Y     E       ++  ++   D D+N     VF+ V    V  D++K F I+  SG +Y+ + LDYE+     F  E                       A   DT     A A+V + +IN+ND  P  A    N      +  + E      +A  T TD D G  G +   L   +  +   N D+       +I     LD +T   Y+  +  +D G      A A + V ++D NDN P    +     + EN P GT+V  +TA D D G+NG L+++IS   D    +  IN  +G + T     RE D ET+ ++ + ++  D G   +       V+V DENDN P+  +  +I   ++E        L  I   D D   N QL  S+    +   S F L     +  ++ T  LD E + +Y   I  +D  G   +T + TV V I D ND+ P+F   P  S  T  I+  E    I    + +   D     NGK ++ L  D  G F++D   G+++  + +          ++ D G+ ++ + A D   P    K +++ ++I +    DNS  F
Sbjct:   49 QPYMAKIAENARVGTTILKISAIDADSGTNSQVQYKF---SNATATQTPFFSLNSVNGELTLGGPLDFE---------------VARSYMLVVIAEDLGVPK-LESRTTVIIEVTDISDMPPRFLQSFYLKEIEENTPIGSTVVTVEARDGDVGINNPILYEIISGNS--DGVFTIDSN--TGVITVN--GSIDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAFLQSVYIFDVREDVALPGRVVSDQLQVTDGDKNP----VFRRVLYHLVGADSDK-FAIDPTSGTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMFAKSSYN------YTMDEEITPGTHIADITATDADLGTFGALTYELRGGQAAYFSVNADNG------TISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDD--GGHFSING-SGLVTTA----RELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSM----SGGDSRFTLNSATGRLQISPT-GLDRELKDSYDLIINVTD-NGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEHGFFRLDPVTGELSVRKELDRESPQMSRNAQGD-GRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQF 827          

HSP 5 Score: 124.02 bits (310), Expect = 2.185e-28
Identity = 151/557 (27.11%), Postives = 251/557 (45.06%), Query Frame = 3
Query:  528 NGKLYSAQTIDREELCINVESCCHKKDPCDISLSI-AVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDD-SEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKD-KGLGGQVHCRL--SNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVK--DENDNAPVIKLENNV-SVYENK-PI--GTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFEN--------YSIQFQVTENQQALYTLGEIRVHDKD 2141
            +G LY+   ID +   I      ++++    +L++ AV S       T    I + D ND+ P+F    +  +++E   VG        TD+D ++   +R Y    N+    +FS+ +     +  +     LDRE+ A Y  ++ A D G P       + I + DVNDN P  S++ YN+   ES F    ++++ A D DE  N +  +KI        D +  F I+ N+G I +K KLDYE+   +   V   +      T    V I V +++D  P       ++   +A + EN   +   V     TD D +    +V+ R+   N +++F I  +   I  N         L+RET   YELQ+    + +     K+L+  V+   D NDNAP    E+ V SV E+  PI   T++T + A+D DEG++GE+ ++I   ++      ++++ TG L     +DRE  S     + +++   DKG+P   S    +++V D NDN P  +             F V EN  A   +G +   D D
Sbjct: 1439 SGVLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSL--MFSVNET----TGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAG-----DTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAP-----VFHKPRYSAELYENV-TRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVITLN---CTPSGCLNRETHARYELQVAAISRVNL-TEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGPITDATILT-VKAQDGDEGESGEIIFTIVSGNE--NGVFQMDNKTGVLTRTRPLDREDTS----FYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQTPMDVLIPERRTTFSVKENLDAGVPVGVVAAQDLD 1967          

HSP 6 Score: 110.538 bits (275), Expect = 2.958e-24
Identity = 122/437 (27.92%), Postives = 203/437 (46.45%), Query Frame = 3
Query:  675 CRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYL----KEKLDYERDEQHRFYVEVSNNAGHVDTATAT-VLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQV-HCRLSNNEN-VFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNV---------SVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDS 1937
              I IED+NDN P F    + + ++ES  + +     IATD D        YK+        +F ++ N  TG + ++   KLD EK + Y   + A D G PP TG   + I+V DV+DN P   +  Y+ +  E+      ++ + A D D   + K V+  +       + +  F I E SG I L       L+ E   ++   V   +     +  +    +I V+++ND  P     + +E+   + +++        +      D D+G  G++    +S NEN VF++ N+   +       RTR  LDRE   +Y L +  EDKG+P L +   + + V D NDN P+++   +V         SV EN   G  V  + A+D+D  KN  + Y I+ + +  +KY  +N  +G+L+TR+ +DRE  S
Sbjct: 1594 VMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDT-DDVFYIDAN--TGLITIK--AKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESG----NTDSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPR----FDSESYVRSVLEDTGPITDATILTVKAQDGDEGESGEIIFTIVSGNENGVFQMDNKTGVL------TRTR-PLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQTPMDVLIPERRTTFSVKENLDAGVPVGVVAAQDLDT-KN-LIYYYITNTEE--QKYFILNETSGELRTRITLDREDSS 2006          

HSP 7 Score: 104.76 bits (260), Expect = 1.472e-22
Identity = 142/557 (25.49%), Postives = 245/557 (43.99%), Query Frame = 3
Query:  513 FHLHSNGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEP-RTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGS---LFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHL------SQTNYNIQYEESKFSM-QPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYE-----RDEQH--RFYVEVS--NNAGHVD---TATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPS--NKYSIRTR-VTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVS-VYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFD---VSVKDENDNAPEFENYSIQFQVTEN 2093
            F ++ +G + +A+ +DRE +                +L+++     +    +  +  + + D NDN P+  TD  TI    SE  G    L S   A D D+       Y +         F+L  N  TG L +     LDRE +  Y+ ++   D G+PP T    +++ +LDVNDN P        S   Y I  +E   ++ + L+ I A D D + N K+ + +        D + +FR++  +G + ++++LD E     R+ Q   RF ++++  + A  +    +AT  V I V + ND +P+         N    + E     +  + ++  TD+D    G+V   +++ +      NR   +      Y+   +   L +E+K   E               +  + + V D NDN PV       + V EN P GT V  + A D D+G NG++TY ++  +        IN+ TG++     IDR    E + +F + +   D+G+P   SRK F    ++VKDENDN P+F     + ++ EN
Sbjct:  542 FSINGSGLVTTARELDRETIAT-------------YTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQI-TDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGD---SRFTL--NSATGRLQISP-TGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSG------DEHGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQF-----QSQNYETRLSEAARPGSNVIQVS-ATDQDLEYKGKVIYNITDGD-----ENRKCEVEKLVRHYNWHKKNCVLCKESKCSVE---------------RTYVVIYVDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKLTNGNK--DDAFSINNVTGEITVAGVIDR----EAVHTFVLTVQAEDQGEPS--SRKTFAEVVITVKDENDNFPQFSFTGYEGEIAEN 1038          

HSP 8 Score: 80.4925 bits (197), Expect = 3.649e-15
Identity = 151/651 (23.20%), Postives = 259/651 (39.78%), Query Frame = 3
Query:  528 NGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQ---TNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLK-EKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFI---KENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRET---------KGYYELQMECEDKGDP-PLRAKALIKV--VVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLE-INSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRS-------LDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNY 2396
            NG + +AQ +D + L    +     KD       IA+ +            + ++D+NDN P F    +T +I E+ P G++     ATD DS +     + +         FS+      GS  +   ++LDRE  A Y   + A D G   +   + + +NVLD NDN P ++       NI  E +      L  I A D D   N ++ + +          +  F +   +G + +    LD E  + +   + V++N    +T + TV + ++++ND TP  A D     +   ++    E      K +     TD D    G+V   LS +E+ F    R   + + + S+R    LDRE+          G + L +   D+  P   R  A ++V   V+D NDN+P  + +N    + E    G+ V  ++A D D    G++ Y+I++  +  K  +E +  H    K    + +E      +++ VI                    V D NDN P F        V EN      +  +   D+D  +  +++   L N          +D+ + +N           +D E    +   + A D     S    A V + ++DEND+ P F F  Y
Sbjct:  442 NGTISAAQILDYDTLR-QYQFSLVVKDGGGFYQEIAIAT----------VTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGH-FSIN-----GSGLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNIS-EGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSG-------GDSRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTP--AFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEHGFF---RLDPV-TGELSVRKE--LDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNITDGDENRKCEVEKLVRHYNWHKKNCVLCKESKCSVERTYVVIY-------------------VDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITY-KLTNG--------NKDDAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQFSFTGY 1031          

HSP 9 Score: 62.3882 bits (150), Expect = 1.168e-9
Identity = 48/177 (27.12%), Postives = 77/177 (43.50%), Query Frame = 3
Query: 1623 YELQMECED---KGDPPLRAKALIKVVVKDENDNAPVIKLENNVS-VYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD 2141
            YE  +  ED    G    R      ++V D NDNAPV   +  ++ + EN  +GT +  I+A D D G N ++ Y  S ++     +  +NS  G+L     +D     E  +S+ +++   D G P   SR    + V D +D  P F       ++ EN     T+  +   D D
Sbjct:    9 YEFTVYVEDDFNGGGLARRGSKFFFLIVDDYNDNAPVFTEQPYMAKIAENARVGTTILKISAIDADSGTNSQVQYKFSNATATQTPFFSLNSVNGELTLGGPLDF----EVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRFLQSFYLKEIEENTPIGSTVVTVEARDGD 181          

HSP 10 Score: 62.003 bits (149), Expect = 1.843e-9
Identity = 151/683 (22.11%), Postives = 272/683 (39.82%), Query Frame = 3
Query:  675 CRIQIEDINDNAPRFRTD------KFTINIKESEPVGSLFSLPI---ATDDDSEQYSIRDYKL--EENSIFPPIFSLEQNRPTGSLNLQLIQKLDREK---------RAKYEFVLLAIDRGNP---PKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNN--ENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAK-ALIKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVN-DHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGN 2639
              + I D+NDN P F  +       + I + E    G++    I   ATD D++      Y L  +E+  F        +  TG L+++  ++LDRE            ++   + A D+  P    K+  + ++I V D NDN P     NY  +  E+      ++++ A D+D     K+++ I +      D N+   +          EKL    +   +  V    +   V+     V+I V ++ND  P       N++   A + EN    T  + +   +D+D+G  G++  +L+N   ++ F I+N    I            +DRE    + L ++ ED+G+P  R   A + + VKDENDN P          + EN P+G+ +T +  +                         +I+S T  L+ R               P  L  + + +P  +        + DE   +P FE       V+E+      +G +   D+D+   +   + +  N   + F +        +++   LD E +  Y   + A++       T T  V + + D  D  P F   N S+ T  +S + S    +  ++  D D  D++    S+ + N D  GLF ID   G+I T   +   ++ ++ + V A+D  N
Sbjct:  690 VHVTILDVNDNTPAFDPNPAQSLATYVITVDEGP--GTINKTLIDINATDPDADANGKVAYSLSGDEHGFF------RLDPVTGELSVR--KELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNITDG-----DENRKCEV----------EKLVRHYNWHKKNCVLCKESKCSVE--RTYVVIYVDDVNDNDP-----VFNQSKYAADVLENSPTGTPVLRVH-ASDRDQGANGKITYKLTNGNKDDAFSINNVTGEITVAG-------VIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQFSFTGYEGEIAENSPVGSTITMVPDQ-------------------------KISSST--LRPRSS----------PRAPAALLTAREKRPITL--------INDE---SPLFEKSMYYVNVSESASRGIVIGRVTATDRDEG--INAIIFYSSNGAEAKFYVSRSTGDIIVDS--PLDREFKNVYILNVTAANIVAGAQDTTTQ-VHITVTDVIDDKPYF---NSSSLTVKLSENASIGTNVTKITALDKDIGDTI----SYSIANGDPYGLFTIDNVTGEIRTVAELDRENVTQYELFVQAKDSVN 1272          

HSP 11 Score: 53.1434 bits (126), Expect = 9.463e-7
Identity = 72/261 (27.59%), Postives = 119/261 (45.59%), Query Frame = 3
Query:  588 SCCHKKDPCDISLSIAVKS--DSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKE-SEPVGSLFSLPIATDDDSEQYS----IRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESK--FSMQ-------PLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDT 1322
             C +++      L +A  S  +  E+       I + D+NDNAPRF ++ +  ++ E + P+     L +   D  E  S           EN +F      + +  TG L     + LDRE  + Y  V++A D+G P  +  + +NI VLD+NDN P L QT  ++   E +  FS++       P+  + A+D D  +   + + I N +       KYF + E SG +  +  LD E    H  YV+ SN+  ++ T
Sbjct: 1779 GCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGPITDATILTVKAQDGDEGESGEIIFTIVSGNENGVF------QMDNKTGVLTRT--RPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPIL-QTPMDVLIPERRTTFSVKENLDAGVPVGVVAAQDLDTKN--LIYYYITNTE-----EQKYFILNETSGELRTRITLDREDSSVHYLYVKASNDKLNITT 2023          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO41005 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5N5])

HSP 1 Score: 171.014 bits (432), Expect = 7.736e-43
Identity = 170/648 (26.23%), Postives = 285/648 (43.98%), Query Frame = 3
Query:  531 GKLYSAQTIDREEL-CINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGS-LFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXX-HLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIR------TRVTLDRETKGYYELQMECEDKGDPPLRAKAL-IKVVVKDENDNAPVIK-LENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDD--NSQLRVSLVHLPNEMSSPFVLFERDNKY--YLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHE 2429
            G + + + +DRE +   N+       +  D+ ++ +V              + + D ND+ P F   ++ I+  E+ PVGS LF +     DD     +R   + E S+F        N  TG +   L+  LDRE +A+Y+  + A DRG P         +  +   ++     +  +Y+    E +      + + A D+DE  NA +V+ I+       + +  F I   SG+IY    LD E  +++   V  S+       ++  V I V ++ND  P I       NN    +          V + + +D D+G         SN    F  +    ++P  K+SI+       R +LDRE +  +       D G PP  +  +   +++ DENDN PV   +  +V++ EN P   ++  + A + DEGK   L + IS        Y  I++ TG + TR  +DRE  S     F + +T  D+G+P +++     + V DEND AP  E       V+EN      +  I   DKDD  N+++  S+ +    +++  + F   ++Y   + T   LD E++ NY+  + ASDG    +H AT  + V I D ND++P F     +  T  IS HE
Sbjct: 1020 GIITTTRALDRESIPAYNLMVTARNSNSSDMEVNCSV-------------HVIVMDTNDHTPSFTMARYYISTPETTPVGSTLFRVRAVDGDDGINAEVRYTLMGEESLF------RINYTTGIV--TLVSSLDRENKAQYQLEVEARDRGIPESNANSTTILIRVGDVNDNRPTFTHAHYDGNVLEGQVGAVAAIVV-ALDKDEEINADIVYSIIGG-----NTDNSFAINNKSGSIYTLLHLDRETTDRYILTVLASDRGEPAMNSSTNVTIHVNDVNDNKPNIT------NNPGVVVTRENTPPGSLVYILSASDLDEG---------SNARVAFSGY----AVPDGKFSIKPNGEIMVRDSLDREAQNRFVFYAMATDSGQPPFNSSMVSFDILIADENDNNPVFDPVHYSVNISENGPSEEVIVQVNASERDEGK---LLFKISSGD--PGGYFTIHNVTGVISTRKPLDREMVSR----FDLTITAEDEGRPSRMALGYVTIFVNDENDFAPVIEQCEQLVSVSENAHIGSAVASINAVDKDDPSNTKITYSVGNSAFNITTQRLPFSSGSRYRGIIITAGLLDRERQDNYNITVTASDG----NHIATCNIIVRITDVNDNSPVF-----NQTTMNISLHE 1603          

HSP 2 Score: 139.813 bits (351), Expect = 2.809e-33
Identity = 168/656 (25.61%), Postives = 286/656 (43.60%), Query Frame = 3
Query:  789 ATDDDSEQYSIR-DYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNP-------PKTGRXXXXXXXXXXXXXX---XHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNE-QPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAI-DYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMEC-EDKGDPPLRAKALIKVVVKDENDNAPVI-KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVK---DENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTG-----YKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMS-ESDMGKHVITVIARDHGNPPKESSILITIVIDN 2684
            ATD D+E+ + R +Y +   +    IF ++ N+      ++L ++LD E+  +Y+   L I   NP       PK G     +  ++V D        +  +Y+    E+      ++++ AKD D++ NA + + I  E  P+++     F I   +G I L   LD E   ++R  +          T    VLI V ++ND  P   +  Y    N+NA I         +V      D D+G+       ++   + F I      I  N        TLDRE K  Y + +   E +      +   I V+++DENDN+P+  +   +  +YEN+P GT V  ++A D D G N  ++Y++   ++   +Y +IN+  G + T  ++DRE     + +F + +T SD G P    R +    V    D NDN+PEF   S  F V E       LG I   D+D +    +  +     +   F++  R     LN T  LD E    +S ++ ASD  G       S   T  VT+ + D ND+ P     +   +T  I  + S   +++ ++  D DS +  N    +H+V+ H   F +D   G ++ ++ +  E       + +   DHG PP    + + + +DN
Sbjct:  133 ATDMDAEEINQRVNYAIVSGN-EDGIFDIDFNKGV----IRLARELDFEQMTQYK---LNISASNPLTNDTVIPKNGLSNWTMVTVNVLDADDLPVRFNNYSYSASIPENAAMGSVVMQVHAKDLDKSINAPVTYAIDKETNPLRM-----FNIANITGEITLNGSLDRETIAEYRLRILAYCTIYQDHTE---VLITVTDVNDNIPLFTLPSYNTTVNENAAIG-------TYVIQVQAEDIDQGVNASFIYEIAYAGHEFVIGEHSGIIIVNG-------TLDREKKDLYSITVIARETETSAGFHSNVTITVMLRDENDNSPIFSRALYSSPIYENEPPGTFVIQVSANDSDIGSNAMVSYAVLSDAEGHYQYFKINAKNGTITTSRRLDREN----ITTFRLRVTASD-GAPLSTIRVSVVDVVVTVLDINDNSPEFVRPSYNFSVIETALPGAILGIISAVDRDKDLNGNIVYIITEGNVEGSFIIGARSGLLQLNHT--LDREVVSKHSLRVTASDRGGEFMADGSSLNTTINVTINVLDSNDNIP---VCDKVYYTISIPENTSVGQSLIHLNCTDQDSGE--NAHLLYHMVSGHSK-FVVDNVTGIMSLNKLLDFEEKPTVFTVAIEVIDHGRPPLSLVVFVNVTVDN 745          

HSP 3 Score: 135.961 bits (341), Expect = 4.259e-32
Identity = 162/690 (23.48%), Postives = 296/690 (42.90%), Query Frame = 3
Query:  672 ECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQ-KLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXH---LSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNA--GHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLS--NNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGD------PPLRAKALIKVVVKDENDNAPVI-KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQAL--YTLGEIRVHDKDDNSQ---LRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKG-LFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI 2678
            E  I + D+NDN P F    +   + E+  +G+ + + +  +D        D  +  + I+   ++  +        + ++   LDREK+  Y   ++A  R      G        + + D   +    S+  Y+    E++     ++++ A D D   NA + + ++++        +YF+I   +G I    +LD E     R  V  S+ A    +  +   V++ V+++ND +PE    +V  +   + I+         + + +  D+DK L G +   ++  N E  F I  R   +  N        TLDRE    + L++   D+G         L     + + V D NDN PV  K+   +S+ EN  +G  + H+   D D G+N  L Y +        K++ +++ TG +     +D E+       F V + V D G+PP       +V+V + NDN P F   +  F ++E   A+    +G +  HD D +S    L   L +     + PF + ++D    L    SLD E  KNY+F ++A D    +       VTV + D ND+ P F   +   +T  +S   S  + +L +    +D+  + N   S+ +V+ + G  F +D   G+I     +    +  + +TV + D G  P+ S+ L+ I +
Sbjct:  310 EVLITVTDVNDNIPLFTLPSYNTTVNENAAIGT-YVIQVQAED-------IDQGVNASFIYEIAYAGHEFVIGEHSGIIIVNGTLDREKKDLYSITVIA--RETETSAGFHSNVTITVMLRDENDNSPIFSRALYSSPIYENEPPGTFVIQVSANDSDIGSNAMVSYAVLSDAEGHY---QYFKINAKNGTITTSRRLDRENITTFRLRVTASDGAPLSTIRVSVVDVVVTVLDINDNSPE----FVRPSYNFSVIETA--LPGAILGIISAVDRDKDLNGNIVYIITEGNVEGSFIIGARSGLLQLNH-------TLDREVVSKHSLRVTASDRGGEFMADGSSLNTTINVTINVLDSNDNIPVCDKVYYTISIPENTSVGQSLIHLNCTDQDSGENAHLLYHMVSGH---SKFV-VDNVTGIMSLNKLLDFEEKPTV---FTVAIEVIDHGRPPLSLVVFVNVTVDNVNDNYPSFGQDNYTFWISEGDFAVDHAIVGVVSAHDLDADSSNCPLCGKLQYTLGNSTGPFAI-DKDTGV-LRAVGSLDREGIKNYTFSVIAQDSIPNRPLVNVTMVTVNLLDVNDNDPVF---DRDVYTANVSEDASPGLTVLKIRA--VDNDLASNANVSYSIVSGNTGAAFHVDNVTGEIKLVSKLEREKITSYTLTVGSADGGAVPRRSTALVIIYV 959          

HSP 4 Score: 129.028 bits (323), Expect = 5.863e-30
Identity = 173/680 (25.44%), Postives = 290/680 (42.65%), Query Frame = 3
Query:  681 IQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPI-ATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQ---KTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKAL-IKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLV-NDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNSKPFS 2699
            + + D+NDN P F  D +T N+ E    G L  L I A D+D    +   Y +   +      +   +  TG +  +L+ KL+REK   Y   + + D G  P+    ++ I V+DVNDN P        ++  E+  +   ++K+   D DE  N ++ + + ++          FR++  +G I     LD E    +   V   N+         +V + V++ ND TP   +          +I   E      T F   A   D D G+  +V   L   E++F I N  + I      +    +LDRE K  Y+L++E  D+G P   A +  I + V D NDN P     + + +V E +    +   + A D DE  N ++ YSI   +  T     IN+ +G + T + +DRE    T   + + +  SD+G+P   S     + V D NDN P   N        EN      +  +   D D+ S  RV+     +  + P   F       +    SLD E +  + F  +A+D      +++  +  ++I DEND+ P F   +YS     IS +  +E  I+ V+  + D      GK  F +   D  G F I    G I+T + +    + +  +T+ A D G P + +   +TI +++   F+
Sbjct:  852 VNLLDVNDNDPVFDRDVYTANVSEDASPG-LTVLKIRAVDNDLASNANVSYSIVSGNTGA---AFHVDNVTGEI--KLVSKLEREKITSYTLTVGSADGGAVPRRSTALVIIYVMDVNDNSPVCLHDTQTVRLLENLPAGHFVVKVVTTDPDEVHNGRVEYNLTSDA---------FRVDPFTGIITTTRALDRESIPAYNLMVTARNSNSSDMEVNCSVHVIVMDTNDHTPSFTM-------ARYYISTPETTPVGSTLFRVRAV--DGDDGINAEVRYTLMGEESLFRI-NYTTGI------VTLVSSLDRENKAQYQLEVEARDRGIPESNANSTTILIRVGDVNDNRPTFTHAHYDGNVLEGQVG-AVAAIVVALDKDEEINADIVYSIIGGN--TDNSFAINNKSGSIYTLLHLDRE----TTDRYILTVLASDRGEPAMNSSTNVTIHVNDVNDNKPNITNNPGVVVTRENTPPGSLVYILSASDLDEGSNARVAF----SGYAVPDGKFSIKPNGEIMVRDSLDREAQNRFVFYAMATDSGQPPFNSSMVSFDILIADENDNNPVFDPVHYS---VNISENGPSEEVIVQVNASERDE-----GKLLFKISSGDPGGYFTIHNVTGVISTRKPLDREMVSRFDLTITAEDEGRPSRMALGYVTIFVNDENDFA 1481          

HSP 5 Score: 118.242 bits (295), Expect = 1.015e-26
Identity = 167/681 (24.52%), Postives = 281/681 (41.26%), Query Frame = 3
Query:  666 TFECRIQIEDINDNAPRFRTDKFTINIKESEPVG-SLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLK--IGAKDED-ENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATAT-VLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRL--SNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPV-IKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDD--NSQLRVSLVHLPNEMSSPFVLFERDNKYYLNT-TRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHK-GLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITI 2672
            T    I + D NDN P      +TI+I E+  VG SL  L     D  E   +  + +  +S F        +  TG ++L  +   + EK   +   +  ID G PP +  + +N+ V +VNDN P   Q NY     E  F++   +   + A D D ++ N  +  K+   Q    ++   F I++++G +     LD E  + + F V   ++  +      T V + ++++ND  P    D    N     + E+       + +  V D D      V   +   N    F + N    I       +    L+RE    Y L +   D G  P R+ AL+ + V D NDN+PV +     V + EN P G  V  +   D DE  NG + Y      +LT     ++  TG + T   +DR    E++ ++ +++T  +          +  V V D ND+ P F          E      TL  +R  D DD  N+++R +L+    E S    LF  +    + T   SLD E +  Y  ++ A D    +S+  + T+ + + D ND+ P+F   +Y             ++  +   V  LD  + +N    + ++  +    F I+   G I T   +      ++++TV+A D G P   SS  +TI
Sbjct:  632 TINVTINVLDSNDNIPVCDKVYYTISIPENTSVGQSLIHLNCTDQDSGENAHLLYHMVSGHSKFV------VDNVTGIMSLNKLLDFE-EKPTVFTVAIEVIDHGRPPLSLVVFVNVTVDNVNDNYPSFGQDNYTFWISEGDFAVDHAIVGVVSAHDLDADSSNCPLCGKL---QYTLGNSTGPFAIDKDTGVLRAVGSLDREGIKNYTFSVIAQDSIPNRPLVNVTMVTVNLLDVNDNDPVFDRDVYTAN-----VSEDASPGLTVLKIRAV-DNDLASNANVSYSIVSGNTGAAFHVDNVTGEI-------KLVSKLEREKITSYTLTVGSADGGAVPRRSTALVIIYVMDVNDNSPVCLHDTQTVRLLENLPAGHFVVKVVTTDPDEVHNGRVEY------NLTSDAFRVDPFTGIITTTRALDR----ESIPAYNLMVTARNSNSSDMEVNCSVHVIVMDTNDHTPSFTMARYYISTPETTPVGSTLFRVRAVDGDDGINAEVRYTLM---GEES----LFRINYTTGIVTLVSSLDRENKAQYQLEVEARDRGIPESNANSTTILIRVGDVNDNRPTFTHAHYDGNVL------EGQVGAVAAIVVALDKDEEINADIVYSIIGGNTDNSFAINNKSGSIYTLLHLDRETTDRYILTVLASDRGEPAMNSSTNVTI 1266          

HSP 6 Score: 111.694 bits (278), Expect = 1.057e-24
Identity = 173/720 (24.03%), Postives = 292/720 (40.56%), Query Frame = 3
Query:  627 SIAVKSDSIEEPRTFECRIQI----EDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXH---LSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDT------ATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETK-GYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGT---LVTHITAKDIDEGKN-----GELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI----DNSKPFSIGQ 2708
            SI V +   E    F   + I     D NDN+P F    ++  I E+EP G+      A D D    ++  Y +  ++     +  + N   G++     ++LDRE    +   + A D G P  T R+ +   V+ V D   +     + +YN    E+      L  I A D D++ N  +V+ I+ E  V+      F I   SG + L   LD E   +H   V  S+  G           T  V I V++ ND  P     Y   +     I EN       + L   TD+D G    +   + +  + F + N    +  NK        LD E K   + + +E  D G PPL     + V V + NDN P    +N               +V  ++A D+D   +     G+L Y++  S+        I+  TG L+    +DRE       +F VI   S   + P ++     V++ D NDN P F+       V+E+     T+ +IR  D D  S   VS   +     + F +     +  L     L+ EK  +Y+  + ++DG G     +TA V + + D ND++P  +       T+ +   E+       V V   D  +  NG+  ++L +D    F++D   G ITT+R +    +  + + V AR+  +   E +  + +++    D++  F++ +
Sbjct:  395 SITVIARETETSAGFHSNVTITVMLRDENDNSPIFSRALYSSPIYENEPPGTFVIQVSANDSDIGSNAMVSYAVLSDAEGHYQY-FKINAKNGTITTS--RRLDRENITTFRLRVTASD-GAPLSTIRVSVVDVVVTVLDINDNSPEFVRPSYNFSVIETALPGAILGIISAVDRDKDLNGNIVY-IITEGNVE----GSFIIGARSGLLQLNHTLDREVVSKHSLRVTASDRGGEFMADGSSLNTTINVTINVLDSNDNIPVCDKVYYTIS-----IPENTSVGQSLIHL-NCTDQDSGENAHLLYHMVSGHSKFVVDNVTGIMSLNKL-------LDFEEKPTVFTVAIEVIDHGRPPLSLVVFVNVTVDNVNDNYPSFGQDNYTFWISEGDFAVDHAIVGVVSAHDLDADSSNCPLCGKLQYTLGNST----GPFAIDKDTGVLRAVGSLDREGIKN--YTFSVIAQDSIPNR-PLVNVTMVTVNLLDVNDNDPVFDRDVYTANVSEDASPGLTVLKIRAVDNDLASNANVSYSIVSGNTGAAFHVDNVTGEIKL--VSKLEREKITSYTLTVGSADG-GAVPRRSTALVIIYVMDVNDNSPVCLHD-----TQTVRLLENLPAGHFVVKVVTTDPDEVHNGRVEYNLTSDA---FRVDPFTGIITTTRALDRESIPAYNLMVTARNSNSSDMEVNCSVHVIVMDTNDHTPSFTMAR 1074          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 269.626 bits (688), Expect = 1.148e-74
Identity = 228/737 (30.94%), Postives = 360/737 (48.85%), Query Frame = 3
Query:  531 GKLYSAQT-IDREEL--CINVESCCHKKDPCDISLSIAVKSDSIE--EPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKI---VNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEI---AIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSN--KYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIK---LENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNS 2687
            G +++ +  IDRE L  C        K  PC +   ++V +D ++   PR  E RI+++DINDN P+F     TI++ E+  +G+LFS+P+ATD DSE+  + DY L        +F L+     G    QLI    LDRE +  Y+  + A+D GNP +  + ++ + V D NDN P     +Y  +  E+      +L++ A D D   N ++ + +   V+  P      K  RI+  +G IY+K  LD E      FYV   +      ++   V I+V + ND  P +    I  V  +   A I E+    T  VAL  V+DKD+G    V C ++ +   F++     S   N  KY ++T   LD E    Y +++   D G+P L +   +KV V D NDN+PV      E + +  EN+P G  +  +TA D D G N EL Y+I   S + K   EI+ +TG++K R  +DRE      + +   +T +DKG P         + V D NDN P+F      F V EN   L  +G + V D D      V L   P+     FV+  ++    + ++ S D EKE +Y+F++ A DG G    ++   VT+ + DEND+ P    P+ S+F + +S   S +  +  V   DLDS  + +   S    N ++ LF+I  + G+IT ++ M+    G H + V   D G PP+ ++ L+ I ++ +
Sbjct:   70 GDIFTTEIPIDRETLRDC----RSLVKGKPCYLEFEVSV-TDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVP------KLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTA-VALVQVSDKDEGENAVVTCVVAGDVP-FQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFA-EENQP-GETILDVTATDADSGTNAELFYNIVGDSYI-KGLFEIDPNTGEVKARTPLDREHK----ERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPD--GGKFVV--QNGTGTILSSISFDREKESSYTFRLKAVDG-GEPPRSSYVGVTINVLDENDNDPVVTKPSNSSF-RQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQ-LFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNET 779          

HSP 2 Score: 76.6406 bits (187), Expect = 1.305e-13
Identity = 91/376 (24.20%), Postives = 165/376 (43.88%), Query Frame = 3
Query:  630 IAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENE-DQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVY 1754
            +AV S +     T   ++Q+ D+NDN+P F    F ++  E    G       ATD DS   +   Y +  +S    +F ++ N  TG +  +    LDRE + +YEF + A D+G+P   G   + I VLD NDN P    + Y+    E+   + P+  +   D D+ +NA +         V+ D  K F ++  +G I      D E++  + F ++  +      ++   V I V++ ND  P      V + + ++F + +        V +    D D G    +   ++   N +++     S  S + ++   +T  R+  G + L +   D+G PP  A AL+ + V +   N  +++     S+Y
Sbjct:  441 VAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPN--TGEVKAR--TPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLS------VEPDGGK-FVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDP-----VVTKPSNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGG-NPYQLFRISPS--SGEITLAKEMT--RKHGGLHRLVVRVSDRGKPPRHATALVHIYVNETISNVSLVEALVGHSLY 795          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 270.396 bits (690), Expect = 5.874e-74
Identity = 228/735 (31.02%), Postives = 361/735 (49.12%), Query Frame = 3
Query:  531 GKLYSAQT-IDREEL--CINVESCCHKKDPCDISLSIAVKSDSIE--EPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNE-QPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEI---AIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSN--KYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIK---LENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNS 2687
            G +++ +  IDRE L  C ++     K  PC +   ++V +D ++   PR  E RI+++DINDN P+F     TI++ E+  +G+LFS+P+ATD DSE+  + DY L        +F L+     G    QLI    LDRE +  Y+  + A+D GNP +  + ++ + V D NDN P     +Y  +  E+      +L++ A D D   N ++ + +     PV     K  RI+  +G IY+K  LD E      FYV   +      ++   V I+V + ND  P +    I  V  +   A I E+    T  VAL  V+DKD+G    V C ++ +   F++     S   N  KY ++T   LD E    Y +++   D G+P L +   +KV V D NDN+PV      E + +  EN+P G  +  +TA D D G N EL Y+I   S + K   EI+ +TG++K R  +DRE      + +   +T +DKG P         + V D NDN P+F      F V EN   L  +G + V D D      V L   P+     FV+  ++    + ++ S D EKE +Y+F++ A DG G    ++   VT+ + DEND+ P    P+ S+F + +S   S +  +  V   DLDS  + +   S    N ++ LF+I  + G+IT ++ M+    G H + V   D G PP+ ++ L+ I ++ +
Sbjct:  147 GDIFTTEIPIDRETLRDCRSLV----KGKPCYLEFEVSV-TDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVP----KLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTA-VALVQVSDKDEGENAVVTCVVAGDVP-FQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFA-EENQP-GETILDVTATDADSGTNAELFYNIVGDSYI-KGLFEIDPNTGEVKARTPLDREHK----ERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPD--GGKFVV--QNGTGTILSSISFDREKESSYTFRLKAVDG-GEPPRSSYVGVTINVLDENDNDPVVTKPSNSSF-RQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQ-LFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNET 856          

HSP 2 Score: 78.1814 bits (191), Expect = 5.613e-14
Identity = 93/380 (24.47%), Postives = 161/380 (42.37%), Query Frame = 3
Query:  630 IAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENE-DQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDS----SIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVY 1754
            +AV S +     T   ++Q+ D+NDN+P F    F ++  E    G       ATD DS   +   Y +  +S    +F ++ N  TG +  +    LDRE + +YEF + A D+G+P   G   + I VLD NDN P    + Y+    E+   + P+  +   D D+ +NA +         V+ D  K F ++  +G I      D E++  + F ++  +      ++   V I V++ ND  P      V + + ++F + +        V +    D D G          N + VF I   +      I  +   I     + R+  G + L +   D+G PP  A AL+ + V +   N  +++     S+Y
Sbjct:  518 VAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPN--TGEVKAR--TPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLS------VEPDGGK-FVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDP-----VVTKPSNSSFRQLSPVASPDSHVDVVEAEDLDSG---------PNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNETISNVSLVEALVGHSLY 872          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh11 (protocadherin-11 X-linked [Source:NCBI gene;Acc:101161492])

HSP 1 Score: 260.381 bits (664), Expect = 2.296e-71
Identity = 237/805 (29.44%), Postives = 389/805 (48.32%), Query Frame = 3
Query:  324 FGMILFSFGLFRKCKSEPCDIKVTDNTKENSFISNLNSFDVY----STPYTQNKKFNLLSNTKANRLFHLHSN-GKLYSA-QTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLE-QNRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDY-VNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI-KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDH--------KGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIV 2675
            F +++    +   CK++  D  V +   EN  I NL          S   +   +F  +  T    L  + +N G++++    IDRE+LC    S    +  C   + +AV  D I   R  + R  IED+NDNAP F++    I+I E+  + + + +P A D D     I++Y+L ++      F L+    P G    QLI  Q LDREKR  +   +   D GNPPK+   ++ + + DVNDN P    +   +   E+  +   + ++ A D D   NA++ F   N+  +     ++F I  ++G I +K+ LD E    H+  V  S+  G    + ATV++ V ++ND  P I   Y +N  N    + EN    TK +AL TVTDKD  L G+V C   +     ++  R   + ++++ + T   LD ET   Y +++   D+G PPL   A++ + +KDENDNAP+  + E  +S+ EN    T +  I+A D D G N E+ Y++   +        I+  +G L    ++DRE+     + F  I+   D G  P  S     + V+D NDN+P F +    F V EN     T+G I V D D  DN+ + +S+++  +     F++  +      N T   D E++ +Y+F + A DG G    ++ A VT+ + D ND+ P F+ P+ SN++  +    +   A++T  V  +D+   MN +  + +++          +GLF ID+  G IT    +  +D+G H + V  RD G P  ES   IT+V
Sbjct:    8 FPLVVLLTCVLILCKAQERDYIVKEEQPENVRIGNLLKDLDLNLDPSIRLSSPLQFKPVYKTGDVPLVRVEANTGEIFTTNHRIDREKLC----SGVFTEKRCYYEIEVAVLPDEIF--RLVKIRFLIEDVNDNAPLFQSTVINISIPENTAINTRYPVPSAFDPDVGINGIQNYELVKSVTE---FGLDIIETPEGDKWPQLIVQQNLDREKRDTFVMKIKVEDGGNPPKSSTAILQVTISDVNDNRPIFQDSELEVSVPENAPTGTSVAQLHATDADWGSNAQIHFAFSNQ--ISSSTKRHFAINSSTGLITVKQPLDREVTPVHKLIVLASD--GGSTPSRATVIVNVTDVNDNVPAIDTRYIINLVNGTVLLSENAPLNTK-IALITVTDKDADLYGKVACYTDH-----DVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDRGTPPLNTSAMVLIKIKDENDNAPIFPQPEIQLSIPENNDPSTQLIKISATDADSGSNAEIIYTLGPDA---PDGFHIDRRSGILSVGKRLDREKQ----ERFSFIVIARDNGSTPLQSNVTVRLIVQDLNDNSPAFTHPEYNFYVPENLPLYGTVGLITVTDADAGDNAAITLSILNGKDN----FIIDPQTGVIKPNIT--FDREQQSSYTFMVKAIDG-GQPPTSSYAKVTINVVDVNDNRPVFVIPS-SNYSYDLVRTTTTPGAVVT-RVFAIDNDTGMNAELQYSIISSIIITSRVSPRGLFTIDKISGNITLQEKIVGADLGLHRLVVKVRDLGQP--ESLQAITLV 775          

HSP 2 Score: 139.043 bits (349), Expect = 8.261e-33
Identity = 137/506 (27.08%), Postives = 218/506 (43.08%), Query Frame = 3
Query: 1233 IYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIK-------LENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKY-YLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITI----VIDNSKPFSIGQSN 2714
            + +++ LD E+ +     ++V +      ++TA + + + ++ND  P        ++     + EN    T  VA    TD D G   Q+H   SN   +     R  +I S+   I  +  LDRE    ++L +   D G  P RA  ++ V   D NDN P I        +   V + EN P+ T +  IT  D D    G++  +     D+  +   + +    L+T   +D E    T + + + +  SD+G PP  +     + +KDENDNAP F    IQ  + EN      L +I   D D  S   +     P+        F  D +   L+  + LD EK++ +SF ++A D  G     +  TV +I++D ND++P+F  P Y NF  Y+  +      +  ++V D D+ D  N   +  ++N  K  F ID   G I  + T        +   V A D G PP  S   +TI    V DN   F I  SN
Sbjct:  201 LIVQQNLDREKRDTFVMKIKVEDGGNPPKSSTAILQVTISDVNDNRP-----IFQDSELEVSVPENAPTGTS-VAQLHATDADWGSNAQIHFAFSNQ--ISSSTKRHFAINSSTGLITVKQPLDREVTPVHKLIVLASDGGSTPSRATVIVNVT--DVNDNVPAIDTRYIINLVNGTVLLSENAPLNTKIALITVTDKDADLYGKV--ACYTDHDVPFRLKPVFNDQFLLETAAPLDYE----TTREYAIKIVASDRGTPPLNTSAMVLIKIKDENDNAPIFPQPEIQLSIPENNDPSTQLIKISATDADSGSNAEIIYTLGPDAPDG----FHIDRRSGILSVGKRLDREKQERFSFIVIARDN-GSTPLQSNVTVRLIVQDLNDNSPAFTHPEY-NF--YVPENLPLYGTVGLITVTDADAGD--NAAITLSILNG-KDNFIIDPQTGVIKPNITFDREQQSSYTFMVKAIDGGQPPTSSYAKVTINVVDVNDNRPVFVIPSSN 679          

HSP 3 Score: 98.2117 bits (243), Expect = 3.003e-20
Identity = 107/394 (27.16%), Postives = 179/394 (45.43%), Query Frame = 3
Query: 1608 ETKGYYELQMECEDKGDPPLRAKALIKV--VVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEI-NSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRS-LDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSF---IFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKID---QNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI----DNSKPF---SIGQSNENNRDPN 2735
            E + YYE+++        P     L+K+  +++D NDNAP+ +    N+S+ EN  I T     +A D D G NG   Y + +S  +T+  L+I  +  GD   ++ + +  D E   +F + + V D G PP+ S     V++ D NDN P F++  ++  V EN     ++ ++   D D  S  ++         SS    F  ++   L T +  LD E    +   +LASDG    S    ATV V + D ND+ P+       N  N T  +S +      I  ++V D D+   + GK + +   DH   F++     ++  + T+  +      ++ I ++A D G PP  +S ++ I I    DN+  F    I  S   N DP+
Sbjct:  103 EKRCYYEIEVAVL-----PDEIFRLVKIRFLIEDVNDNAPLFQSTVINISIPENTAINTRYPVPSAFDPDVGINGIQNYELVKS--VTEFGLDIIETPEGDKWPQLIVQQNLDREKRDTFVMKIKVEDGGNPPKSSTAILQVTISDVNDNRPIFQDSELEVSVPENAPTGTSVAQLHATDADWGSNAQIHFAFSNQISSSTKRHFAINSSTGLITVKQPLDREVTPVHKLIVLASDGGSTPSR---ATVIVNVTDVNDNVPAIDTRYIINLVNGTVLLSENAPLNTKIALITVTDKDA--DLYGKVACY--TDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDRGTPPLNTSAMVLIKIKDENDNAPIFPQPEIQLSIPENNDPS 482          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh11 (protocadherin-11 X-linked [Source:NCBI gene;Acc:101161492])

HSP 1 Score: 260.766 bits (665), Expect = 3.406e-71
Identity = 237/805 (29.44%), Postives = 389/805 (48.32%), Query Frame = 3
Query:  324 FGMILFSFGLFRKCKSEPCDIKVTDNTKENSFISNLNSFDVY----STPYTQNKKFNLLSNTKANRLFHLHSN-GKLYSA-QTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLE-QNRPTGSLNLQLI--QKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDY-VNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI-KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDH--------KGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIV 2675
            F +++    +   CK++  D  V +   EN  I NL          S   +   +F  +  T    L  + +N G++++    IDRE+LC    S    +  C   + +AV  D I   R  + R  IED+NDNAP F++    I+I E+  + + + +P A D D     I++Y+L ++      F L+    P G    QLI  Q LDREKR  +   +   D GNPPK+   ++ + + DVNDN P    +   +   E+  +   + ++ A D D   NA++ F   N+  +     ++F I  ++G I +K+ LD E    H+  V  S+  G    + ATV++ V ++ND  P I   Y +N  N    + EN    TK +AL TVTDKD  L G+V C   +     ++  R   + ++++ + T   LD ET   Y +++   D+G PPL   A++ + +KDENDNAP+  + E  +S+ EN    T +  I+A D D G N E+ Y++   +        I+  +G L    ++DRE+     + F  I+   D G  P  S     + V+D NDN+P F +    F V EN     T+G I V D D  DN+ + +S+++  +     F++  +      N T   D E++ +Y+F + A DG G    ++ A VT+ + D ND+ P F+ P+ SN++  +    +   A++T  V  +D+   MN +  + +++          +GLF ID+  G IT    +  +D+G H + V  RD G P  ES   IT+V
Sbjct:    8 FPLVVLLTCVLILCKAQERDYIVKEEQPENVRIGNLLKDLDLNLDPSIRLSSPLQFKPVYKTGDVPLVRVEANTGEIFTTNHRIDREKLC----SGVFTEKRCYYEIEVAVLPDEIF--RLVKIRFLIEDVNDNAPLFQSTVINISIPENTAINTRYPVPSAFDPDVGINGIQNYELVKSVTE---FGLDIIETPEGDKWPQLIVQQNLDREKRDTFVMKIKVEDGGNPPKSSTAILQVTISDVNDNRPIFQDSELEVSVPENAPTGTSVAQLHATDADWGSNAQIHFAFSNQ--ISSSTKRHFAINSSTGLITVKQPLDREVTPVHKLIVLASD--GGSTPSRATVIVNVTDVNDNVPAIDTRYIINLVNGTVLLSENAPLNTK-IALITVTDKDADLYGKVACYTDH-----DVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDRGTPPLNTSAMVLIKIKDENDNAPIFPQPEIQLSIPENNDPSTQLIKISATDADSGSNAEIIYTLGPDA---PDGFHIDRRSGILSVGKRLDREKQ----ERFSFIVIARDNGSTPLQSNVTVRLIVQDLNDNSPAFTHPEYNFYVPENLPLYGTVGLITVTDADAGDNAAITLSILNGKDN----FIIDPQTGVIKPNIT--FDREQQSSYTFMVKAIDG-GQPPTSSYAKVTINVVDVNDNRPVFVIPS-SNYSYDLVRTTTTPGAVVT-RVFAIDNDTGMNAELQYSIISSIIITSRVSPRGLFTIDKISGNITLQEKIVGADLGLHRLVVKVRDLGQP--ESLQAITLV 775          

HSP 2 Score: 140.198 bits (352), Expect = 4.651e-33
Identity = 137/506 (27.08%), Postives = 218/506 (43.08%), Query Frame = 3
Query: 1233 IYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIK-------LENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKY-YLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITI----VIDNSKPFSIGQSN 2714
            + +++ LD E+ +     ++V +      ++TA + + + ++ND  P        ++     + EN    T  VA    TD D G   Q+H   SN   +     R  +I S+   I  +  LDRE    ++L +   D G  P RA  ++ V   D NDN P I        +   V + EN P+ T +  IT  D D    G++  +     D+  +   + +    L+T   +D E    T + + + +  SD+G PP  +     + +KDENDNAP F    IQ  + EN      L +I   D D  S   +     P+        F  D +   L+  + LD EK++ +SF ++A D  G     +  TV +I++D ND++P+F  P Y NF  Y+  +      +  ++V D D+ D  N   +  ++N  K  F ID   G I  + T        +   V A D G PP  S   +TI    V DN   F I  SN
Sbjct:  201 LIVQQNLDREKRDTFVMKIKVEDGGNPPKSSTAILQVTISDVNDNRP-----IFQDSELEVSVPENAPTGTS-VAQLHATDADWGSNAQIHFAFSNQ--ISSSTKRHFAINSSTGLITVKQPLDREVTPVHKLIVLASDGGSTPSRATVIVNVT--DVNDNVPAIDTRYIINLVNGTVLLSENAPLNTKIALITVTDKDADLYGKV--ACYTDHDVPFRLKPVFNDQFLLETAAPLDYE----TTREYAIKIVASDRGTPPLNTSAMVLIKIKDENDNAPIFPQPEIQLSIPENNDPSTQLIKISATDADSGSNAEIIYTLGPDAPDG----FHIDRRSGILSVGKRLDREKQERFSFIVIARDN-GSTPLQSNVTVRLIVQDLNDNSPAFTHPEY-NF--YVPENLPLYGTVGLITVTDADAGD--NAAITLSILNG-KDNFIIDPQTGVIKPNITFDREQQSSYTFMVKAIDGGQPPTSSYAKVTINVVDVNDNRPVFVIPSSN 679          

HSP 3 Score: 98.5969 bits (244), Expect = 2.887e-20
Identity = 108/395 (27.34%), Postives = 181/395 (45.82%), Query Frame = 3
Query: 1608 ETKGYYELQMECEDKGDPPLRAKALIKV--VVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEI-NSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRS-LDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPS----FIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKID---QNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI----DNSKPF---SIGQSNENNRDPN 2735
            E + YYE+++        P     L+K+  +++D NDNAP+ +    N+S+ EN  I T     +A D D G NG   Y + +S  +T+  L+I  +  GD   ++ + +  D E   +F + + V D G PP+ S     V++ D NDN P F++  ++  V EN     ++ ++   D D  S  ++         SS    F  ++   L T +  LD E    +   +LASDG    S    ATV V + D ND+ P+    +I  N  N T  +S +      I  ++V D D+   + GK + +   DH   F++     ++  + T+  +      ++ I ++A D G PP  +S ++ I I    DN+  F    I  S   N DP+
Sbjct:  103 EKRCYYEIEVAVL-----PDEIFRLVKIRFLIEDVNDNAPLFQSTVINISIPENTAINTRYPVPSAFDPDVGINGIQNYELVKS--VTEFGLDIIETPEGDKWPQLIVQQNLDREKRDTFVMKIKVEDGGNPPKSSTAILQVTISDVNDNRPIFQDSELEVSVPENAPTGTSVAQLHATDADWGSNAQIHFAFSNQISSSTKRHFAINSSTGLITVKQPLDREVTPVHKLIVLASDGGSTPSR---ATVIVNVTDVNDNVPAIDTRYII-NLVNGTVLLSENAPLNTKIALITVTDKDA--DLYGKVACY--TDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDRGTPPLNTSAMVLIKIKDENDNAPIFPQPEIQLSIPENNDPS 482          
BLAST of Protocadherin vs. Ensembl Medaka
Match: ENSORLT00000005325.2 (protocadherin-16 [Source:NCBI gene;Acc:101171352])

HSP 1 Score: 261.536 bits (667), Expect = 1.883e-70
Identity = 215/681 (31.57%), Postives = 339/681 (49.78%), Query Frame = 3
Query:  666 TFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGS---LNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVS---LVHLPNEMSSPFVLFERDNKYYLNTTRSLDW-EKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLV-NDHKGLFKIDQNKGKITTSRTM--SESDMGKHVITVIARDHGNPPKESSILITIV 2675
            T E  I + DIND+AP F   K  + I E   VG+ FSL  ATD D +Q + + Y ++E ++   +F LE  R       L+L +   LDREKR+ Y  V+ A D G+P + G + + + V D+ND+ P  +Q+ Y+    ES      +L++ A DEDE DN  ++++I   Q    D  +YF I+  SG I L   LDYE    H   V+  +NA   +   A V I V + ND  P + I +++E+  +  I E   Q  ++VA  +VTD D G    V+  L   +  F +  +DS I    Y I     LDRE +  Y+L++   D G PPLRA++   + V D NDN P+   +    ++ E    G+ V  +TA+D D+G NG++ YS+ +     KK+  I+  TG + T   +D E  SE   S  VI T  D G+PP  S    D+ V+D NDNAP F +      V EN  A     E+   D+D  S   ++    +     + +PF + ++  +  L T  +LD  E  + Y   + A+DG G  S      V V + D ND+ P+F +P    +T  +S H +   +++ V+  D D+ +  NG+ ++  V       F ++++ G I+ SR++    + +   VIT +  D    P  + + ++IV
Sbjct:  109 TIEVSITVNDINDHAPEFPKKKALLKIPEHTVVGTRFSLDPATDADKDQLTTQGYAIKEGNV-GHMFKLESKRSANKVLYLDLVVSGLLDREKRSSYSLVIEAFDGGSPRRVGFMTLEVTVTDINDHAPVFNQSRYHAIISESLPQGSSILQVFAADEDEGDNGLVLYEINRRQS---DPERYFVIDLKSGVITLNRPLDYELKRVHELVVQARDNASQPEVTNAFVTIHVRDFNDNQPTMTIIFLSEDG-SPRISEGA-QPGQYVARISVTDPDYGEYANVNVSLEGGDGKFALTTKDSII----YLIYVDQVLDREERDSYDLRVMATDSGTPPLRAESSFTIQVTDVNDNPPLFDQQAYRQTIPEVVYPGSFVLQVTARDKDQGPNGDVRYSLLKG----KKWFSIDPITGIITTATALDFE--SEPAPSVTVIAT--DGGRPPLSSTAKVDIVVQDVNDNAPVFSSNFYNVSVKENTPAGTCFLEVSATDEDRGSFGTITYALTLKSGGTVQTPFTINKQTGQ--LCTASALDRDEGLEKYDLTVTATDGGGLSSAVG---VRVKVMDINDNRPTF-YPVL--YTVSLSTHSAPGTSVVKVTANDPDAGE--NGRITYRTVPGGSSPFFTLNKDTGVISLSRSLHSKANTVISMVITAVDGDGLTAPVNARVNVSIV 761          

HSP 2 Score: 163.31 bits (412), Expect = 7.293e-40
Identity = 185/711 (26.02%), Postives = 310/711 (43.60%), Query Frame = 3
Query:  636 VKSDSIEEPR--TFECRIQIEDINDNAPRF---RTD-KFTINIKESEPVGSLFSLPIATDDDSEQ-----YSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDEND--NAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSN-NAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIP-SNKYSIRTRVTLDRETKGYYELQMECEDKG-DPPLR--AKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHL-VNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI----DNSKPFS 2699
            V  D    PR  T    I + D ND+AP F   R D +    ++E  P G++     A D D  +     YS+   ++E        FSL  N  TG   L+    L   +RA+Y F L A D G P  +    I I V+  + + P  +  +  +   E       +  +G  D+ E++    ++ + +V+      D +  F ++   G++YL  +LDYE+   +  +VEVS+ +    ++    + I V + ND  P+ + D V        I EN++      A     D+D G G     R S      +  +  +  P S   +IR +  LDRE+  +  L +   D+  D   R       ++ VKDENDN PV    + +SV E++P+G ++ H+ A D DEG+NG ++Y I   ++  +  L  N  TG L     +DRE+     + F + +   D G P   + +   V V D ND AP F+       V EN+    T+ ++   D+D  S   ++   +  +    FV+        + TT+ LD E + +Y   + A DG G   + A A V V ++D ND+AP F    Y    +      + E+  +  +    D      G+  + +   D  G F++    G ++TS  +      K+ + V+A D G+P   ++  + + +    DNS  FS
Sbjct: 1172 VVQDGGTPPRSATGTAHISVLDENDHAPTFTHVRPDTERMFEVREGLPSGTMVGSVAAKDPDEGENGTVYYSLSGSRVER-------FSLNPN--TG--ELKTASPLRWAERAEYTFTLTAADHGTPGLSSTCQIRIQVISSSRSIPKPNVLSMTLNVVEGTAPGSIIGSVGQVDKPESNVLEGQVTYLVVD----GTDRDGTFMVDRLRGDVYLVRELDYEKGSSYTLHVEVSDFSKAFPNSYLVKLEINVQDSNDHAPQFSEDPVT-----IVIPENKEPGASIYAFQ-AGDQD-GSGPNSELRYSIEHQWPQTSDLLALDPLSGVLTIRQQ--LDRESTPFLYLVVRATDQAVDLSQRRWGSVTARLFVKDENDNPPVFSSPSAISVMEDQPVGFVILHVMAHDADEGENGRVSYRIQSGNNAGRFSLSPN--TGSLSILKALDREEQ----EVFNLTIVAEDHGIPQLSTSQVLCVQVIDVNDEAPMFQQAEFGTHVMENKGPGTTVLKVTATDRDQGSNGHITYGGVTEDG---FVINPLTG--VITTTKELDAELQNHYVLTVYARDG-GLPPNFAKAVVRVEVQDVNDNAPVFAKMWYG--LEVPENQPAVELCFVKAT----DPDSGPGGELEYKIAAGDPDGDFQLHSRTGALSTSHGLDREKKPKYTLEVVAVDRGSPALSATATVEVKVLDVNDNSPVFS 1840          

HSP 3 Score: 162.155 bits (409), Expect = 1.513e-39
Identity = 188/695 (27.05%), Postives = 311/695 (44.75%), Query Frame = 3
Query:  666 TFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRD---YKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNP-PKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDEND-NAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDT-----ATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVT-DKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIK-LENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHG-NPPKESS--ILITIV-IDNSKPFSI 2702
            T + RIQ+   + + P+      T+N+ E    GS+    +   D  E   +     Y + + +     F +++ R     ++ L+++LD EK + Y   +   D     P +  + + INV D ND+ P  S+    I   E+K     +    A D+D +  N+++ + I ++ P   D      ++  SG + ++++LD  R+     Y+ V      VD       + T  + V + ND  P  +          + I   EDQ   FV L  +  D D+G  G+V  R+ +  N         S+  N  S+     LDRE +  + L +  ED G P L    ++ V V D ND AP+ +  E    V ENK  GT V  +TA D D+G NG +TY       +T+    IN  TG + T     +E D+E    + + +   D G PP  ++    V V+D NDNAP F       +V ENQ A+  L  ++  D D      +       +    F L  R     L+T+  LD EK+  Y+ +++A D  G  + +ATATV V + D ND++P F   +Y+     +   E+AE     + V   D  + +NGK  + L  +  G F +D++ G+ITT+  +    +  +   V A D   + P  SS  + +TI+ ++++ PF I
Sbjct: 1292 TCQIRIQVISSSRSIPKPNVLSMTLNVVEGTAPGSIIG-SVGQVDKPESNVLEGQVTYLVVDGTDRDGTFMVDRLRG----DVYLVRELDYEKGSSYTLHVEVSDFSKAFPNSYLVKLEINVQDSNDHAPQFSEDPVTIVIPENKEPGASIYAFQAGDQDGSGPNSELRYSIEHQWPQTSD---LLALDPLSGVLTIRQQLD--RESTPFLYLVVRATDQAVDLSQRRWGSVTARLFVKDENDNPPVFS--------SPSAISVMEDQPVGFVILHVMAHDADEGENGRVSYRIQSGNNAGRF-----SLSPNTGSLSILKALDREEQEVFNLTIVAEDHGIPQLSTSQVLCVQVIDVNDEAPMFQQAEFGTHVMENKGPGTTVLKVTATDRDQGSNGHITYG-----GVTEDGFVINPLTGVITTT----KELDAELQNHYVLTVYARDGGLPPNFAKAVVRVEVQDVNDNAPVFAKMWYGLEVPENQPAV-ELCFVKATDPDSGPGGELEYKIAAGDPDGDFQLHSRTGA--LSTSHGLDREKKPKYTLEVVAVD-RGSPALSATATVEVKVLDVNDNSPVFSKNSYT-----VEVLENAEEGYQVLQVSATDVDEGLNGKILYFLSQEADGAFAVDEDTGRITTAAPLDREKLASYNFRVFAVDLSPSVPINSSAQVKVTILDVNDNAPFFI 1945          

HSP 4 Score: 151.369 bits (381), Expect = 2.701e-36
Identity = 159/625 (25.44%), Postives = 270/625 (43.20%), Query Frame = 3
Query:  561 REELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKES-EPVGSLFSLPIATDDDSEQYSIRDYKL----EENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKV----DANKYFRIEENSGNIYLKEKLDYERDEQHRFYV-EVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIK-----LENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHL---PNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSF 2381
            R  L ++ E+C        + L I  +  S          I I DINDNAP F        +      +G++     ATD DS       + L       S     F +++    GS  ++LI  L  +   +Y+  ++A D G P  +    + +++   +   P+     Y ++  E+       L++ A + + + N      I +    ++    DA   F I  +SG ++++  LD E  + +   V   S ++G   T +ATV + V + ND +P ++ + V        ++EN    T F    + TD+D GL  ++  RL + +  F+I+       S    I TR+ LDRE +  Y+L +  +D G PP  A     + V DEND+AP         E    V E  P GT+V  + AKD DEG+NG + YS+S S     +   +N +TG+LKT   +   + +E    +   LT +D G P   S     + V   + + P+    S+   V E       +G +   DK +++ L   + +L     +    F++       YL   R LD+EK  +Y+  +  SD +    ++    + + ++D NDHAP F
Sbjct:  827 RTALPLDHETCSS------LDLEIQARYGSPPSYGISRVHISISDINDNAPTFLPSSSESLLLPEVTKMGTVIYRIQATDKDSGHNGQLSFDLISAGAAGSSGQRTFGIDR----GSGEVRLIGSLSYDSVPRYDLQVIAKDGGAPQLSSTFTLVVHIQAQDAQGPNFDTLTYRVELRENAPLNTRFLQVRALNREASGNGGSSSSISSSISYRLRPDGDAAG-FGIMPDSGWLFVRSSLDREAKDMYLLTVLATSRHSGTGRTGSATVRVTVTDENDNSPRLSQERVF-----LAVRENLVAGTGF-GRVSATDRDAGLNARLTYRLLHADKHFQIN-------SQTGEISTRLALDREQQSSYQLFVVVQDGGTPPRSATGTAHISVLDENDHAPTFTHVRPDTERMFEVREGLPSGTMVGSVAAKDPDEGENGTVYYSLSGSR---VERFSLNPNTGELKTASPLRWAERAE----YTFTLTAADHGTPGLSSTCQIRIQVISSSRSIPKPNVLSMTLNVVEGTAPGSIIGSVGQVDKPESNVLEGQVTYLVVDGTDRDGTFMVDRLRGDVYL--VRELDYEKGSSYTLHVEVSDFSKAFPNSYLVKLEINVQDSNDHAPQF 1418          

HSP 5 Score: 140.198 bits (352), Expect = 8.282e-33
Identity = 187/753 (24.83%), Postives = 318/753 (42.23%), Query Frame = 3
Query:  528 NGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQ----TNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSN------NENVFEIHNRDSS-----IPSNKYSIRTRVTLDRETKGYYELQMECEDKGDP-PLRAKALIKVVVKDENDNAPVIKLENNVSVY--ENKPIGTLVTHITAKDID-EGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVI-LTVSDKGQPPQISRKAFD-----VSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITI----VIDNSKPFS 2699
            +G L+   ++DRE            KD   +++    +        +   R+ + D NDN+PR   ++  + ++E+   G+ F    ATD D+   +   Y+L            + N  TG ++ +L   LDRE+++ Y+  ++  D G PP++     +I+VLD ND+ P  +     T    +  E   S   +  + AKD DE +N  + + +   +       + F +  N+G +     L +    ++ F +  +++     ++T  + IQVI+ +   P                K N    T  V   T      G  GQV    SN         V +  +RD +     +  + Y +R    LD E    Y L +E  D     P      +++ V+D ND+AP    E+ V++   ENK  G  +    A D D  G N EL YSI      T   L ++  +G L  R ++DRE       S P + L V    Q   +S++ +      + VKDENDN P F + S    V E+Q   + +  +  HD D+    RVS        +  F L    N   L+  ++LD E+++ ++  I+A D  G    + +  + V + D ND AP F     + F  ++  ++     +L V+  D D     NG  ++  V +    F I+   G ITT++ +       +V+TV ARD G PP  +  ++ +    V DN+  F+
Sbjct: 1046 SGWLFVRSSLDRE-----------AKDMYLLTVLATSRHSGTGRTGSATVRVTVTDENDNSPRLSQERVFLAVRENLVAGTGFGRVSATDRDAGLNARLTYRLLHADKH-----FQINSQTGEISTRL--ALDREQQSSYQLFVVVQDGGTPPRSATGTAHISVLDENDHAPTFTHVRPDTERMFEVREGLPSGTMVGSVAAKDPDEGENGTVYYSLSGSR------VERFSLNPNTGELKTASPLRWAERAEYTFTLTAADHGTPGLSSTCQIRIQVISSSRSIP----------------KPNVLSMTLNVVEGTAPGSIIGSVGQVDKPESNVLEGQVTYLVVDGTDRDGTFMVDRLRGDVYLVR---ELDYEKGSSYTLHVEVSDFSKAFPNSYLVKLEINVQDSNDHAPQFS-EDPVTIVIPENKEPGASIYAFQAGDQDGSGPNSELRYSIEHQWPQTSDLLALDPLSGVLTIRQQLDRE-------STPFLYLVVRATDQAVDLSQRRWGSVTARLFVKDENDNPPVFSSPS-AISVMEDQPVGFVILHVMAHDADEGENGRVSYRIQSGNNAGRFSL--SPNTGSLSILKALDREEQEVFNLTIVAED-HGIPQLSTSQVLCVQVIDVNDEAPMF---QQAEFGTHVMENKGPGTTVLKVTATDRDQGS--NGHITYGGVTEDG--FVINPLTGVITTTKELDAELQNHYVLTVYARDGGLPPNFAKAVVRVEVQDVNDNAPVFA 1736          

HSP 6 Score: 130.568 bits (327), Expect = 6.505e-30
Identity = 187/738 (25.34%), Postives = 326/738 (44.17%), Query Frame = 3
Query:  513 FHLHS-NGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRG-NPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNN-ENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVS-VYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVI--ARDHGNPPKESSILITIVI----DNSKPF 2696
            F LHS  G L ++  +DRE            K P      +AV   S     T    +++ D+NDN+P F  + +T+ + E+   G       ATD D        Y L + +     F+++++  TG +       LDREK A Y F + A+D   + P      + + +LDVNDN P   Q    I+   S+ S + L  + A+D+D   N  + ++     PV     K F I   +G I   E L      Q    VE  +      +A   V++ V  +        I + ++N ++  I+EN  + T  VA A     D    G  +   S N +++F+I +    I      + +   LD E      L ++ E        A     +V++D NDN P  +L+N V+ + E +     +  + A+D+D+G+NG++TYSI  SS       +I+  TG + T   +DRE  ++T     +++T +D+G P         V + D+NDN+P       + ++ EN      +  +  +D D +  L  SL+  P  +   F +        ++ T  LD+E++  Y+  + A+D      H   A +T+++ED ND+AP F    +  +   +  H     A++TV+  D DS +  NG+ ++ +++  +  F ID + G +  +   +E D  +  + ++  A D G+P   S   + + I    DN+  F
Sbjct: 1782 FQLHSRTGALSTSHGLDRE------------KKPKYTLEVVAVDRGSPALSATATVEVKVLDVNDNSPVFSKNSYTVEVLENAEEGYQVLQVSATDVDEGLNGKILYFLSQEA--DGAFAVDED--TGRITTA--APLDREKLASYNFRVFAVDLSPSVPINSSAQVKVTILDVNDNAPFFIQDPLIIEV-SSRRSQRVLATMKAEDKDFGANGSVFYRFAT--PV-----KGFSINSLTGEIQATEPLGSLTQAQRTLIVEAMDQGSPAQSAHGVVVVYVKEVEYN----GIRF-SKNARDVSIQENASKGTA-VAQAQAEYPDGTRQGISYSLFSGNKKHLFKISSSTGEI-----WVESSNGLDFEETPRLRLVVKAETVSSTSFMA---FNLVLQDVNDNLPRFQLQNYVAFMKEAQGYEMPIIQVVAEDVDQGQNGQVTYSIQSSS--MSGLFKIDPVTGSITTTAIMDREIFTQT----KLVVTATDRGSPRLAGLATLTVIIIDQNDNSPTIP-LPQEIRIPENTLIGTEITLVTGNDVDSSPALSYSLLLDPTALGK-FGIHRYTGG--VSITGPLDFEEKTWYTVTVQATD----SQHQTEANITIVVEDINDNAPLF---THDLYQISLPEHTPPGSAVITVTATDRDSGE--NGRVNYRVMSSTQEGFYIDPSNGTLFINH-RAEFDPERPSVNIVIEASDGGSPALSSLTTVQVHISDINDNAPVF 2459          

HSP 7 Score: 125.946 bits (315), Expect = 1.563e-28
Identity = 189/793 (23.83%), Postives = 333/793 (41.99%), Query Frame = 3
Query:  384 IKVTDNTKENSFISNLNSFDVYSTPYTQNKKFNLLSNTKANRLFHLHSN-GKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEK--LDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRL--SNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKG-LFKID-----------QNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSI--LITI--VIDNSKPFS 2699
            ++V +N +E   +  +++ DV       N K     + +A+  F +  + G++ +A  +DRE+L     S   +    D+S S+ + S +       + ++ I D+NDNAP F  D   I +        L ++     D     S+  Y+        P+     N  TG   +Q  + L    +A+   ++ A+D+G+P ++   V+ + V +V  N    S+   ++  +E+      + +  A+  D           ++      +    F+I  ++G I+++    LD+E   + R  V+    +     A   VL  V   ND  P   +      N  AF+KE +  +   + +    D D+G  GQV   +  S+   +F+I     SI        T   +DRE     +L +   D+G P L   A + V++ D+NDN+P I L   + + EN  IGT +T +T  D+D      L+YS+        K+  I+ +TG +     +D E+  +T  +  V  T S       I+     + V+D NDNAP F +   Q  + E+      +  +   D+D     RV+   + +     F +   +   ++N     D E+  + +  I ASDG G  + ++  TV V I D ND+AP F    Y       ++  S  + I      DL  +   N    F + N ++G +F+I+           Q  G +  +  +       + +TV+  D G P + SS+  LITI  V DN   FS
Sbjct: 1846 VEVLENAEEGYQVLQVSATDVDEG---LNGKILYFLSQEADGAFAVDEDTGRITTAAPLDREKLA----SYNFRVFAVDLSPSVPINSSA-------QVKVTILDVNDNAPFFIQDPLIIEVSSRRSQRVLATMKAEDKDFGANGSVF-YRFAT-----PVKGFSINSLTG--EIQATEPLGSLTQAQRTLIVEAMDQGSPAQSAHGVVVVYVKEVEYNGIRFSKNARDVSIQENASKGTAVAQAQAEYPDGTRQG------ISYSLFSGNKKHLFKISSSTGEIWVESSNGLDFEETPRLRLVVKAETVSSTSFMAFNLVLQDV---NDNLPRFQL-----QNYVAFMKEAQGYEMPIIQVV-AEDVDQGQNGQVTYSIQSSSMSGLFKIDPVTGSI-------TTTAIMDREIFTQTKLVVTATDRGSPRLAGLATLTVIIIDQNDNSPTIPLPQEIRIPENTLIGTEITLVTGNDVDSSP--ALSYSLLLDPTALGKF-GIHRYTGGVSITGPLDFEE--KTWYTVTVQATDSQHQTEANIT-----IVVEDINDNAPLFTHDLYQISLPEHTPPGSAVITVTATDRDSGENGRVNY-RVMSSTQEGFYIDPSNGTLFINHRAEFDPER-PSVNIVIEASDG-GSPALSSLTTVQVHISDINDNAPVFHQSEYRAMVSEDTFPGST-LLIFEAFDNDLSRE---NCGFDFAIANGNEGNVFQIESSVRFLEGRGFQTVGTLLLAEGLDFETKSLYNLTVVVSDRGVPQRSSSVAALITIGDVNDNPPVFS 2577          

HSP 8 Score: 125.561 bits (314), Expect = 2.118e-28
Identity = 138/511 (27.01%), Postives = 225/511 (44.03%), Query Frame = 3
Query: 1212 IEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIK--ENEDQKTKF-VALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI-KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPE----FENYSIQFQVTENQQALYTLGEIRVHDKD--DNSQLRVSLVHLPNEMSSPFVLFERDNKYYL-NTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI----DNSKPFS 2699
            I+E +G I  K +LD E  + + F       A  +   T  V I V ++ND  PE          K A +K  E+    T+F +  AT  DKD+        +  N  ++F++ ++ S+       +     LDRE +  Y L +E  D G P       ++V V D ND+APV  +   +  + E+ P G+ +  + A D DEG NG + Y I+      ++Y  I+  +G     + ++R  D E  +   +++   D    P+++     + V+D NDN P     F +     +++E  Q    +  I V D D  + + + VSL          F L  +D+  YL    + LD E+  +Y  +++A+D +G     A ++ T+ + D ND+ P F    Y      + Y  S    +L V+  D D     NG   + L+   K  F ID   G ITT+  +         +TVIA D G PP  S+  + IV+    DN+  FS
Sbjct:   77 IDETTGIITTKRRLDREERDHYSFI------AVTMTGITIEVSITVNDINDHAPEFP-------KKKALLKIPEHTVVGTRFSLDPATDADKDQLTTQGYAIKEGNVGHMFKLESKRSANKVLYLDLVVSGLLDREKRSSYSLVIEAFDGGSPRRVGFMTLEVTVTDINDHAPVFNQSRYHAIISESLPQGSSILQVFAADEDEGDNGLVLYEINRRQSDPERYFVIDLKSG----VITLNRPLDYELKRVHELVVQARDNASQPEVTNAFVTIHVRDFNDNQPTMTIIFLSEDGSPRISEGAQPGQYVARISVTDPDYGEYANVNVSL----EGGDGKFALTTKDSIIYLIYVDQVLDREERDSYDLRVMATD-SGTPPLRAESSFTIQVTDVNDNPPLFDQQAYRQTIPEVVYPGSF---VLQVTARDKDQ--GPNGDVRYSLLKGKK-WFSIDPITGIITTATALDFESEPAPSVTVIATDGGRPPLSSTAKVDIVVQDVNDNAPVFS 559          

HSP 9 Score: 112.079 bits (279), Expect = 3.094e-24
Identity = 158/628 (25.16%), Postives = 268/628 (42.68%), Query Frame = 3
Query:  375 PCDIKVTDNTKENSFISNLNSFDVYSTPYTQNKKFNLLSNTKANRLFHLHS-NGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDED------------ENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNE--NVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVV--KDENDNAPVIKLEN-NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKG-QPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPF 2201
            P +I++ +NT   + I+ +   DV S+P      ++LL +  A   F +H   G +     +D EE                   ++ V++   +        I +EDINDNAP F  D + I++ E  P GS      ATD DS +    +Y++  ++     F ++ +   G+L +    + D E R     V+ A D G+P  +    + +++ D+NDN P   Q+ Y     E  F    LL   A D D             N N   VF+I  E  V+    + F   +  G + L E LD+E    +   V VS+      +++   LI + ++ND  P       +       + E     T+ + L T TD D     +V   +S+ +  N+F I     ++       R +  LDRE +  + + ++  D         AL+ V+V  KD NDN P   +E    ++ EN P  + VT + A D D G  G+L Y + E S   +    I  ++G++++++  D E+    + SF  +    D G     ++ + F V+ +DE D  P F +    F+V E  +   ++G++   D+D      V    LP   SSP+
Sbjct: 2257 PQEIRIPENTLIGTEITLVTGNDVDSSPAL---SYSLLLDPTALGKFGIHRYTGGVSITGPLDFEEKTW---------------YTVTVQATDSQHQTEANITIVVEDINDNAPLFTHDLYQISLPEHTPPGSAVITVTATDRDSGENGRVNYRVMSST--QEGFYIDPSN--GTLFINHRAEFDPE-RPSVNIVIEASDGGSPALSSLTTVQVHISDINDNAPVFHQSEYRAMVSEDTFPGSTLLIFEAFDNDLSRENCGFDFAIANGNEGNVFQI--ESSVRFLEGRGF---QTVGTLLLAEGLDFETKSLYNLTVVVSDRGVPQRSSSVAALITIGDVNDNPP-----VFSRPEYTVALSEGAVSGTEIIRL-TATDPDSTPNAEVQYTISSGDEMNLFSIDQWTGAL-------RLQRALDREHQSTHVVIIQATDGQG----YFALVPVIVDVKDVNDNHPYFPVETLTATIQENLPANSPVTVLHAIDHDTGVFGQLKYYMMERSGSGRDSFVIEQNSGEVRSKIPFDFEK----INSFNFVAVAVDSGNHSATVTVQVF-VTGEDEYD--PLFTSTDFAFEVPEGAKKGQSIGQVLARDEDGGVDGIVLYSLLP---SSPY 2829          

HSP 10 Score: 102.064 bits (253), Expect = 2.837e-21
Identity = 182/815 (22.33%), Postives = 342/815 (41.96%), Query Frame = 3
Query:  381 DIKVTDNTKENSFISNLNSFDVYSTPYTQNKKFNLLSNTKANRLFHLHSN-GKLY--SAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPI----ATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCR-LSNNENVFEIHNRDSSIPSNK-YSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI-KLENNVSVYENKPIGTLVTHITAKDIDEGK-NGELTYSISESSDLTKKYLEINSHTGDLKTR-------MKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVS-LVHLPNEMSSPFVLFERDN-KYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLV---NDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNSKPFSIGQSNENNRDPNYVNKKFS 2756
            D+ + +N  + + ++   +   Y     Q   ++L S  K   LF + S+ G+++  S+  +D EE                  L + VK++++         + ++D+NDN PRF+   +   +KE++     + +PI    A D D  Q     Y ++ +S+   +F ++    TGS+    I  +DRE   + + V+ A DRG+P   G   + + ++D NDN P +      I+  E+      +  +   D D +    + + ++    +   A   F I   +G + +   LD+E    +   V+ +++  H   A  T++++  ++ND  P    D    +     + E+    +  + + T TD+D G  G+V+ R +S+ +  F I       PSN    I  R   D E +    + +E  D G P L +   ++V + D NDNAPV  + E    V E+   G+ +    A D D  + N    ++I+  ++      +I S    L+ R       + +    D ET   + + + VSD+G P + S  A  +++ D NDN P F        ++E   +   +  +   D D      V   +   +EM+    LF  D     L   R+LD E +  +   I A+DG GY    A   V V ++D ND+ P F        T  I  +  A   +  +   D D+   + G+  ++++      +  F I+QN G++ +        +       +A D GN    +++ + + +          + E+  DP + +  F+
Sbjct: 2052 DVSIQENASKGTAVAQAQA--EYPDGTRQGISYSLFSGNK-KHLFKISSSTGEIWVESSNGLDFEETP---------------RLRLVVKAETVSSTSFMAFNLVLQDVNDNLPRFQLQNYVAFMKEAQG----YEMPIIQVVAEDVDQGQNGQVTYSIQSSSM-SGLFKIDPV--TGSITTTAI--MDREIFTQTKLVVTATDRGSPRLAGLATLTVIIIDQNDNSPTIPLPQ-EIRIPENTLIGTEITLVTGNDVDSS--PALSYSLL----LDPTALGKFGIHRYTGGVSITGPLDFEEKTWYTVTVQATDSQ-HQTEANITIVVE--DINDNAPLFTHDLYQIS-----LPEHTPPGSAVITV-TATDRDSGENGRVNYRVMSSTQEGFYID------PSNGTLFINHRAEFDPE-RPSVNIVIEASDGGSPALSSLTTVQVHISDINDNAPVFHQSEYRAMVSEDTFPGSTLLIFEAFDNDLSRENCGFDFAIANGNE--GNVFQIESSVRFLEGRGFQTVGTLLLAEGLDFETKSLYNLTVVVSDRGVPQRSSSVAALITIGDVNDNPPVFSRPEYTVALSEGAVSGTEIIRLTATDPDSTPNAEVQYTISSGDEMN----LFSIDQWTGALRLQRALDREHQSTHVVIIQATDGQGY---FALVPVIVDVKDVNDNHPYF---PVETLTATIQENLPANSPVTVLHAIDHDT--GVFGQLKYYMMERSGSGRDSFVIEQNSGEVRSKIPFDFEKINSFNFVAVAVDSGN--HSATVTVQVFV----------TGEDEYDPLFTSTDFA 2790          

HSP 11 Score: 85.1149 bits (209), Expect = 4.556e-16
Identity = 150/629 (23.85%), Postives = 254/629 (40.38%), Query Frame = 3
Query:  537 LYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECR--IQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQ-HRFYVEVSNNAGHVDTATATVLIQVINLNDETPEI--AIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCR-LSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVI-KLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEF----ENYSIQFQVTENQQALYTLGEIRVHDKDD--NSQLRVSLVHLPNEMSSPFVLFERD-NKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSF 2381
            +Y  Q +DREE           +D  D+ +   + +DS   P   E    IQ+ D+NDN P F    +   I E    GS      A D D        Y L +   +   FS++   P   + +     LD E        ++A D G PP +    ++I V DVNDN P  S   YN+  +E+  +    L++ A DED      + + +  +    V     F I + +G +     LD  RDE   ++ + V+   G   ++   V ++V+++ND  P     +  V+ +  +A            V   T  D D G  G++  R +    + F   N+D+ + S   S+ ++            + +   D         A + V +   + ++PV  + +   +V E+   GT V  + A     G +  + YSIS        Y  ++S +G ++T + +D E    T  S  + +  +  G PP        +S+ D NDNAP F        +  +VT+    +Y    I+  DKD   N QL   L+      SS    F  D     +    SL ++    Y  +++A DG G    ++T T+ V I+ ++   P+F
Sbjct:  407 IYVDQVLDREE-----------RDSYDLRV---MATDSGTPPLRAESSFTIQVTDVNDNPPLFDQQAYRQTIPEVVYPGSFVLQVTARDKDQGPNGDVRYSLLKGKKW---FSID---PITGI-ITTATALDFESEPAPSVTVIATDGGRPPLSSTAKVDIVVQDVNDNAPVFSSNFYNVSVKENTPAGTCFLEVSATDEDRGSFGTITYALTLKSGGTVQTP--FTINKQTGQLCTASALD--RDEGLEKYDLTVTATDGGGLSSAVGVRVKVMDINDNRPTFYPVLYTVSLSTHSA--------PGTSVVKVTANDPDAGENGRITYRTVPGGSSPFFTLNKDTGVISLSRSLHSKANT------VISMVITAVDGDGLTAPVNARVNVSIVGGSTSSPVFEQAQYFFTVSEDVLRGTAVGVVRAA-TKTGVSKGIYYSISSGD--PDGYFTVDSTSGTIRTALPLDHE----TCSSLDLEIQ-ARYGSPPSYGISRVHISISDINDNAPTFLPSSSESLLLPEVTKMGTVIY---RIQATDKDSGHNGQLSFDLISAGAAGSSGQRTFGIDRGSGEVRLIGSLSYDSVPRYDLQVIAKDG-GAPQLSSTFTLVVHIQAQDAQGPNF 984          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000051236.1 (SMESG000051236.1)

HSP 1 Score: 2162.5 bits (5602), Expect = 0.000e+0
Identity = 1093/1093 (100.00%), Postives = 1093/1093 (100.00%), Query Frame = 3
Query:  312 MKIVFGMILFSFGLFRKCKSEPCDIKVTDNTKENSFISNLNSFDVYSTPYTQNKKFNLLSNTKANRLFHLHSNGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNSKPFSIGQSNENNRDPNYVNKKFSGHFIMTKESXXXXXXXXXXXXXXXXXXXXXYMRHIRGLFPMLPDIFEGCNCFSDKRNSQKKNLMYNKSVCEIPINENKHFTSSSSPLEFQQGRNNESTIMPFYFNQYDTSISTSPPHPIDQKLSVNQYRQYETMKYQHYSAPIMNTNPVPNYNYDQLCYHHPRSSPCEESFSIPNVNPNNVYDSRIKAIPSSLHRDLVTCHRIVNNIDPSPLISEELICEVKKERFSSNPCLKSDITENFVTDTSLTKTPDVRRHSKSKTDKIDTYAVTYPKEQSTFV 3590
            MKIVFGMILFSFGLFRKCKSEPCDIKVTDNTKENSFISNLNSFDVYSTPYTQNKKFNLLSNTKANRLFHLHSNGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRLVININVLDVNDNPPHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNSKPFSIGQSNENNRDPNYVNKKFSGHFIMTKESFLITSLIILLLFLLLCIFIILYMRHIRGLFPMLPDIFEGCNCFSDKRNSQKKNLMYNKSVCEIPINENKHFTSSSSPLEFQQGRNNESTIMPFYFNQYDTSISTSPPHPIDQKLSVNQYRQYETMKYQHYSAPIMNTNPVPNYNYDQLCYHHPRSSPCEESFSIPNVNPNNVYDSRIKAIPSSLHRDLVTCHRIVNNIDPSPLISEELICEVKKERFSSNPCLKSDITENFVTDTSLTKTPDVRRHSKSKTDKIDTYAVTYPKEQSTFV
Sbjct:    1 MKIVFGMILFSFGLFRKCKSEPCDIKVTDNTKENSFISNLNSFDVYSTPYTQNKKFNLLSNTKANRLFHLHSNGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRLVININVLDVNDNPPHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNSKPFSIGQSNENNRDPNYVNKKFSGHFIMTKESFLITSLIILLLFLLLCIFIILYMRHIRGLFPMLPDIFEGCNCFSDKRNSQKKNLMYNKSVCEIPINENKHFTSSSSPLEFQQGRNNESTIMPFYFNQYDTSISTSPPHPIDQKLSVNQYRQYETMKYQHYSAPIMNTNPVPNYNYDQLCYHHPRSSPCEESFSIPNVNPNNVYDSRIKAIPSSLHRDLVTCHRIVNNIDPSPLISEELICEVKKERFSSNPCLKSDITENFVTDTSLTKTPDVRRHSKSKTDKIDTYAVTYPKEQSTFV 1093          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000051236.1 (SMESG000051236.1)

HSP 1 Score: 2147.09 bits (5562), Expect = 0.000e+0
Identity = 1087/1087 (100.00%), Postives = 1087/1087 (100.00%), Query Frame = 3
Query:  330 MILFSFGLFRKCKSEPCDIKVTDNTKENSFISNLNSFDVYSTPYTQNKKFNLLSNTKANRLFHLHSNGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNSKPFSIGQSNENNRDPNYVNKKFSGHFIMTKESXXXXXXXXXXXXXXXXXXXXXYMRHIRGLFPMLPDIFEGCNCFSDKRNSQKKNLMYNKSVCEIPINENKHFTSSSSPLEFQQGRNNESTIMPFYFNQYDTSISTSPPHPIDQKLSVNQYRQYETMKYQHYSAPIMNTNPVPNYNYDQLCYHHPRSSPCEESFSIPNVNPNNVYDSRIKAIPSSLHRDLVTCHRIVNNIDPSPLISEELICEVKKERFSSNPCLKSDITENFVTDTSLTKTPDVRRHSKSKTDKIDTYAVTYPKEQSTFV 3590
            MILFSFGLFRKCKSEPCDIKVTDNTKENSFISNLNSFDVYSTPYTQNKKFNLLSNTKANRLFHLHSNGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRLVININVLDVNDNPPHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNSKPFSIGQSNENNRDPNYVNKKFSGHFIMTKESFLITSLIILLLFLLLCIFIILYMRHIRGLFPMLPDIFEGCNCFSDKRNSQKKNLMYNKSVCEIPINENKHFTSSSSPLEFQQGRNNESTIMPFYFNQYDTSISTSPPHPIDQKLSVNQYRQYETMKYQHYSAPIMNTNPVPNYNYDQLCYHHPRSSPCEESFSIPNVNPNNVYDSRIKAIPSSLHRDLVTCHRIVNNIDPSPLISEELICEVKKERFSSNPCLKSDITENFVTDTSLTKTPDVRRHSKSKTDKIDTYAVTYPKEQSTFV
Sbjct:    1 MILFSFGLFRKCKSEPCDIKVTDNTKENSFISNLNSFDVYSTPYTQNKKFNLLSNTKANRLFHLHSNGKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRLVININVLDVNDNPPHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNSKPFSIGQSNENNRDPNYVNKKFSGHFIMTKESFLITSLIILLLFLLLCIFIILYMRHIRGLFPMLPDIFEGCNCFSDKRNSQKKNLMYNKSVCEIPINENKHFTSSSSPLEFQQGRNNESTIMPFYFNQYDTSISTSPPHPIDQKLSVNQYRQYETMKYQHYSAPIMNTNPVPNYNYDQLCYHHPRSSPCEESFSIPNVNPNNVYDSRIKAIPSSLHRDLVTCHRIVNNIDPSPLISEELICEVKKERFSSNPCLKSDITENFVTDTSLTKTPDVRRHSKSKTDKIDTYAVTYPKEQSTFV 1087          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000059376.1 (SMESG000059376.1)

HSP 1 Score: 519.235 bits (1336), Expect = 3.342e-165
Identity = 384/1111 (34.56%), Postives = 582/1111 (52.39%), Query Frame = 3
Query:  312 MKIVFGMILFSFGLFRKCKSEPCDIKVTDNTKENSFISNLNSFDVYSTPYTQNKK-FNLLSNTKANRLFHLHSN-GKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVK----SDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQN--RPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHL-PNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFT-KYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI------DNSKPFSIGQSNENNRDPNYVNKKFSGHFIMTKESXXXXXXXXXXXXXXXXXXXXXYMRHIRGLFPMLPDIFEGCNCFSDKRNSQKKNLMYNKSVCEIPINENKHFTSSSSPLEFQQGRNNESTIMPFYFNQYDTSISTSPPHPIDQKLSVNQYRQ-YETMKYQHYSAPIMNTNPVPNYNYDQLCYHHPRSSPCEESFSIPNVNPNNVYDSRIKAIPSSLHRDLVTCHRIVNNIDPSPLISEELICEVKKERFSSNP-CLKSDITENFVTDTSLTKTPDVRRHSKSKTDKIDTYAVTYPKEQSTFV 3590
            MKI+  +I   F L++  ++E  +IK+ D  +  + I++L S  ++     + K  + LLS        HL SN GKL++ + IDR+ LC  +E CC     C +S+S+A+     S  + +P   +  I IED ND+ P F    F ++I ES PV + F LP+A D DS++YS++ YK    S    IFSLE        S+ L+L  +LDRE   +Y   + A+D G+P  TG LV++I VLDVNDNPP    T YN++ +ES+     + ++ A D D  +NA++ +K+          +  FR++E SG++Y+   LDYE+D++++  +   N    V+TATAT+ + VIN+NDE P I +DY N N ++A I E E     FV + TV DKD G+ G+V C+L N+  +F++          +Y I TR  LDRET   Y L + C+D+G P L A  +I VV+ D+NDN P I   +   V ENKP GT+VT I A D D+G NG+LTYSI+++ +L   YL I+S TG ++T  KIDRE  +  L    + +TVSD G P Q S K+  + + DENDNAP+F   + +F VTEN+  +Y LG+I V D D+   +R+ +  +  N   SPF +    N+++L TT SLD E+   Y   I+A+DG GYKSHTA+ATV V + D ND+ P FIFP   N T   + Y +     +LT S  D D+    NGK  F + ++   LF ID + G+I   R M  SD+G H I +   D G P   S   I I I      +N K     QS    +D N       G+    +ES  + +L+++L  +++CI  ++Y+RH++G    LPD+   C+   D+   + +N + +     IPI +NK++ + S+                +Y  QY T  +  P      ++ + + R  YE +K      P       P+ ++D          PC+    IP ++ +   D     I  +     +T H+ +N+    P+  E L      + F   P  + +    N V+  S  K P+    S        +YAV++P EQSTFV
Sbjct:    1 MKIIDMVIAVLFLLYQLLEAE--EIKIDDEIQPGTLITDLASTSIFLHEKPEGKVLYRLLSGGSFIEYLHLDSNNGKLFAKRKIDRDSLCSEIELCCKSDIICSVSVSVAMTAAQPSSKLSDPIIGKFLIVIEDRNDHKPNFEYPIFNLSISESCPVSTTFQLPLAIDKDSDKYSVKSYKFISKSDLS-IFSLETQFIDRKMSVYLRLKNRLDREDTDQYSLTIAAVDGGDPALTGVLVVHILVLDVNDNPPVFENTRYNVRVKESQMISDSIAQVRATDRDIGENAEIFYKL---------DSGMFRVDELSGSVYMISPLDYEKDQEYKLIITARNRIPGVNTATATLTVNVININDEKPVIFVDYFN-NWQHASISEYE-TAPAFVCIVTVKDKDIGIAGKVQCQLDNHHELFDLRQNSPG----QYKIHTRQQLDRETNSKYSLSIVCKDQGTPSLSADTIIPVVILDKNDNKPEINSPSIFHVSENKPPGTIVTKIDATDKDDGLNGKLTYSITDAQNLVSSYLTIDSQTGIIRTLQKIDREATNPPLTKLDLSVTVSDSGTPKQSSIKSIQILIDDENDNAPQFGQSTFRFSVTENEAPIYRLGQIEVSDPDETGSVRLGISFIKSNNRKSPFSITSEKNRFWLMTTESLDREELDFYELVIIATDGAGYKSHTASATVNVTVLDINDNPPIFIFPRSGNETIPKVPYRQQPGYLVLTASANDKDNLPRGNGKLYFSINSNSNNLFNIDPHNGEIRIHRQMGISDIGDHFIIIKVEDDGTPVLSSERQIQIKIQDIPIYENDKGNKYDQSKSEFQDGN-------GNIFSDRESIFVFALVLILFLVMICICFVVYVRHMKGWLEFLPDLISICHYKEDRTTRKGENFIPDDE--NIPIPQNKYYPNQSN----------------YYAQQYMT--AAQPNFSQTPEMFIQKGRDCYEVLK-----CP-------PDMSHD----------PCQ----IPIMHEHQYNDVLSNTIRPTFQDSYLTMHQYLNDY---PVFKESL----NGQNFPKPPKSISAQTPINIVSMNSPEKVPNPNFVSSKA-----SYAVSFPTEQSTFV 1028          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000059376.1 (SMESG000059376.1)

HSP 1 Score: 514.998 bits (1325), Expect = 1.406e-163
Identity = 381/1105 (34.48%), Postives = 578/1105 (52.31%), Query Frame = 3
Query:  330 MILFSFGLFRKCKSEPCDIKVTDNTKENSFISNLNSFDVYSTPYTQNKK-FNLLSNTKANRLFHLHSN-GKLYSAQTIDREELCINVESCCHKKDPCDISLSIAVK----SDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQN--RPTGSLNLQLIQKLDREKRAKYEFVLLAIDRGNPPKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHL-PNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFT-KYISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVI------DNSKPFSIGQSNENNRDPNYVNKKFSGHFIMTKESXXXXXXXXXXXXXXXXXXXXXYMRHIRGLFPMLPDIFEGCNCFSDKRNSQKKNLMYNKSVCEIPINENKHFTSSSSPLEFQQGRNNESTIMPFYFNQYDTSISTSPPHPIDQKLSVNQYRQ-YETMKYQHYSAPIMNTNPVPNYNYDQLCYHHPRSSPCEESFSIPNVNPNNVYDSRIKAIPSSLHRDLVTCHRIVNNIDPSPLISEELICEVKKERFSSNP-CLKSDITENFVTDTSLTKTPDVRRHSKSKTDKIDTYAVTYPKEQSTFV 3590
            +I   F L++  ++E  +IK+ D  +  + I++L S  ++     + K  + LLS        HL SN GKL++ + IDR+ LC  +E CC     C +S+S+A+     S  + +P   +  I IED ND+ P F    F ++I ES PV + F LP+A D DS++YS++ YK    S    IFSLE        S+ L+L  +LDRE   +Y   + A+D G+P  TG LV++I VLDVNDNPP    T YN++ +ES+     + ++ A D D  +NA++ +K+          +  FR++E SG++Y+   LDYE+D++++  +   N    V+TATAT+ + VIN+NDE P I +DY N N ++A I E E     FV + TV DKD G+ G+V C+L N+  +F++          +Y I TR  LDRET   Y L + C+D+G P L A  +I VV+ D+NDN P I   +   V ENKP GT+VT I A D D+G NG+LTYSI+++ +L   YL I+S TG ++T  KIDRE  +  L    + +TVSD G P Q S K+  + + DENDNAP+F   + +F VTEN+  +Y LG+I V D D+   +R+ +  +  N   SPF +    N+++L TT SLD E+   Y   I+A+DG GYKSHTA+ATV V + D ND+ P FIFP   N T   + Y +     +LT S  D D+    NGK  F + ++   LF ID + G+I   R M  SD+G H I +   D G P   S   I I I      +N K     QS    +D N       G+    +ES  + +L+++L  +++CI  ++Y+RH++G    LPD+   C+   D+   + +N + +     IPI +NK++ + S+                +Y  QY T  +  P      ++ + + R  YE +K      P       P+ ++D          PC+    IP ++ +   D     I  +     +T H+ +N+    P+  E L      + F   P  + +    N V+  S  K P+    S        +YAV++P EQSTFV
Sbjct:    2 VIAVLFLLYQLLEAE--EIKIDDEIQPGTLITDLASTSIFLHEKPEGKVLYRLLSGGSFIEYLHLDSNNGKLFAKRKIDRDSLCSEIELCCKSDIICSVSVSVAMTAAQPSSKLSDPIIGKFLIVIEDRNDHKPNFEYPIFNLSISESCPVSTTFQLPLAIDKDSDKYSVKSYKFISKSDLS-IFSLETQFIDRKMSVYLRLKNRLDREDTDQYSLTIAAVDGGDPALTGVLVVHILVLDVNDNPPVFENTRYNVRVKESQMISDSIAQVRATDRDIGENAEIFYKL---------DSGMFRVDELSGSVYMISPLDYEKDQEYKLIITARNRIPGVNTATATLTVNVININDEKPVIFVDYFN-NWQHASISEYE-TAPAFVCIVTVKDKDIGIAGKVQCQLDNHHELFDLRQNSPG----QYKIHTRQQLDRETNSKYSLSIVCKDQGTPSLSADTIIPVVILDKNDNKPEINSPSIFHVSENKPPGTIVTKIDATDKDDGLNGKLTYSITDAQNLVSSYLTIDSQTGIIRTLQKIDREATNPPLTKLDLSVTVSDSGTPKQSSIKSIQILIDDENDNAPQFGQSTFRFSVTENEAPIYRLGQIEVSDPDETGSVRLGISFIKSNNRKSPFSITSEKNRFWLMTTESLDREELDFYELVIIATDGAGYKSHTASATVNVTVLDINDNPPIFIFPRSGNETIPKVPYRQQPGYLVLTASANDKDNLPRGNGKLYFSINSNSNNLFNIDPHNGEIRIHRQMGISDIGDHFIIIKVEDDGTPVLSSERQIQIKIQDIPIYENDKGNKYDQSKSEFQDGN-------GNIFSDRESIFVFALVLILFLVMICICFVVYVRHMKGWLEFLPDLISICHYKEDRTTRKGENFIPDDE--NIPIPQNKYYPNQSN----------------YYAQQYMT--AAQPNFSQTPEMFIQKGRDCYEVLK-----CP-------PDMSHD----------PCQ----IPIMHEHQYNDVLSNTIRPTFQDSYLTMHQYLNDY---PVFKESL----NGQNFPKPPKSISAQTPINIVSMNSPEKVPNPNFVSSKA-----SYAVSFPTEQSTFV 1023          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000041975.1 (SMESG000041975.1)

HSP 1 Score: 364.77 bits (935), Expect = 8.747e-108
Identity = 262/751 (34.89%), Postives = 406/751 (54.06%), Query Frame = 3
Query:  477 FNLLSNTKANRLFHLHSNGKLYSAQTIDREELCINVESCCHK-KDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKL--EENSIFPPIFSLEQNRPTGSLNLQL--IQKLDREKRAKYEFVLLAIDRGNP-PKTGRXXXXXXXXXXXXXXXHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVD----TATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNR-DSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPL-RAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNK-YYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKY-ISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNS 2687
            ++LL ++KA+  F +  N  L++   +D + +C NV  CC+K K+ CD S++IA + +   E    + +I I D NDN P F      I I ES  +G   +LP+ATD D     +  YK+  +E   F   F L       S+ ++L   + LDRE   KY F L+AID G    KTG + I I ++D NDN P  S   Y    +E   S++ +L++ A D DE  N K+++K             YF I E+SG IYLK+ LDYE+    +F V   N    V     T+TA+V I V+N+ DE  EI +DY+N  NKN  I E E++   FVA+ TVT K+  L   + CRL + + +  + ++ D S     + IRT   +DRE        + C++  D  +  + A I++++KD+NDNAP +      S+ EN   GT+V  I A+D DEG+NG +T+S+ +S+  + +YL I    G +K +  ID E       +  +++T +D G  P+ +     ++++D NDN P+F +  + F + EN      +GEI V DKD +  + + L    N    PFV+ ++ N+ ++LNTTRSLD EK+  ++F+++A+D  G  +++ T TV V + D+ND+ P  IFP+ +N T + ISY E      +TVS  D D     N    +HL      +F IDQ +G I T R M++SD+G+HVI +   + G    +SS+ + +VID S
Sbjct:   30 YHLLKSSKAHSYFTIK-NDNLFTNTLVDMDSMCQNVGECCNKAKEICDFSIAIACRENQESEVIRKDIKISIRDKNDNYPIFNERNIEIEISESVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVR-ILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLN--NKNYSIVE-ENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVL-RSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFN-TIEYHL-ESESDVFDIDQQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDAS 772          
The following BLAST results are available for this feature:
BLAST of Protocadherin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH11Y1.789e-7431.09protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y2.445e-7431.09protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y2.702e-7431.09protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y2.702e-7431.09protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y1.040e-7331.13protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Protocadherin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-11.420e-3825.33FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-16.796e-3225.78CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
fmi-12.378e-3126.91FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-42.654e-3126.87Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI... [more]
hmr-13.056e-2525.24Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ds3.121e-5329.34gene:FBgn0284247 transcript:FBtr0078045[more]
ds3.121e-5329.34gene:FBgn0284247 transcript:FBtr0343249[more]
ft1.175e-5026.73gene:FBgn0001075 transcript:FBtr0077478[more]
stan3.498e-4425.95gene:FBgn0024836 transcript:FBtr0330601[more]
stan3.796e-4425.95gene:FBgn0024836 transcript:FBtr0339463[more]
back to top
BLAST of Protocadherin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CT030123.19.826e-8231.43protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CT030123.19.988e-8231.43protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CT030123.12.039e-8131.43protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CT030123.12.163e-8131.43protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CT030123.12.284e-8131.43protocadherin 1b [Source:NCBI gene;Acc:572016][more]
back to top
BLAST of Protocadherin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000047804.14.047e-7231.21protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047798.14.449e-7231.11protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047801.15.433e-7231.21protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000027070.11.179e-7029.24pep primary_assembly:Xenopus_tropicalis_v9.1:3:190... [more]
vapa7.651e-6629.63VAMP associated protein A [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Protocadherin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh11x8.516e-7331.14protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x3.258e-7231.15protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x4.543e-7231.02protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x6.274e-7231.15protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x6.590e-7231.15protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Protocadherin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6KEQ9|PC11X_PIG1.109e-7431.49Protocadherin-11 X-linked OS=Sus scrofa OX=9823 GN... [more]
sp|Q6WYY1|PC11X_PANPA1.253e-7331.44Protocadherin-11 X-linked OS=Pan paniscus OX=9597 ... [more]
sp|Q71M42|PC11X_PANTR1.335e-7331.44Protocadherin-11 X-linked OS=Pan troglodytes OX=95... [more]
sp|Q6X862|PC11X_GORGO2.969e-7331.44Protocadherin-11 X-linked OS=Gorilla gorilla goril... [more]
sp|Q9BZA8|PC11Y_HUMAN4.996e-7331.13Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of Protocadherin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3UIX63.672e-9529.25Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3W3Z81.026e-9230.12Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A068YFN41.865e-9228.91Protocadherin 11 OS=Echinococcus multilocularis OX... [more]
A0A0R3TSV23.584e-9229.75Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A0R3SLI47.678e-9230.19Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of Protocadherin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000036470.11.045e-7430.09pep primary_assembly:Astyanax_mexicanus-2.0:20:107... [more]
pcdh114.133e-7330.01protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
dchs1b1.004e-7231.24dachsous cadherin-related 1b [Source:ZFIN;Acc:ZDB-... [more]
pcdh111.429e-7230.01protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh112.557e-7230.01protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
back to top
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh113.282e-6229.55protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
ENSPMAT00000010725.11.078e-6127.39pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
si:ch211-199f5.19.318e-5427.74protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
ENSPMAT00000004042.12.507e-4826.83pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
ENSPMAT00000004043.12.520e-4826.83pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
back to top
BLAST of Protocadherin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461894.823e-5628.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354124.883e-5527.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404707.110e-4828.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303641.636e-4325.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410057.736e-4326.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a1.148e-7430.94protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh1a5.874e-7431.02protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh112.296e-7129.44protocadherin-11 X-linked [Source:NCBI gene;Acc:10... [more]
pcdh113.406e-7129.44protocadherin-11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSORLT00000005325.21.883e-7031.57protocadherin-16 [Source:NCBI gene;Acc:101171352][more]
back to top
BLAST of Protocadherin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051236.10.000e+0100.00SMESG000051236.1[more]
SMESG000051236.10.000e+0100.00SMESG000051236.1[more]
SMESG000059376.13.342e-16534.56SMESG000059376.1[more]
SMESG000059376.11.406e-16334.48SMESG000059376.1[more]
SMESG000041975.18.747e-10834.89SMESG000041975.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014105 ID=SMED30014105|Name=Protocadherin|organism=Schmidtea mediterranea sexual|type=transcript|length=3724bp
AAGAGAGTTGCAATGATATATAAGATAAATGATGTAAGAGGTTTTTTCAG
CAAGAAACTATAAAAAAAGAGCATTTCGTAATTATCAGCAACATTAAATG
TCGCATGACACATCCGAAAGTCTTTGTTTATCAAACTCGCTCTTCCGACG
ATTTGCGTGGGTGTTTTGACGAACATGCGAGTGGATAAACTATTTTAAAT
ATTAACGAATGCTATCTTCTTTGTCAAAAAAACAAAAACTTTCCTTATTT
TCACTAAAATCAATGTTGGGAAATTTTTGCATCGATTTCCAATATTGAAA
AAATTATCAAAATGAAAATCGTTTTTGGAATGATTTTGTTTTCATTCGGT
TTGTTCAGAAAATGCAAAAGTGAACCTTGTGACATAAAGGTGACCGATAA
CACAAAAGAAAATAGCTTTATATCCAATTTGAATTCTTTCGATGTCTACT
CCACACCTTATACCCAAAACAAGAAATTCAACTTGCTATCGAATACGAAG
GCCAACAGACTATTCCATTTGCATTCTAATGGGAAACTGTATAGTGCGCA
GACCATAGATCGTGAAGAATTATGTATAAATGTCGAATCCTGTTGTCATA
AGAAGGATCCCTGTGATATTTCTTTATCAATAGCGGTAAAATCAGATTCT
ATAGAAGAGCCAAGAACCTTCGAGTGCCGCATACAAATCGAAGACATCAA
TGACAACGCACCTAGATTTCGAACGGATAAGTTTACAATTAATATTAAAG
AATCTGAACCAGTTGGATCATTGTTTTCACTCCCAATTGCAACCGATGAC
GACAGTGAACAGTATTCCATTCGCGATTACAAACTTGAGGAAAATTCAAT
CTTTCCTCCAATATTTTCTTTGGAACAAAATCGTCCAACTGGCAGTTTAA
ATCTGCAATTAATCCAAAAGCTCGACAGGGAAAAACGAGCAAAGTATGAG
TTTGTTCTATTAGCAATTGATCGAGGAAATCCCCCTAAAACTGGAAGGTT
GGTCATTAACATAAACGTACTTGATGTTAATGATAATCCTCCTCATTTAT
CACAGACAAACTATAACATCCAGTACGAAGAAAGCAAGTTTTCAATGCAA
CCTCTTTTAAAAATCGGAGCAAAGGATGAAGACGAAAACGACAATGCAAA
AATGGTTTTCAAAATAGTCAACGAACAGCCAGTAAAAGTCGATGCAAACA
AGTATTTCCGAATTGAAGAAAATAGCGGAAACATTTATCTGAAAGAAAAG
CTTGATTACGAAAGAGATGAGCAGCATAGATTCTATGTTGAAGTATCAAA
CAACGCCGGTCACGTTGACACTGCAACGGCTACGGTGTTGATTCAAGTGA
TTAATTTGAACGATGAAACTCCAGAAATTGCCATTGACTATGTGAATGAA
AACAATAAAAATGCATTTATCAAAGAAAATGAAGACCAGAAAACGAAATT
TGTCGCTCTGGCTACAGTTACTGACAAAGACAAAGGTCTAGGAGGCCAAG
TACACTGTCGACTGTCTAATAATGAAAATGTATTTGAAATCCATAACAGA
GACTCGTCAATTCCTTCGAATAAGTATTCGATTAGAACACGAGTTACTCT
GGATCGGGAAACGAAAGGATATTATGAGCTACAGATGGAGTGCGAAGACA
AAGGTGATCCTCCTTTGAGAGCCAAGGCTTTAATTAAAGTAGTTGTAAAA
GATGAAAATGACAATGCACCAGTTATAAAGCTTGAAAATAACGTTTCGGT
GTATGAAAACAAACCAATCGGAACTTTGGTTACACACATAACCGCAAAAG
ATATCGATGAAGGAAAAAACGGAGAACTAACGTACTCTATTAGTGAATCA
AGTGATTTGACAAAAAAATACCTGGAAATAAATTCTCATACTGGAGATTT
GAAGACGAGAATGAAAATTGATCGAGAACAAGACAGTGAAACTCTACAAA
GTTTTCCAGTTATTTTGACCGTATCGGACAAAGGCCAACCTCCACAGATT
TCAAGGAAAGCCTTCGATGTCTCCGTTAAAGATGAAAACGATAACGCTCC
AGAATTCGAGAACTACTCCATTCAATTTCAAGTAACAGAAAATCAACAAG
CCCTATATACCCTAGGAGAAATTCGTGTCCATGACAAAGATGATAATTCT
CAGTTGAGAGTGTCTTTGGTTCATTTACCAAACGAAATGTCGAGTCCGTT
CGTTTTATTTGAAAGAGACAACAAGTACTATCTCAACACAACAAGAAGTT
TGGATTGGGAAAAAGAAAAAAACTATTCATTTAAAATCCTTGCAAGCGAT
GGAACTGGATACAAATCTCATACTGCAACTGCTACGGTTACTGTGATCAT
CGAAGATGAAAACGATCATGCTCCTTCATTTATTTTCCCGAATTATAGCA
ACTTTACAAAATATATTTCATATCACGAATCTGCTGAAATTGCGATTTTG
ACGGTCAGCGTTGGAGATCTTGATAGTAAAGATTCAATGAACGGAAAATG
TTCCTTTCACCTAGTCAATGACCATAAGGGTTTGTTTAAAATCGATCAAA
ATAAAGGAAAAATTACCACATCAAGAACAATGAGCGAAAGTGATATGGGA
AAACACGTCATTACAGTCATTGCTCGAGATCATGGAAATCCTCCAAAGGA
ATCCTCAATTCTAATAACAATAGTAATTGATAATTCTAAGCCATTTTCTA
TAGGGCAATCAAACGAAAATAACAGAGATCCCAATTATGTCAACAAAAAG
TTTTCTGGTCATTTTATTATGACAAAAGAAAGCTTTTTAATAACAAGCTT
AATCATATTATTGTTGTTCCTATTGCTATGTATATTCATTATTCTTTACA
TGAGACACATACGAGGGTTGTTTCCAATGCTTCCGGATATTTTTGAAGGT
TGCAATTGTTTCAGTGACAAGCGAAATTCTCAGAAAAAGAACCTAATGTA
TAACAAATCAGTTTGTGAAATCCCCATCAATGAAAATAAACATTTTACTT
CTTCAAGCTCACCTTTGGAATTTCAACAGGGACGAAATAACGAAAGCACA
ATCATGCCATTTTACTTCAATCAATACGACACATCGATCAGCACCTCCCC
CCCTCACCCAATTGATCAAAAATTGTCTGTCAATCAATATCGGCAATATG
AAACCATGAAATATCAACACTATTCTGCACCAATCATGAATACAAACCCG
GTTCCAAACTACAACTACGACCAATTATGCTATCATCATCCTCGCAGTTC
ACCTTGTGAAGAATCTTTCTCAATTCCAAACGTTAACCCAAACAACGTTT
ACGATTCCAGAATCAAAGCCATTCCAAGTAGTTTGCACCGAGATCTGGTG
ACATGTCACAGAATAGTGAACAACATCGATCCTTCACCCTTGATAAGTGA
AGAATTGATCTGTGAAGTGAAAAAAGAACGATTCTCATCGAATCCTTGCT
TGAAATCTGATATTACTGAAAATTTTGTCACAGACACTTCATTGACAAAA
ACTCCCGATGTCAGAAGGCACAGCAAAAGTAAGACCGACAAGATAGACAC
GTACGCCGTCACCTACCCAAAGGAACAATCAACTTTCGTTTAAAGTGAAA
TTCTAACCAAGATACTTGAACCGATAAACAAATATTAAATATAATGAAGA
AATATTTGGTTTTAATTTTCAAGGAGCATAATTTCCACAATTTCAAAACA
GATTTTGTATATATTGTATAATCT
back to top

protein sequence of SMED30014105-orf-1

>SMED30014105-orf-1 ID=SMED30014105-orf-1|Name=SMED30014105-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1094bp
MKIVFGMILFSFGLFRKCKSEPCDIKVTDNTKENSFISNLNSFDVYSTPY
TQNKKFNLLSNTKANRLFHLHSNGKLYSAQTIDREELCINVESCCHKKDP
CDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEP
VGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQL
IQKLDREKRAKYEFVLLAIDRGNPPKTGRLVININVLDVNDNPPHLSQTN
YNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFR
IEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLN
DETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCR
LSNNENVFEIHNRDSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDP
PLRAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDE
GKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPV
ILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYT
LGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWE
KEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTK
YISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGK
ITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNSKPFSIGQS
NENNRDPNYVNKKFSGHFIMTKESFLITSLIILLLFLLLCIFIILYMRHI
RGLFPMLPDIFEGCNCFSDKRNSQKKNLMYNKSVCEIPINENKHFTSSSS
PLEFQQGRNNESTIMPFYFNQYDTSISTSPPHPIDQKLSVNQYRQYETMK
YQHYSAPIMNTNPVPNYNYDQLCYHHPRSSPCEESFSIPNVNPNNVYDSR
IKAIPSSLHRDLVTCHRIVNNIDPSPLISEELICEVKKERFSSNPCLKSD
ITENFVTDTSLTKTPDVRRHSKSKTDKIDTYAVTYPKEQSTFV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000019muscle progenitor cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR013164Cadherin_N
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 672..689
score: 38.78
coord: 471..500
score: 34.07
coord: 561..580
score: 35.51
coord: 547..559
score: 20.49
coord: 297..316
score: 26.22
coord: 580..593
score: 32.47
coord: 637..663
score: 25.24
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 604..688
e-value: 2.2E-16
score: 70.4
coord: 158..244
e-value: 8.0E-16
score: 68.6
coord: 384..470
e-value: 1.0E-18
score: 78.2
coord: 40..134
e-value: 1.5
score: 2.1
coord: 493..580
e-value: 2.5E-17
score: 73.6
coord: 268..354
e-value: 1.9E-17
score: 74.0
coord: 715..794
e-value: 1.0E-6
score: 38.3
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 141..237
e-value: 3.0E-12
score: 46.8
coord: 477..572
e-value: 1.3E-15
score: 57.5
coord: 368..462
e-value: 2.5E-12
score: 47.0
coord: 588..680
e-value: 6.5E-10
score: 39.3
coord: 711..789
e-value: 6.8E-10
score: 39.3
coord: 251..346
e-value: 5.3E-15
score: 55.6
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 686..790
e-value: 2.2E-16
score: 62.3
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 468..577
e-value: 1.4E-24
score: 88.7
coord: 130..241
e-value: 2.3E-24
score: 88.0
coord: 242..353
e-value: 5.7E-24
score: 86.8
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 578..685
e-value: 1.7E-21
score: 78.8
coord: 354..467
e-value: 2.8E-20
score: 74.8
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 24..129
e-value: 3.9E-11
score: 45.0
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 541..954
coord: 26..542
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 247..356
score: 21.818
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 19..136
score: 13.356
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 362..472
score: 18.661
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 472..582
score: 24.449
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 583..690
score: 18.968
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 137..246
score: 21.511
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 712..809
score: 13.268
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 706..791
e-value: 2.92079E-13
score: 64.6421
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 141..242
e-value: 2.52641E-21
score: 87.7541
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 263..351
e-value: 1.45807E-19
score: 82.7465
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 367..468
e-value: 9.07797E-19
score: 80.4353
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 477..578
e-value: 1.50107E-25
score: 99.6953
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 586..686
e-value: 1.69385E-15
score: 71.1905
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.666
NoneNo IPR availableTMHMMTMhelixcoord: 824..846
IPR013164Cadherin, N-terminalPFAMPF08266Cadherin_2coord: 26..95
e-value: 8.0E-5
score: 22.4
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 460..470
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 234..244
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 570..580
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 678..688
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 570..697
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 364..472
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 466..574
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 124..253
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 234..360
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 678..791