Carbonic anhydrase-related

Overview
NameCarbonic anhydrase-related
Smed IDSMED30014102
Length (bp)1053
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Carbonic anhydrase-related (SMED30014102) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Carbonic anhydrase-related (SMED30014102) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014102

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30014102SMESG000056463.1 SmedASXL_010758SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30014102SMESG000056463.1 dd_Smed_v4_15243_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014102SMESG000056463.1 dd_Smed_v4_15243_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30014102SMESG000056463.1 dd_Smed_v4_15243_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014102SMESG000056463.1 Contig55210newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014102SMESG000056463.1 Contig55210uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30014102SMESG000056463.1 dd_Smed_v6_15243_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Carbonic anhydrase-related vs. Ensembl Human
Match: CA10 (carbonic anhydrase 10 [Source:HGNC Symbol;Acc:HGNC:1369])

HSP 1 Score: 182.956 bits (463), Expect = 2.068e-54
Identity = 105/296 (35.47%), Postives = 159/296 (53.72%), Query Frame = 2
Query:  167 WHYKPGDIGG----PQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQ--TAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSG-RMADNFRPIQSLHNRAIRTNIRLHQQTKIC--DFKQDFYYEVN 1027
            W YK    G     P  WG +      + W  C+ G  QSP+NI    +++DP LTP+ +  G + +  ++ N G+ ++        + ISGGP++YS +   + + FGS  S+GS+H +NG +F GE+Q   +NHE+Y N++ A   P GL  +S+F+K+  +S+  L  ++   T  +   K     L GL +  L P    +ITY GS+  P C ET +WII+N+ + +T  Q+ SLR L  +        M+DNFRP+Q L+NR IRTNI    Q K C  +  Q   Y VN
Sbjct:   33 WAYKEVVQGSFVPVPSFWGLV-----NSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVN 323          
BLAST of Carbonic anhydrase-related vs. Ensembl Human
Match: CA10 (carbonic anhydrase 10 [Source:HGNC Symbol;Acc:HGNC:1369])

HSP 1 Score: 182.956 bits (463), Expect = 2.068e-54
Identity = 105/296 (35.47%), Postives = 159/296 (53.72%), Query Frame = 2
Query:  167 WHYKPGDIGG----PQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQ--TAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSG-RMADNFRPIQSLHNRAIRTNIRLHQQTKIC--DFKQDFYYEVN 1027
            W YK    G     P  WG +      + W  C+ G  QSP+NI    +++DP LTP+ +  G + +  ++ N G+ ++        + ISGGP++YS +   + + FGS  S+GS+H +NG +F GE+Q   +NHE+Y N++ A   P GL  +S+F+K+  +S+  L  ++   T  +   K     L GL +  L P    +ITY GS+  P C ET +WII+N+ + +T  Q+ SLR L  +        M+DNFRP+Q L+NR IRTNI    Q K C  +  Q   Y VN
Sbjct:   33 WAYKEVVQGSFVPVPSFWGLV-----NSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVN 323          
BLAST of Carbonic anhydrase-related vs. Ensembl Human
Match: CA10 (carbonic anhydrase 10 [Source:HGNC Symbol;Acc:HGNC:1369])

HSP 1 Score: 182.956 bits (463), Expect = 2.068e-54
Identity = 105/296 (35.47%), Postives = 159/296 (53.72%), Query Frame = 2
Query:  167 WHYKPGDIGG----PQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQ--TAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSG-RMADNFRPIQSLHNRAIRTNIRLHQQTKIC--DFKQDFYYEVN 1027
            W YK    G     P  WG +      + W  C+ G  QSP+NI    +++DP LTP+ +  G + +  ++ N G+ ++        + ISGGP++YS +   + + FGS  S+GS+H +NG +F GE+Q   +NHE+Y N++ A   P GL  +S+F+K+  +S+  L  ++   T  +   K     L GL +  L P    +ITY GS+  P C ET +WII+N+ + +T  Q+ SLR L  +        M+DNFRP+Q L+NR IRTNI    Q K C  +  Q   Y VN
Sbjct:   33 WAYKEVVQGSFVPVPSFWGLV-----NSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVN 323          
BLAST of Carbonic anhydrase-related vs. Ensembl Human
Match: CA10 (carbonic anhydrase 10 [Source:HGNC Symbol;Acc:HGNC:1369])

HSP 1 Score: 163.696 bits (413), Expect = 6.155e-48
Identity = 90/248 (36.29%), Postives = 140/248 (56.45%), Query Frame = 2
Query:  299 LLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQ--TAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSG-RMADNFRPIQSLHNRAIRTNIRLHQQTKIC--DFKQDFYYEVN 1027
            +++DP LTP+ +  G + +  ++ N G+ ++        + ISGGP++YS +   + + FGS  S+GS+H +NG +F GE+Q   +NHE+Y N++ A   P GL  +S+F+K+  +S+  L  ++   T  +   K     L GL +  L P    +ITY GS+  P C ET +WII+N+ + +T  Q+ SLR L  +        M+DNFRP+Q L+NR IRTNI    Q K C  +  Q   Y VN
Sbjct:    1 MIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVN 248          
BLAST of Carbonic anhydrase-related vs. Ensembl Human
Match: CA11 (carbonic anhydrase 11 [Source:HGNC Symbol;Acc:HGNC:1370])

HSP 1 Score: 157.532 bits (397), Expect = 1.104e-44
Identity = 101/306 (33.01%), Postives = 155/306 (50.65%), Query Frame = 2
Query:   86 ALVSMILVNSANQIWRSQEWNSKWDAKWHYKPGDIGGPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALI--QTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSGR-MADNFRPIQSLHNRAIRTNIRLHQQTKIC 994
            ALV    + +A  I  + +    W  K + +   + GP  WG +        W  C  G  QSP+++ L ++LYDP L P+ +  G + +  ++ N G+ ++        + +SGGPL YS +   L + FG+    GS+H+IN   F  E+Q   FN E+Y N S A   P GLA +S+F+ +  TS+  L  L+   T  +   K    FL  L L  L P    +ITY GSL  P C ETVTWI++++ L++T  Q+ SLR L  +      + ++ N RP+Q L +RA+R N       + C
Sbjct:   12 ALVLWAALGAAAHIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLV-----NAAWSLCAVGKRQSPVDVELKRVLYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFLPAPRPVVNVSGGPLLYSHRLSELRLLFGARDGAGSEHQINHQGFSAEVQLIHFNQELYGNFSAASRGPNGLAILSLFVNVASTSNPFLSRLLNRDTITRISYKNDAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNSRPLQPLAHRALRGNRDPRHPERRC 312          
BLAST of Carbonic anhydrase-related vs. Ensembl Celegans
Match: cah-2 (Putative carbonic anhydrase-like protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q18932])

HSP 1 Score: 171.014 bits (432), Expect = 3.799e-50
Identity = 104/287 (36.24%), Postives = 150/287 (52.26%), Query Frame = 2
Query:  194 GPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQ--DLTASQTSNE-NITISGGP-LSYSFKFFSLLIKFGSLSS--RGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVT--EXXXXXXXXXXXXXXENSGRMADNFRPIQSLHNRAIRTNIRL--HQQTKICDFKQDFYYEV 1024
            GP  WG L+       W  C  G  QSP+NI   +LLYDP L PI++ G    +E   +N GQ   +T     N   I I+GGP + Y +K   + + FG      +GS+H ++ + FP E+Q   +N  +Y N S A+  P GL A+SV + IGKT+S +L+ L   ++    KG    L   Q S L+P    Y+TY GSL FPGC ETVTW+ILN  + +T  + Q+ +  Q   +       M   +RP++SL+ R +RTNI +   Q T       + Y E+
Sbjct:   16 GPDFWGLLH-----GDWRMCTAGQMQSPVNIDPSQLLYDPHLMPINIEG--NIVEAVFENTGQLPVVTVKDLPNRPTINITGGPTMPYRYKLHQISVHFGRADEGEKGSEHTVDRVRFPAEIQLLAYNSALYPNFSVAMTSPRGLLAVSVIVDIGKTTSVELRRLTVASQSINYKGQTTNLTDFQPSALLPKTSHYVTYEGSLTFPGCHETVTWVILNNPIYITNDDLQIWNEMQKTETKQPEPSYMTPAYRPLKSLNGRLVRTNINVGSKQSTVSSSCPSNVYVEM 295          
BLAST of Carbonic anhydrase-related vs. Ensembl Celegans
Match: cah-1 (Putative carbonic anhydrase-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q20781])

HSP 1 Score: 145.976 bits (367), Expect = 5.490e-41
Identity = 90/274 (32.85%), Postives = 131/274 (47.81%), Query Frame = 2
Query:  164 KWHYKPGDIGGPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTAS---QTSNENITISGGPL-SYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDV-TEXXXXXXXXXXXXXXENSGRMADNFRPIQSLHNRAIRTNIR 970
            +W Y     GGP  WG +     E  W  C KG  QSPI+I  D+LL+D  + P+ +      +     N GQ +       +   ++ I+ GPL  Y ++   +    G  +  GS+H ING  FP E+Q   +N ++Y N + A   P+G+A +SV +  G  ++ +L  L         K  +  L   +  RL+P     ITY GSL  PGC ETVTWIILNQ + +  E   +               +A NFR IQ  +NR +RTNI+
Sbjct:   29 QWSYDSDVFGGPHFWGLV-----EKDWWMCKKGRLQSPIDIQPDRLLFDASVKPVRL--DKLPVVSEFVNTGQMVRVRIGYSSKKPSVNITSGPLYGYRYRVQRIDFHMGRKNENGSEHTINGRRFPMEVQLVAYNTDLYPNFTSASKSPHGIAILSVLVDFGPETNQELIKLTIATASISYKDQRVQLADFEPWRLLPFTRDIITYEGSLTSPGCHETVTWIILNQPIFIKKEHFEEWSHLYLSMEGAEKVPVAPNFRKIQETNNRLVRTNIQ 295          
BLAST of Carbonic anhydrase-related vs. Ensembl Celegans
Match: cah-1 (Putative carbonic anhydrase-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q20781])

HSP 1 Score: 111.309 bits (277), Expect = 7.026e-29
Identity = 67/189 (35.45%), Postives = 97/189 (51.32%), Query Frame = 2
Query:  413 NITISGGPLSYSFKFFSLLIKF--GSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDV-TEXXXXXXXXXXXXXXENSGRMADNFRPIQSLHNRAIRTNIR 970
            ++ I+ GPL Y +++    I F  G  +  GS+H ING  FP E+Q   +N ++Y N + A   P+G+A +SV +  G  ++ +L  L         K  +  L   +  RL+P     ITY GSL  PGC ETVTWIILNQ + +  E   +               +A NFR IQ  +NR +RTNI+
Sbjct:   14 SVNITSGPL-YGYRYRVQRIDFHMGRKNENGSEHTINGRRFPMEVQLVAYNTDLYPNFTSASKSPHGIAILSVLVDFGPETNQELIKLTIATASISYKDQRVQLADFEPWRLLPFTRDIITYEGSLTSPGCHETVTWIILNQPIFIKKEHFEEWSHLYLSMEGAEKVPVAPNFRKIQETNNRLVRTNIQ 201          
BLAST of Carbonic anhydrase-related vs. Ensembl Celegans
Match: cah-3 (Putative carbonic anhydrase 3 [Source:UniProtKB/Swiss-Prot;Acc:Q27504])

HSP 1 Score: 79.337 bits (194), Expect = 7.417e-17
Identity = 72/268 (26.87%), Postives = 116/268 (43.28%), Query Frame = 2
Query:  167 WHYKPGDIGGPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTAS-QTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTS---SDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMP-NVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSGRMADNFRPIQSLHNRAI 955
            W Y   D  GP +W                 G +QSPINI L ++        I     +  I+  I N G  +  + +  +E+  I GG L   ++       +G   + GS+H + G+ +P EL            +   +  P  LA + VFL++GK     S++ + L    + C  +   +  N ++LS  +P N   +  Y GSL  P C E VTW I  + + VT  QL+  RQ++         +  N+RP Q+L++R I
Sbjct:    5 WSYCDDDECGPNRWP---------------TGQHQSPINIDLGEVERKDTHDGIKFVNYDHPIQGDIVNNGHSVQMTPELRSEHPEIYGGGLDQVYRLVQYHFHWGENDNEGSEHTLGGLRYPAELHL----------VHQGVEDPGKLAVVGVFLQLGKEGKALSNEERVL---GKLCNPETVTRVEN-VRLSEKLPANKRSFWRYEGSLTTPPCSEIVTWTIFTEPVTVTHDQLELFRQVQDIEKRP---IKKNYRPTQNLNDRKI 240          
BLAST of Carbonic anhydrase-related vs. Ensembl Celegans
Match: cah-5 (Putative carbonic anhydrase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q10462])

HSP 1 Score: 74.7146 bits (182), Expect = 5.933e-15
Identity = 63/253 (24.90%), Postives = 111/253 (43.87%), Query Frame = 2
Query:  251 CNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTA---SQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFL-KIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMP-NVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSGRMADNFRPIQSLHNRAIRTNIRLHQQTKIC 994
            C     QSPI+I    + Y  +L  +     +   ++ + N G+ L A       ++   I GG L + +K     + +G   + GS+H +  + +P EL        +   +  AL++P GLA + VFL K     ++    + +        G++  L   +   ++P + + +  Y GSL  P C E V W +L + + ++  QL  LRQL       S +   N+RP+Q L+ R I+       +  IC
Sbjct:   43 CQNHLKQSPIDIRAPDVDY-ALLHRMHFLNYDMDGKIELSNTGRTLFAGGFESWQHKQPMIQGGGLKHRYKLAQFHLHWGQNDAVGSEHAMGSLHYPAELHLVHVREGL--TLKEALSRPDGLAVVGVFLAKTNDPVANKFSPISERLHDLRHSGNKTELKNFRTKYVLPLDTEAFYRYEGSLTTPDCSEAVIWTVLAEPMAISSHQLHLLRQLHNKELVKSDK---NYRPLQPLNGRRIQYRPSKLDRAMIC 289          
BLAST of Carbonic anhydrase-related vs. Ensembl Fly
Match: CARPA (gene:FBgn0029962 transcript:FBtr0343348)

HSP 1 Score: 206.068 bits (523), Expect = 1.130e-63
Identity = 119/330 (36.06%), Postives = 182/330 (55.15%), Query Frame = 2
Query:   68 NYISLLALVSMILVNSANQIWRSQEWNSKWDAKWHYKPGDIGGPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLT--ASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXEN-SGRMADNFRPIQSLHNRAIRTNI---RLHQQTKICDFKQDFYYEVNTNSP 1039
            ++ S     +  +  SA  +  S E  S W+  W Y    I GP  WG +       +W  CNKG  QSPI++  DKLL+DP L P+ +      +  ++ N GQ L     + + +++ ISGGPL+Y ++F  + I +G+ + RGS+H I G SFPGE+Q YGFN E+Y N+S A +K  G+  +S+ ++IG+T + +L+ +  T  K + +G    +  + +  L+PN D YITY GS   PGC E+  WII+N+ + +T+ +L  LR+L           + +N RP+QSLH+R +RTNI   R   Q       +D YY  N  SP
Sbjct:    6 HHTSFCCSTAGFIACSAIVLLCSSEVLSSWEEWWTYD--GISGPSFWGLI-----NPQWNMCNKGRRQSPIDVVPDKLLFDPYLRPLHI--DKHKVSGTLHNTGQSLVFRVDKDTKQHVNISGGPLAYRYQFEEIYIHYGTENVRGSEHFIQGYSFPGEIQIYGFNKELYHNMSEAQHKSQGIVGLSLMVQIGETPNPELRIITSTFNKVLYRGFSTPIRHISVRSLLPNTDHYITYEGSTTHPGCWESTVWIIVNKPIYITKQELYQLRRLMQGSESTPKAPLGNNARPVQSLHHRTVRTNIDFKRNKNQYACPSMYKDMYYRANRWSP 326          
BLAST of Carbonic anhydrase-related vs. Ensembl Fly
Match: CARPA (gene:FBgn0029962 transcript:FBtr0300019)

HSP 1 Score: 206.068 bits (523), Expect = 1.130e-63
Identity = 119/330 (36.06%), Postives = 182/330 (55.15%), Query Frame = 2
Query:   68 NYISLLALVSMILVNSANQIWRSQEWNSKWDAKWHYKPGDIGGPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLT--ASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXEN-SGRMADNFRPIQSLHNRAIRTNI---RLHQQTKICDFKQDFYYEVNTNSP 1039
            ++ S     +  +  SA  +  S E  S W+  W Y    I GP  WG +       +W  CNKG  QSPI++  DKLL+DP L P+ +      +  ++ N GQ L     + + +++ ISGGPL+Y ++F  + I +G+ + RGS+H I G SFPGE+Q YGFN E+Y N+S A +K  G+  +S+ ++IG+T + +L+ +  T  K + +G    +  + +  L+PN D YITY GS   PGC E+  WII+N+ + +T+ +L  LR+L           + +N RP+QSLH+R +RTNI   R   Q       +D YY  N  SP
Sbjct:    6 HHTSFCCSTAGFIACSAIVLLCSSEVLSSWEEWWTYD--GISGPSFWGLI-----NPQWNMCNKGRRQSPIDVVPDKLLFDPYLRPLHI--DKHKVSGTLHNTGQSLVFRVDKDTKQHVNISGGPLAYRYQFEEIYIHYGTENVRGSEHFIQGYSFPGEIQIYGFNKELYHNMSEAQHKSQGIVGLSLMVQIGETPNPELRIITSTFNKVLYRGFSTPIRHISVRSLLPNTDHYITYEGSTTHPGCWESTVWIIVNKPIYITKQELYQLRRLMQGSESTPKAPLGNNARPVQSLHHRTVRTNIDFKRNKNQYACPSMYKDMYYRANRWSP 326          
BLAST of Carbonic anhydrase-related vs. Ensembl Fly
Match: CARPB (gene:FBgn0052698 transcript:FBtr0346170)

HSP 1 Score: 176.792 bits (447), Expect = 2.314e-52
Identity = 103/281 (36.65%), Postives = 158/281 (56.23%), Query Frame = 2
Query:  155 WDAKWHYKPGDIGGPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDL--TASQTSNEN-------ITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXEN-SGRMADNFRPIQSLHNRAIRTNI 967
            W+  W Y    I GP  WG   L++ E  W  CNKG  QSP+N+   +LL+DP L P+ +      I   I N G  +  TA   +  N       + ISGGPLSY ++F  + + +G     GS+H + G +FP E+Q +G+N ++Y N S ALN+  G+  +S+ L++G  S+ +L+ L    E+    G + F+  L +  L+P+ D Y+TY GS   P C ETVTW++LN+ + +T+ QL +LR+L     ++    + +N+RP Q L +R IRTNI
Sbjct:   26 WEDWWTYD--GISGPAFWG---LINPE--WSLCNKGRRQSPVNLEPQRLLFDPNLRPMHI--DKHRISGLITNTGHSVIFTAGNDTVANYDGMQTPVNISGGPLSYRYRFHEIHMHYGLNDQFGSEHSVEGYTFPAEIQIFGYNSQLYANFSDALNRAQGIVGVSILLQLGDLSNAELRMLTDQLERIRYGGDEAFVKRLSIRGLLPDTDHYMTYDGSTTAPACHETVTWVVLNKPIYITKQQLHALRRLMQGSPDHPKAPLGNNYRPPQPLLHRPIRTNI 297          
BLAST of Carbonic anhydrase-related vs. Ensembl Fly
Match: CARPB (gene:FBgn0052698 transcript:FBtr0336923)

HSP 1 Score: 176.792 bits (447), Expect = 2.314e-52
Identity = 103/281 (36.65%), Postives = 158/281 (56.23%), Query Frame = 2
Query:  155 WDAKWHYKPGDIGGPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDL--TASQTSNEN-------ITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXEN-SGRMADNFRPIQSLHNRAIRTNI 967
            W+  W Y    I GP  WG   L++ E  W  CNKG  QSP+N+   +LL+DP L P+ +      I   I N G  +  TA   +  N       + ISGGPLSY ++F  + + +G     GS+H + G +FP E+Q +G+N ++Y N S ALN+  G+  +S+ L++G  S+ +L+ L    E+    G + F+  L +  L+P+ D Y+TY GS   P C ETVTW++LN+ + +T+ QL +LR+L     ++    + +N+RP Q L +R IRTNI
Sbjct:   26 WEDWWTYD--GISGPAFWG---LINPE--WSLCNKGRRQSPVNLEPQRLLFDPNLRPMHI--DKHRISGLITNTGHSVIFTAGNDTVANYDGMQTPVNISGGPLSYRYRFHEIHMHYGLNDQFGSEHSVEGYTFPAEIQIFGYNSQLYANFSDALNRAQGIVGVSILLQLGDLSNAELRMLTDQLERIRYGGDEAFVKRLSIRGLLPDTDHYMTYDGSTTAPACHETVTWVVLNKPIYITKQQLHALRRLMQGSPDHPKAPLGNNYRPPQPLLHRPIRTNI 297          
BLAST of Carbonic anhydrase-related vs. Ensembl Fly
Match: CARPB (gene:FBgn0052698 transcript:FBtr0307489)

HSP 1 Score: 176.792 bits (447), Expect = 2.314e-52
Identity = 103/281 (36.65%), Postives = 158/281 (56.23%), Query Frame = 2
Query:  155 WDAKWHYKPGDIGGPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDL--TASQTSNEN-------ITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXEN-SGRMADNFRPIQSLHNRAIRTNI 967
            W+  W Y    I GP  WG   L++ E  W  CNKG  QSP+N+   +LL+DP L P+ +      I   I N G  +  TA   +  N       + ISGGPLSY ++F  + + +G     GS+H + G +FP E+Q +G+N ++Y N S ALN+  G+  +S+ L++G  S+ +L+ L    E+    G + F+  L +  L+P+ D Y+TY GS   P C ETVTW++LN+ + +T+ QL +LR+L     ++    + +N+RP Q L +R IRTNI
Sbjct:   26 WEDWWTYD--GISGPAFWG---LINPE--WSLCNKGRRQSPVNLEPQRLLFDPNLRPMHI--DKHRISGLITNTGHSVIFTAGNDTVANYDGMQTPVNISGGPLSYRYRFHEIHMHYGLNDQFGSEHSVEGYTFPAEIQIFGYNSQLYANFSDALNRAQGIVGVSILLQLGDLSNAELRMLTDQLERIRYGGDEAFVKRLSIRGLLPDTDHYMTYDGSTTAPACHETVTWVVLNKPIYITKQQLHALRRLMQGSPDHPKAPLGNNYRPPQPLLHRPIRTNI 297          
BLAST of Carbonic anhydrase-related vs. Ensembl Zebrafish
Match: ca10a (carbonic anhydrase Xa [Source:ZFIN;Acc:ZDB-GENE-051030-123])

HSP 1 Score: 179.104 bits (453), Expect = 3.908e-53
Identity = 104/296 (35.14%), Postives = 159/296 (53.72%), Query Frame = 2
Query:  167 WHYKPGDIGG----PQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQ--TAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSG-RMADNFRPIQSLHNRAIRTNIRLHQQTKIC--DFKQDFYYEVN 1027
            W YK    G     P  WG +      + W  C+ G  QSP+NI    +++DP LTP+ +  G + +  ++ N G+ ++        + ISGGP++YS +   + + FGS   +GS+H +NG +F GE+Q   +NHE+Y N + A   P GL  +S+F+KI +TS+  L  ++   T  +   K     L+GL +  + P    +ITY GS+  P C ET TWI++N+ + VT+ Q+ S+R L  +        M+DN RP+Q L+NR IRTNI    Q K C  +  Q   Y VN
Sbjct:   33 WAYKEVVQGSFVPVPSFWGLV-----NSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRLNTGGRKVGGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDGQGSEHLLNGQAFSGEVQLIHYNHELYTNYTEAAKSPNGLVIVSIFMKISETSNSFLNRMLNRDTITRITYKNDAYLLSGLNIEEVYPETASFITYEGSMTIPPCYETATWILMNKPIYVTKMQMHSMRLLSQNQPSQIFLSMSDNVRPVQPLNNRCIRTNINFSMQGKDCPNNRAQKLQYRVN 323          
BLAST of Carbonic anhydrase-related vs. Ensembl Zebrafish
Match: ca10a (carbonic anhydrase Xa [Source:ZFIN;Acc:ZDB-GENE-051030-123])

HSP 1 Score: 179.104 bits (453), Expect = 3.908e-53
Identity = 104/296 (35.14%), Postives = 159/296 (53.72%), Query Frame = 2
Query:  167 WHYKPGDIGG----PQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQ--TAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSG-RMADNFRPIQSLHNRAIRTNIRLHQQTKIC--DFKQDFYYEVN 1027
            W YK    G     P  WG +      + W  C+ G  QSP+NI    +++DP LTP+ +  G + +  ++ N G+ ++        + ISGGP++YS +   + + FGS   +GS+H +NG +F GE+Q   +NHE+Y N + A   P GL  +S+F+KI +TS+  L  ++   T  +   K     L+GL +  + P    +ITY GS+  P C ET TWI++N+ + VT+ Q+ S+R L  +        M+DN RP+Q L+NR IRTNI    Q K C  +  Q   Y VN
Sbjct:   33 WAYKEVVQGSFVPVPSFWGLV-----NSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRLNTGGRKVGGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDGQGSEHLLNGQAFSGEVQLIHYNHELYTNYTEAAKSPNGLVIVSIFMKISETSNSFLNRMLNRDTITRITYKNDAYLLSGLNIEEVYPETASFITYEGSMTIPPCYETATWILMNKPIYVTKMQMHSMRLLSQNQPSQIFLSMSDNVRPVQPLNNRCIRTNINFSMQGKDCPNNRAQKLQYRVN 323          
BLAST of Carbonic anhydrase-related vs. Ensembl Zebrafish
Match: ca10b (carbonic anhydrase Xb [Source:ZFIN;Acc:ZDB-GENE-080815-2])

HSP 1 Score: 177.563 bits (449), Expect = 1.346e-52
Identity = 98/282 (34.75%), Postives = 156/282 (55.32%), Query Frame = 2
Query:  158 DAKWHYKPGDIGG----PQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALI--QTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSG-RMADNFRPIQSLHNRAIRTNIRLHQQ 982
            D  W YK    G     P  WG +        W  C  G  QSP+NI   ++++DP L P+ +  G + +  ++ N G+ ++     +  + ISGGPLSYS++   + + FGS  +RGS+H +NG +FPGE+Q   +N ++Y N S A+  P G+A +S+F+KI + ++  L  ++  +T  +   K     L GL +  L P   ++ITY GS+  P C ET TWI++N+ + +++ +++SLR L  +        M DN RP Q+LH R IRTNI   Q+
Sbjct:   29 DGWWAYKDVVQGSFIPVPSFWGLV-----NTAWNLCAIGKRQSPVNIETSRMIFDPFLNPLRLNAGQRKVSGTMYNTGRHVSLRPDKSHLVNISGGPLSYSYRLEEIRLHFGSEDNRGSEHLLNGQAFPGEVQLIHYNQDLYLNYSDAVRSPNGIAVVSIFMKISEPTNVFLNRMLNRETVTRITYKHDAYLLMGLNIEELYPETSRFITYEGSITIPPCLETATWILMNKPIYISQIEMQSLRLLSQNQPSQIFLSMGDNMRPTQTLHQRCIRTNINFSQR 305          
BLAST of Carbonic anhydrase-related vs. Ensembl Zebrafish
Match: ca10a (carbonic anhydrase Xa [Source:ZFIN;Acc:ZDB-GENE-051030-123])

HSP 1 Score: 146.362 bits (368), Expect = 1.022e-41
Identity = 83/224 (37.05%), Postives = 125/224 (55.80%), Query Frame = 2
Query:  371 NMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQ--TAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSG-RMADNFRPIQSLHNRAIRTNIRLHQQTKIC--DFKQDFYYEVN 1027
            N G+ ++        + ISGGP++YS +   + + FGS   +GS+H +NG +F GE+Q   +NHE+Y N + A   P GL  +S+F+KI +TS+  L  ++   T  +   K     L+GL +  + P    +ITY GS+  P C ET TWI++N+ + VT+ Q+ S+R L  +        M+DN RP+Q L+NR IRTNI    Q K C  +  Q   Y VN
Sbjct:    7 NTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDGQGSEHLLNGQAFSGEVQLIHYNHELYTNYTEAAKSPNGLVIVSIFMKISETSNSFLNRMLNRDTITRITYKNDAYLLSGLNIEEVYPETASFITYEGSMTIPPCYETATWILMNKPIYVTKMQMHSMRLLSQNQPSQIFLSMSDNVRPVQPLNNRCIRTNINFSMQGKDCPNNRAQKLQYRVN 230          
BLAST of Carbonic anhydrase-related vs. Ensembl Zebrafish
Match: ca7 (carbonic anhydrase VII [Source:ZFIN;Acc:ZDB-GENE-040426-1786])

HSP 1 Score: 127.487 bits (319), Expect = 4.033e-34
Identity = 89/273 (32.60%), Postives = 134/273 (49.08%), Query Frame = 2
Query:  170 HYKPGDIGGPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQT-SNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVI---KGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXX--XXXXXENSGRMADNFRPIQSLHNRAIRTNIR 970
            H+  G+  GP  W   Y ++         +G+ QSPI+I   + ++D  L+PIS+   N    LSI N G  +      ++E   I+GGPL   ++       +GS    GS+H + G +F  EL    +N   Y + S A   P GLA + +FL+ G    D+ +AL Q  +   +   KGS     G     L+PN  +Y TYPGSL  P   E+VTWI+L + + V+E Q+   R L       E+  RM +N+RP Q L  R +R + +
Sbjct:    5 HWGYGEDNGPSAWHKDYPIA---------EGNRQSPIDIVPSEAVFDAKLSPISL-SYNNCTSLSISNNGHSVVVEFVDTDERSVITGGPLENMYRLKQFHFHWGSKGCCGSEHTVAGKTFVSELHLVHWNANKYKSFSEAAAAPDGLAVLGIFLETG----DEHRALHQITDALYMVRFKGSLAEFKGFNPKCLLPNSLEYWTYPGSLTTPPLYESVTWIVLKEPIYVSEKQMGKFRTLLFNGEEEEDRNRMENNYRPPQPLKGRMVRASFK 263          
BLAST of Carbonic anhydrase-related vs. Ensembl Xenopus
Match: CA10 (carbonic anhydrase 10 [Source:HGNC Symbol;Acc:HGNC:1369])

HSP 1 Score: 180.259 bits (456), Expect = 2.227e-53
Identity = 107/296 (36.15%), Postives = 162/296 (54.73%), Query Frame = 2
Query:  131 RSQEWNSKW-DAKWHYKPGDIGG----PQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALI--QTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXX-XENSGRMADNFRPIQSLHNRAIRTNIRLHQQTKIC 994
            RSQ+ + K  +  W YK    G     P  WG +      + W  C  G  QSP+NI    +++DP LTP+ +  G + +  ++ N G+ ++        + ISGGPL+YS +   + + FGS   +GS+H +NG +F GE+Q   +NHE+Y N++ A   P GL  IS+F+K+  +S+  L  ++   T  +   K     L GL +  + P    +ITY GS+  P C ET +WII+N+ + +T  Q+ SLR L  +  S+    M+DNFRP+QSL+NR IRTNI    Q K C
Sbjct:   29 RSQQNSPKIHEGWWTYKEVVQGSFVPVPSFWGLV-----NSAWNLCAVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPLTYSHRLEEIRLHFGSEDGQGSEHLLNGQAFSGEVQLIHYNHELYTNVTDAAKSPNGLVVISIFIKVTDSSNLFLNRMLNRDTITRITYKNDAYLLQGLNIEEIYPETSSFITYDGSMTIPPCYETASWIIMNKPIYITRMQMHSLRLLSQNQPSQIFSSMSDNFRPVQSLNNRCIRTNINFRLQGKDC 319          
BLAST of Carbonic anhydrase-related vs. Ensembl Xenopus
Match: CA11 (carbonic anhydrase XI [Source:NCBI gene;Acc:100493884])

HSP 1 Score: 160.999 bits (406), Expect = 4.902e-46
Identity = 93/309 (30.10%), Postives = 166/309 (53.72%), Query Frame = 2
Query:   77 SLLALVSMILVNSANQIWRSQEWNSKWDAKWHYKPGDIGGPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALI--QTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSGR-MADNFRPIQSLHNRAIRTNIRLHQQTKIC 994
            S+L L +   + +A Q   ++ +   W  K   +   + GP  WG +      + W  C  G  QSPINI+  ++++DP L P+ +     ++  ++ N G+ ++      + + ISGGPL Y+ +   +++ FGS +S GS+H +N  +  GE+Q   +N ++Y N++ A   P GLA IS+FL +   S+  L  ++  +T  +   +    ++  L +  L P+   ++TY GS+  P C ETVTWI++++ L++T  Q+ SLR L  +      + M+DNFRP+Q L +R +R N+   +  + C
Sbjct:    8 SVLILQASAAIYTAAQFSPAKTYEEWWAYKEAVQGSFVPGPAFWGLV-----NSAWNLCTIGKRQSPININTSQIIFDPFLPPLRLSMTGTTVSGTMHNTGRHVSFRLDKEQPVNISGGPLLYNHRLEEVMLHFGSENSIGSEHLMNKETSAGEVQLIHYNQDLYSNVTEASRNPNGLAVISLFLNVADNSNSFLNRMLNRETITRISFRNEATYIQDLSIEDLYPDTFGFLTYQGSMTIPPCYETVTWIVIDRPLNITSMQMHSLRLLSQNQPSQIFQSMSDNFRPVQPLFHRGLRGNLDFRKPGRKC 311          
BLAST of Carbonic anhydrase-related vs. Ensembl Xenopus
Match: CA11 (carbonic anhydrase XI [Source:NCBI gene;Acc:100493884])

HSP 1 Score: 157.918 bits (398), Expect = 8.996e-45
Identity = 91/307 (29.64%), Postives = 163/307 (53.09%), Query Frame = 2
Query:   83 LALVSMILVNSANQIWRSQEWNSKWDAKWHYKPGDIGGPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALI--QTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSGR-MADNFRPIQSLHNRAIRTNIRLHQQTKIC 994
            L +  +I    + Q   ++ +   W  K   +   + GP  WG +      + W  C  G  QSPINI+  ++++DP L P+ +     ++  ++ N G+ ++      + + ISGGPL Y+ +   +++ FGS +S GS+H +N  +  GE+Q   +N ++Y N++ A   P GLA IS+FL +   S+  L  ++  +T  +   +    ++  L +  L P+   ++TY GS+  P C ETVTWI++++ L++T  Q+ SLR L  +      + M+DNFRP+Q L +R +R N+   +  + C
Sbjct:   23 LCVRRVIYPGESAQFSPAKTYEEWWAYKEAVQGSFVPGPAFWGLV-----NSAWNLCTIGKRQSPININTSQIIFDPFLPPLRLSMTGTTVSGTMHNTGRHVSFRLDKEQPVNISGGPLLYNHRLEEVMLHFGSENSIGSEHLMNKETSAGEVQLIHYNQDLYSNVTEASRNPNGLAVISLFLNVADNSNSFLNRMLNRETITRISFRNEATYIQDLSIEDLYPDTFGFLTYQGSMTIPPCYETVTWIVIDRPLNITSMQMHSLRLLSQNQPSQIFQSMSDNFRPVQPLFHRGLRGNLDFRKPGRKC 324          
BLAST of Carbonic anhydrase-related vs. Ensembl Xenopus
Match: CA3 (carbonic anhydrase III [Source:NCBI gene;Acc:100496328])

HSP 1 Score: 124.02 bits (310), Expect = 8.734e-33
Identity = 80/260 (30.77%), Postives = 127/260 (48.85%), Query Frame = 2
Query:  194 GPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTP-ISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVT-EXXXXXXXXXXXXXXENSGRMADNFRPIQSLHNRAIRTNI 967
            GP  W          ++    KG  QSPI +    + +DP L P  S +  + S+ +  D     +    ++++++ I  GP++ +++   L   +GS    GS+H I+G  + GE+ F  +N + YDNI+ A   P G+A I+VFLKIGK +   LK +++  +    KG +        + L P+   Y TY GS   P C+E VTW++L++ + V+ E   K          E    M DNFRP Q L  R IR + 
Sbjct:   14 GPDTWA---------EYFPAAKGDQQSPIELLTRYIKHDPTLRPWTSTYHPSTSLTVVNDGTTCRVVFDDSTDKSV-IKDGPMNGTYRLRQLQFHWGSSDDHGSEHVIDGFRYAGEMHFIHWNSK-YDNITEAKKHPDGVAIIAVFLKIGK-AKPHLKLVLEALDCIKNKGKKAHFTDFDPTILFPSSRDYWTYQGSFTTPPCEECVTWLLLSEPITVSPEQMEKFRSVYSTLEGEIECHMVDNFRPPQPLKGREIRASF 261          
BLAST of Carbonic anhydrase-related vs. Ensembl Xenopus
Match: proca1 (protein interacting with cyclin A1 [Source:Xenbase;Acc:XB-GENE-1005546])

HSP 1 Score: 122.479 bits (306), Expect = 3.675e-32
Identity = 80/273 (29.30%), Postives = 135/273 (49.45%), Query Frame = 2
Query:  167 WHYKPGDIGGPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTAS-QTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSGR---MADNFRPIQSLHNRAIRTNIRL 973
            W Y  G+  GP +W H + ++         +G+ QSPI+I  ++ +++P L P+ V   +    +++ N G  +       ++   I+GGPL  S++       +G+  + GS+H ++G S+P EL    +N   Y +   A   P GL  I VFL+ G   S  L  L         KG++   +      L+P+  +Y TYPGSL  P  +E+VTWI+L + + V+E Q++  R+  L   E   +   M +NFRP Q L  R ++ + + 
Sbjct:    7 WGY--GEEDGPSEWHHYFPIA---------EGNRQSPIDIVSNQAVFNPSLNPL-VISYDHCTSINLSNNGHSVMVEFDDYDDKTVITGGPLEGSYRLKQFHFHWGTQRNSGSEHTVDGKSYPCELHLVHWNARAYSSFGEAAAAPDGLVVIGVFLETGGQHS-GLNRLTDALYMVKFKGTKTQFDDFNPKCLLPSSFEYWTYPGSLTTPPLNESVTWIVLKEPIKVSEKQMERFRKTLLFSGEEEEQRIHMVNNFRPPQPLKGRKVQASFKC 266          
BLAST of Carbonic anhydrase-related vs. Ensembl Mouse
Match: Car10 (carbonic anhydrase 10 [Source:MGI Symbol;Acc:MGI:1919855])

HSP 1 Score: 182.956 bits (463), Expect = 1.419e-54
Identity = 105/296 (35.47%), Postives = 159/296 (53.72%), Query Frame = 2
Query:  167 WHYKPGDIGG----PQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQ--TAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSG-RMADNFRPIQSLHNRAIRTNIRLHQQTKIC--DFKQDFYYEVN 1027
            W YK    G     P  WG +      + W  C+ G  QSP+NI    +++DP LTP+ +  G + +  ++ N G+ ++        + ISGGP++YS +   + + FGS  S+GS+H +NG +F GE+Q   +NHE+Y N++ A   P GL  +S+F+K+  +S+  L  ++   T  +   K     L GL +  L P    +ITY GS+  P C ET +WII+N+ + +T  Q+ SLR L  +        M+DNFRP+Q L+NR IRTNI    Q K C  +  Q   Y VN
Sbjct:   33 WAYKEVVQGSFVPVPSFWGLV-----NSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVN 323          
BLAST of Carbonic anhydrase-related vs. Ensembl Mouse
Match: Car10 (carbonic anhydrase 10 [Source:MGI Symbol;Acc:MGI:1919855])

HSP 1 Score: 182.956 bits (463), Expect = 1.419e-54
Identity = 105/296 (35.47%), Postives = 159/296 (53.72%), Query Frame = 2
Query:  167 WHYKPGDIGG----PQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQ--TAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSG-RMADNFRPIQSLHNRAIRTNIRLHQQTKIC--DFKQDFYYEVN 1027
            W YK    G     P  WG +      + W  C+ G  QSP+NI    +++DP LTP+ +  G + +  ++ N G+ ++        + ISGGP++YS +   + + FGS  S+GS+H +NG +F GE+Q   +NHE+Y N++ A   P GL  +S+F+K+  +S+  L  ++   T  +   K     L GL +  L P    +ITY GS+  P C ET +WII+N+ + +T  Q+ SLR L  +        M+DNFRP+Q L+NR IRTNI    Q K C  +  Q   Y VN
Sbjct:   33 WAYKEVVQGSFVPVPSFWGLV-----NSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVN 323          
BLAST of Carbonic anhydrase-related vs. Ensembl Mouse
Match: Car10 (carbonic anhydrase 10 [Source:MGI Symbol;Acc:MGI:1919855])

HSP 1 Score: 163.696 bits (413), Expect = 1.973e-47
Identity = 100/296 (33.78%), Postives = 148/296 (50.00%), Query Frame = 2
Query:  167 WHYKPGDIGG----PQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQ--TAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSG-RMADNFRPIQSLHNRAIRTNIRLHQQTKIC--DFKQDFYYEVN 1027
            W YK    G     P  WG +      + W  C+ G  QSP+NI    +++DP LTP+ +  G + +                         GP++YS +   + + FGS  S+GS+H +NG +F GE+Q   +NHE+Y N++ A   P GL  +S+F+K+  +S+  L  ++   T  +   K     L GL +  L P    +ITY GS+  P C ET +WII+N+ + +T  Q+ SLR L  +        M+DNFRP+Q L+NR IRTNI    Q K C  +  Q   Y VN
Sbjct:   33 WAYKEVVQGSFVPVPSFWGLV-----NSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVR------------------------GPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVN 299          
BLAST of Carbonic anhydrase-related vs. Ensembl Mouse
Match: Car11 (carbonic anhydrase 11 [Source:MGI Symbol;Acc:MGI:1336193])

HSP 1 Score: 157.918 bits (398), Expect = 5.520e-45
Identity = 101/306 (33.01%), Postives = 157/306 (51.31%), Query Frame = 2
Query:   86 ALVSMILVNSANQIWRSQEWNSKWDAKWHYKPGDIGGPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALI--QTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSGR-MADNFRPIQSLHNRAIRTNIRLHQQTKIC 994
            ALV    + +A  I  + +    W  K + +   + GP  WG +        W  C  G  QSP+++ L ++LYDP L P+ +  G + +  ++ N G+ ++    S   + +SGGPL YS +   L + FG+    GS+H+IN   F  E+Q   FN E+Y N+S A   P GLA +S+F+ +  +S+  L  L+   T  +   K    FL  L L  L P    +ITY GSL  P C ETVTWI++++ L++T  Q+ SLR L  +      + ++ N RP+Q L +RA+R N       + C
Sbjct:   12 ALVLWAALGAAAHIGPAPDPEDWWSYKENLQGNFVPGPPFWGLV-----NAAWSLCAVGKRQSPVDVELKRVLYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFLPASRPVVNVSGGPLLYSHRLSELRLLFGARDGAGSEHQINHEGFSAEVQLIHFNQELYGNLSAASRGPNGLAILSLFVNVAGSSNPFLSRLLNRDTITRISYKNDAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNGRPLQPLAHRALRGNRDPRHPERRC 312          
BLAST of Carbonic anhydrase-related vs. Ensembl Mouse
Match: Car7 (carbonic anhydrase 7 [Source:MGI Symbol;Acc:MGI:103100])

HSP 1 Score: 125.561 bits (314), Expect = 1.984e-33
Identity = 84/270 (31.11%), Postives = 126/270 (46.67%), Query Frame = 2
Query:  167 WHYKPGDIGGPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTAS-QTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSG-RMADNFRPIQSLHNRAIRTNIR 970
            W Y  G   GP  W  LY ++         +G  QSPINI   + +Y P L P+ +F     + LSI N G  +      S++   +SGGPL   ++   L   +G     GS+H ++G SFP EL    +N + Y     A   P GLA + VFL+ G      +  L         K ++   +      L+P    Y TYPGSL  P   E+VTWI+L + + ++E Q++  R L  +  ++    M DNFRP Q L  R ++ + +
Sbjct:    7 WGY--GQDDGPSNWHKLYPIA---------QGDRQSPINIISSQAVYSPSLQPLELFY-EACMSLSITNNGHSVQVDFNDSDDRTVVSGGPLEGPYRLKQLHFHWGKKRDMGSEHTVDGKSFPSELHLVHWNAKKYSTFGEAAAAPDGLAVVGVFLETGDEHP-SMNRLTDALYMVRFKDTKAQFSCFNPKCLLPTSRHYWTYPGSLTTPPLSESVTWIVLREPIRISERQMEKFRSLLFTSEDDERIHMVDNFRPPQPLKGRVVKASFQ 263          
BLAST of Carbonic anhydrase-related vs. UniProt/SwissProt
Match: sp|A0JN41|CAH10_BOVIN (Carbonic anhydrase-related protein 10 OS=Bos taurus OX=9913 GN=CA10 PE=2 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 2.940e-54
Identity = 106/296 (35.81%), Postives = 159/296 (53.72%), Query Frame = 2
Query:  167 WHYKPGDIGG----PQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQ--TAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSG-RMADNFRPIQSLHNRAIRTNIRLHQQTKIC--DFKQDFYYEVN 1027
            W YK    G     P  WG +      + W  C+ G  QSP+NI    +++DP LTP+ +  G + +  ++ N G+ ++        + ISGGP++YS +   + + FGS  S+GS+H +NG +F GE+Q   +NHE+Y N++ A   P GL  +S+F+K+  +S+  L  ++   T  +   K     L GL +  L P    +ITY GS+  P C ET  WII+N+ + +T  Q+ SLR L  +        M+DNFRP+QSL+NR IRTNI    Q K C  +  Q   Y VN
Sbjct:   33 WAYKEVVQGSFVPVPSFWGLV-----NSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETANWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQSLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVN 323          
BLAST of Carbonic anhydrase-related vs. UniProt/SwissProt
Match: sp|Q5R4U0|CAH10_PONAB (Carbonic anhydrase-related protein 10 OS=Pongo abelii OX=9601 GN=CA10 PE=2 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 9.929e-54
Identity = 105/296 (35.47%), Postives = 159/296 (53.72%), Query Frame = 2
Query:  167 WHYKPGDIGG----PQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQ--TAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSG-RMADNFRPIQSLHNRAIRTNIRLHQQTKIC--DFKQDFYYEVN 1027
            W YK    G     P  WG +      + W  C+ G  QSP+NI    +++DP LTP+ +  G + +  ++ N G+ ++        + ISGGP++YS +   + + FGS  S+GS+H +NG +F GE+Q   +NHE+Y N++ A   P GL  +S+F+K+  +S+  L  ++   T  +   K     L GL +  L P    +ITY GS+  P C ET +WII+N+ + +T  Q+ SLR L  +        M+DNFRP+Q L+NR IRTNI    Q K C  +  Q   Y VN
Sbjct:   33 WAYKEVVQGSFVPVPSFWGLV-----NSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVN 323          
BLAST of Carbonic anhydrase-related vs. UniProt/SwissProt
Match: sp|P61215|CAH10_MOUSE (Carbonic anhydrase-related protein 10 OS=Mus musculus OX=10090 GN=Ca10 PE=1 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 9.929e-54
Identity = 105/296 (35.47%), Postives = 159/296 (53.72%), Query Frame = 2
Query:  167 WHYKPGDIGG----PQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQ--TAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSG-RMADNFRPIQSLHNRAIRTNIRLHQQTKIC--DFKQDFYYEVN 1027
            W YK    G     P  WG +      + W  C+ G  QSP+NI    +++DP LTP+ +  G + +  ++ N G+ ++        + ISGGP++YS +   + + FGS  S+GS+H +NG +F GE+Q   +NHE+Y N++ A   P GL  +S+F+K+  +S+  L  ++   T  +   K     L GL +  L P    +ITY GS+  P C ET +WII+N+ + +T  Q+ SLR L  +        M+DNFRP+Q L+NR IRTNI    Q K C  +  Q   Y VN
Sbjct:   33 WAYKEVVQGSFVPVPSFWGLV-----NSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVN 323          
BLAST of Carbonic anhydrase-related vs. UniProt/SwissProt
Match: sp|Q9N085|CAH10_MACFA (Carbonic anhydrase-related protein 10 OS=Macaca fascicularis OX=9541 GN=CA10 PE=2 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 9.929e-54
Identity = 105/296 (35.47%), Postives = 159/296 (53.72%), Query Frame = 2
Query:  167 WHYKPGDIGG----PQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQ--TAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSG-RMADNFRPIQSLHNRAIRTNIRLHQQTKIC--DFKQDFYYEVN 1027
            W YK    G     P  WG +      + W  C+ G  QSP+NI    +++DP LTP+ +  G + +  ++ N G+ ++        + ISGGP++YS +   + + FGS  S+GS+H +NG +F GE+Q   +NHE+Y N++ A   P GL  +S+F+K+  +S+  L  ++   T  +   K     L GL +  L P    +ITY GS+  P C ET +WII+N+ + +T  Q+ SLR L  +        M+DNFRP+Q L+NR IRTNI    Q K C  +  Q   Y VN
Sbjct:   33 WAYKEVVQGSFVPVPSFWGLV-----NSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVN 323          
BLAST of Carbonic anhydrase-related vs. UniProt/SwissProt
Match: sp|Q9NS85|CAH10_HUMAN (Carbonic anhydrase-related protein 10 OS=Homo sapiens OX=9606 GN=CA10 PE=2 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 9.929e-54
Identity = 105/296 (35.47%), Postives = 159/296 (53.72%), Query Frame = 2
Query:  167 WHYKPGDIGG----PQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQ--TAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSG-RMADNFRPIQSLHNRAIRTNIRLHQQTKIC--DFKQDFYYEVN 1027
            W YK    G     P  WG +      + W  C+ G  QSP+NI    +++DP LTP+ +  G + +  ++ N G+ ++        + ISGGP++YS +   + + FGS  S+GS+H +NG +F GE+Q   +NHE+Y N++ A   P GL  +S+F+K+  +S+  L  ++   T  +   K     L GL +  L P    +ITY GS+  P C ET +WII+N+ + +T  Q+ SLR L  +        M+DNFRP+Q L+NR IRTNI    Q K C  +  Q   Y VN
Sbjct:   33 WAYKEVVQGSFVPVPSFWGLV-----NSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVN 323          
BLAST of Carbonic anhydrase-related vs. TrEMBL
Match: A0A3R7ESL3 (Carbonic anhydrase-related protein 10 (Fragment) OS=Clonorchis sinensis OX=79923 GN=CA10 PE=4 SV=1)

HSP 1 Score: 310.842 bits (795), Expect = 2.143e-101
Identity = 149/308 (48.38%), Postives = 213/308 (69.16%), Query Frame = 2
Query:  101 ILVNSANQIWRSQEWNSKWDAKWHYKPGDIGGPQQWGHLYLMSH-ENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQT-SNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSGRMADNFRPIQSLHNRAIRTNIRLHQQTKICDFKQDFYY 1018
            +  NS    W    WN+ WD  WHYK G IGGP  WG    M++ ++ W +C+KG  QSPI+IS   L YDP L P+ + G ++ I+L I N GQDL      ++  I ++GGPLSY ++ F  LIKFGS S  GSDH+++G+ FP E+Q Y +N+ +Y N+S A+ +P+GLAAI+VFLK+G+  S DL AL+ TAE+  ++G  + LNGL +S L+P+  QY+TY GS+PFP C ETVTW++LNQ + +TE+QLK+LR+L+++   NSGRM+DNFRP QSL+NR++RTNI+  +Q++ C  +    Y
Sbjct:    1 VFCNSLGTSWHETSWNAAWDTWWHYKEGVIGGPSHWGQTAYMTYADDVWPACHKGKLQSPISISSSNLTYDPSLQPLVIVGKDKQIDLEISNAGQDLRIDLLDASPQILLTGGPLSYEYRVFGALIKFGSKSQHGSDHQVDGVPFPAEMQLYAYNYLLYANVSMAVPRPHGLAAIAVFLKVGEHPSADLSALLATAEEVQLRGQSRRLNGLLISALLPSTKQYMTYEGSIPFPACHETVTWVVLNQAMIITETQLKALRELRIAPFANSGRMSDNFRPTQSLNNRSVRTNIQFTEQSEYCSMRPRVSY 308          
BLAST of Carbonic anhydrase-related vs. TrEMBL
Match: G7YJ22 (Carbonic anhydrase-related protein 10 (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_109216 PE=4 SV=1)

HSP 1 Score: 308.531 bits (789), Expect = 7.323e-100
Identity = 149/310 (48.06%), Postives = 214/310 (69.03%), Query Frame = 2
Query:   71 YISLLALVSMILVNSANQIWRSQEWNSKWDAKWHYKPGDIGGPQQWGHLYLMSH-ENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQT-SNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSGRMADNFRPIQSLHNRAIRTNIRLHQQTKIC 994
            ++ L+     +  NS    W    WN+ WD  WHYK G IGGP  WG    M++ ++ W +C+KG  QSPI+IS   L YDP L P+ + G ++ I+L I N GQDL      ++  I ++GGPLSY ++ F  LIKFGS S  GSDH+++G+ FP E+Q Y +N+ +Y N+S A+ +P+GLAAI+VFLK+G+  S DL AL+ TAE+  ++G  + LNGL +S L+P+  QY+TY GS+PFP C ETVTW++LNQ + +TE+QLK+LR+L+++   NSGRM+DNFRP QSL+NR++RTNI+  +Q  +C
Sbjct:    9 WVHLMIFGCGVFCNSLGTSWHETSWNAAWDTWWHYKEGVIGGPSHWGQTAYMTYADDVWPACHKGKLQSPISISSSNLTYDPSLQPLVIVGKDKQIDLEISNAGQDLRIDLLDASPQILLTGGPLSYEYRVFGALIKFGSKSQHGSDHQVDGVPFPAEMQLYAYNYLLYANVSMAVPRPHGLAAIAVFLKVGEHPSADLSALLATAEEVQLRGQSRRLNGLLISALLPSTKQYMTYEGSIPFPACHETVTWVVLNQAMIITETQLKALRELRIAPFANSGRMSDNFRPTQSLNNRSVRTNIQFTEQAFLC 318          
BLAST of Carbonic anhydrase-related vs. TrEMBL
Match: G4VIP7 (Carbonic anhydrase-related OS=Schistosoma mansoni OX=6183 GN=Smp_159710 PE=3 SV=1)

HSP 1 Score: 295.434 bits (755), Expect = 7.917e-95
Identity = 151/309 (48.87%), Postives = 204/309 (66.02%), Query Frame = 2
Query:   74 ISLLALVSMILVNSANQIWRSQEWNSKWDAKWHYKPGDIGGPQQWGHLYLMS-HENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTAS-QTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSGRMADNFRPIQSLHNRAIRTNIRLHQQTKIC 994
            +++ A++S       N +W    W+  WD  WHYK G +GGP  WG    M+   + W +C +G  QSPI+IS   LLYDP L P+ + G ++ I++ + N GQDL      S  ++  S GPL Y++KFF  LIKFGS S RGSDH+I+G++FP ELQ Y FN  +Y N S+AL+KP GLA +SV  KIG  SS DL+AL+ TAE+  +KG  K L+GL L  ++P+  QYITY GSLPFP C ET TWI+LNQ + +TE+QLKSLRQL+++    SG MADN+R IQ L+NR++RTNI   +  +I 
Sbjct:    6 LTVFAIISFTKTRRMNALWHDGSWDPSWDTWWHYKEGVMGGPSHWGQTAFMAIASDVWPACYQGKMQSPISISTKHLLYDPNLVPLKISGSDKQIDVEVVNTGQDLQVKILDSTASVVFSEGPLVYNYKFFGALIKFGSRSDRGSDHRIDGIAFPAELQLYAFNFILYQNFSNALSKPNGLAVLSVLFKIGDQSSADLEALLSTAEQVQLKGQSKRLHGLLLDAVLPSTMQYITYQGSLPFPACYETATWILLNQPIVITETQLKSLRQLRIAPFRGSGSMADNYRTIQKLNNRSVRTNIDFKKSLRIV 314          
BLAST of Carbonic anhydrase-related vs. TrEMBL
Match: A0A3Q0KMH9 (Carbonic anhydrase-related OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 289.271 bits (739), Expect = 1.141e-92
Identity = 153/323 (47.37%), Postives = 208/323 (64.40%), Query Frame = 2
Query:   74 ISLLALVSMILVNSANQIWRSQEWNSKWDAKWHYKPGDIGGPQQWGHLYLMSHENK-WMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITI-SGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSGRMADNFRPIQSLHNRAIRTNIRLHQQTKICDFKQDFYYEVNTNS 1036
            +++ A++S     S N +W+   W+S WD  WHYK G IGGP  WG   LM+  N  W +C +G  QSPINIS   L++D  L PI + G ++ I++ I N GQDL      +  I + S GPL Y ++ F  +IKFGS SSRGSDH+I+G+SFP ELQ Y FN+ +Y N S AL+KP GLA +S+F ++G  SS DL+A+   A+   +KG  K L+GL L  ++P+   Y+TY GSLPFP C ETVTWIILNQ + +TE+QLKSLRQL++S    SGRMADN+R IQ ++ R++RTNI   Q    C  +    Y V+  +
Sbjct:    6 LTVFAIISFTKTKSLNAVWQESSWDSTWDTWWHYKEGVIGGPSHWGQTALMAITNDVWSACYQGKMQSPINISTKHLVFDTNLEPIKILGLDKQIDVEIVNTGQDLQMKILDSTTIIVFSEGPLVYDYRLFGAIIKFGSKSSRGSDHQIDGISFPAELQLYAFNYILYPNFSVALSKPNGLAVLSIFCQVGNRSSADLEAIFSIADHVQLKGQFKKLHGLLLDAIIPSTVHYMTYQGSLPFPACYETVTWIILNQPVIITETQLKSLRQLRISSFWESGRMADNYRIIQKINRRSVRTNIDFEQTQPYCSMQSRRSYIVSKKT 328          
BLAST of Carbonic anhydrase-related vs. TrEMBL
Match: A0A094ZKY9 (Carbonic anhydrase-related protein 10 OS=Schistosoma haematobium OX=6185 GN=MS3_03552 PE=3 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 4.030e-92
Identity = 153/308 (49.68%), Postives = 201/308 (65.26%), Query Frame = 2
Query:  119 NQIWRSQEWNSKWDAKWHYKPGDIGGPQQWGHLYLMSHENK-WMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTAS-QTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSGRMADNFRPIQSLHNRAIRTNIRLHQQTKICDFKQDFYYEVNTNS 1036
            N +W    W+  WD  WHYK G +GGP  WG    M+  N  W +C +G  QSPI+IS   LL+DP L P+ + G ++ I++ + N GQDL      S  +I  S GPL Y++KFF  LIKFGS S RGSDH+I+G++FP ELQ Y FN  +Y N S+AL+KP GLA +SV  KIG  SS DL+AL+ TAE+  +KG  K L+GL L  ++P+  QYITY GSLPFP C ET TWI+LNQ + +TE+QLKSLRQL+++    SG MADN+R IQ L+NR++RTNI   +     ++    Y E  T S
Sbjct:    2 NALWHDGSWDPSWDTWWHYKEGVMGGPSHWGQTAFMAIANDVWPACYQGKMQSPISISTKHLLFDPNLVPLKISGSDKQIDVEVVNTGQDLQVKILDSIASIVFSEGPLVYNYKFFGALIKFGSRSDRGSDHQIDGIAFPAELQLYAFNFILYQNFSNALSKPNGLAVLSVLFKIGDQSSADLEALLSTAEQVQLKGQSKRLHGLLLDAVLPSTMQYITYQGSLPFPACYETATWILLNQPIVITETQLKSLRQLRIAPFRGSGSMADNYRTIQKLNNRSVRTNIDFRKSRLHYEYGDRLYEEKLTES 309          
BLAST of Carbonic anhydrase-related vs. Ensembl Cavefish
Match: ca10b (carbonic anhydrase Xb [Source:ZFIN;Acc:ZDB-GENE-080815-2])

HSP 1 Score: 164.466 bits (415), Expect = 9.312e-48
Identity = 93/267 (34.83%), Postives = 142/267 (53.18%), Query Frame = 2
Query:  197 PQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKAL-IQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSGRMADNFRPIQSLHNRAIRTNIRLHQQTKIC 994
            P  WG +        W  C+ G  QSP+N    +L++DP LTPI +  G + I   + N G  ++        + +SGGPLSYS++   + + FGS   +GS+H +NG +FPGE+Q   +N ++Y N S A   P G+A IS+F+K   T+   ++ L  +   +   K     L GL L  L P   ++ITY GSL  P C E+ TWI++N+ + +++         +    E    M+DN RP+Q LH R +RTNI  +QQ + C
Sbjct:   34 PSFWGLV-----NTAWNLCSVGRRQSPVNSETRRLIFDPYLTPIRLNTGGKKISGIMYNTGHHVSLRLDRAHLVNMSGGPLSYSYRLEEIRLHFGSEDGQGSEHLLNGQAFPGEVQLIHYNQDLYLNYSAAARSPNGIAVISIFMK-EPTNLFLIRMLSREIITRITYKKDAYVLEGLNLQDLFPETSRFITYDGSLTIPPCLESATWILMNKPIYISQ-IESLRLLSQNQPMEIFLSMSDNNRPVQQLHQRCLRTNIHYNQQGRNC 293          
BLAST of Carbonic anhydrase-related vs. Ensembl Cavefish
Match: ca7 (carbonic anhydrase 7 [Source:NCBI gene;Acc:103041882])

HSP 1 Score: 119.013 bits (297), Expect = 4.702e-31
Identity = 87/275 (31.64%), Postives = 135/275 (49.09%), Query Frame = 2
Query:  164 KWHYKPGDIGGPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTAS-QTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVI---KGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENS--GRMADNFRPIQSLHNRAIRTNIR 970
            +W Y  G+  GP  W   Y ++         +G  QSPINI  D+ +YD  L PIS+   N    ++I N G  +      +++   I GGPL+ +++       +G     GS+H ++G ++  EL    +N   Y +   A+    GLA + VFL+IG    D+ + L +  +   +   KG+           L+P    Y TYPGSL  P   E+VTWI+L + ++V+E Q+   R L  S  E     RM +NFRP Q L+ RA+R+N +
Sbjct:    5 QWGY--GEDDGPSAWSKDYPIA---------EGPRQSPINIVPDEAVYDANLPPISLNYDN-CTSINISNNGHSVVVEFDDADDRSVIQGGPLNNAYRLKQFHFHWGGKGCHGSEHTVSGKTYTSELHLVHWNAARYGSFGEAVAASDGLAVLGVFLEIG----DEHRGLHKITDALYMVKFKGTVADFRDFNPKCLLPRSLGYWTYPGSLTTPPLYESVTWIVLAEPIEVSEKQMGKFRTLLFSGEEEEVRKRMENNFRPPQPLNGRAVRSNFQ 263          
BLAST of Carbonic anhydrase-related vs. Ensembl Cavefish
Match: ca7 (carbonic anhydrase 7 [Source:NCBI gene;Acc:103041882])

HSP 1 Score: 115.931 bits (289), Expect = 6.048e-30
Identity = 84/265 (31.70%), Postives = 130/265 (49.06%), Query Frame = 2
Query:  194 GPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTAS-QTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVI---KGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENS--GRMADNFRPIQSLHNRAIRTNIR 970
            GP  W   Y ++         +G  QSPINI  D+ +YD  L PIS+   N    ++I N G  +      +++   I GGPL+ +++       +G     GS+H ++G ++  EL    +N   Y +   A+    GLA + VFL+IG    D+ + L +  +   +   KG+           L+P    Y TYPGSL  P   E+VTWI+L + ++V+E Q+   R L  S  E     RM +NFRP Q L+ RA+R+N +
Sbjct:   17 GPSAWSKDYPIA---------EGPRQSPINIVPDEAVYDANLPPISLNYDN-CTSINISNNGHSVVVEFDDADDRSVIQGGPLNNAYRLKQFHFHWGGKGCHGSEHTVSGKTYTSELHLVHWNAARYGSFGEAVAASDGLAVLGVFLEIG----DEHRGLHKITDALYMVKFKGTVADFRDFNPKCLLPRSLGYWTYPGSLTTPPLYESVTWIVLAEPIEVSEKQMGKFRTLLFSGEEEEVRKRMENNFRPPQPLNGRAVRSNFQ 267          
BLAST of Carbonic anhydrase-related vs. Ensembl Cavefish
Match: ca4c (carbonic anhydrase 4-like [Source:NCBI gene;Acc:103043744])

HSP 1 Score: 116.701 bits (291), Expect = 7.336e-30
Identity = 81/268 (30.22%), Postives = 131/268 (48.88%), Query Frame = 2
Query:  173 YKPGDIGGPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRL---MPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSGR-MADNFRPIQSLHNRAIRTN 964
            Y  G I GP+QW         + + +C  G  QSPINI   K+ YDP LTPI   G  + + +++ N+G    A+ +   ++ ISGG L   +K     + +GS    GS+H ++G  +P E+       E Y  +  A+N   G+AA+  F ++    +  L  +I    +    G+   + G QL  L   + N   Y  Y GSL  P CDE + W +  Q + V++ QL  + +  L    ++G+ M D FRP+ +L+ R + T+
Sbjct:   16 YYYGFISGPRQW--------VSDFPACG-GQRQSPINIITRKVQYDPSLTPIMFEGYTEVMNITVTNVG--YAAAFSLPRSVRISGGGLPGKYKALQFHLHWGSDCGPGSEHTVDGEQYPMEVHIVHIKEE-YSTLKEAMNDSVGVAALGFFFEVSPRENKQLNKIIDALGRVRYNGNSTDIRGFQLGDLLISLENFSGYYRYAGSLTTPSCDEAIIWTLFKQPIPVSQDQLNIIIRQMLF---STGKPMIDIFRPVLNLNGRTVYTS 268          
BLAST of Carbonic anhydrase-related vs. Ensembl Cavefish
Match: ca4c (carbonic anhydrase 4-like [Source:NCBI gene;Acc:103043744])

HSP 1 Score: 113.62 bits (283), Expect = 1.039e-28
Identity = 78/261 (29.89%), Postives = 128/261 (49.04%), Query Frame = 2
Query:  194 GPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRL---MPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSGR-MADNFRPIQSLHNRAIRTN 964
            GP+QW         + + +C  G  QSPINI   K+ YDP LTPI   G  + + +++ N+G    A+ +   ++ ISGG L   +K     + +GS    GS+H ++G  +P E+       E Y  +  A+N   G+AA+  F ++    +  L  +I    +    G+   + G QL  L   + N   Y  Y GSL  P CDE + W +  Q + V++ QL  + +  L    ++G+ M D FRP+ +L+ R + T+
Sbjct:   35 GPRQW--------VSDFPACG-GQRQSPINIITRKVQYDPSLTPIMFEGYTEVMNITVTNVG--YAAAFSLPRSVRISGGGLPGKYKALQFHLHWGSDCGPGSEHTVDGEQYPMEVHIVHIKEE-YSTLKEAMNDSVGVAALGFFFEVSPRENKQLNKIIDALGRVRYNGNSTDIRGFQLGDLLISLENFSGYYRYAGSLTTPSCDEAIIWTLFKQPIPVSQDQLNIIIRQMLF---STGKPMIDIFRPVLNLNGRTVYTS 280          
BLAST of Carbonic anhydrase-related vs. Ensembl Sea Lamprey
Match: ca8 (carbonic anhydrase VIII [Source:ZFIN;Acc:ZDB-GENE-050417-26])

HSP 1 Score: 105.916 bits (263), Expect = 6.204e-27
Identity = 74/245 (30.20%), Postives = 114/245 (46.53%), Query Frame = 2
Query:  260 GHNQSPINISLDKLLYDP-MLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMPN--VDQYITYPGSLPFPGCDETVTWIILN-----QHLDVTEXXXXXXXXXXXXXXENS-GRMADNFRPIQSLHNRAIRTNI 967
            G NQSPINI+  +  +DP +LT           E  + N G  L     S    T    P+   F+   +   +G    RGS+H +N  +FP E     +N  +Y NI  A+ K  G+A I++F++IG+     LK L    ++   KG  K +  L  + L+P+  +  Y  Y GSL  P C E V W++        H  + E +        ++ S+   G++ DNFRP Q L++R IR + 
Sbjct:   14 GENQSPININSREATFDPSLLTAPLCLSYLTCRECEVLNDGHSLHIHIRSKSVTTGGPFPIGQEFELSHICFHWGKEDQRGSEHTVNFKAFPMECHLIHWNATLYKNIEDAMGKENGIAIIALFVQIGREHL-GLKGLTDILQEIQYKGKAKTIPSLNPNTLLPDPLLRDYWVYEGSLTTPPCCENVLWLLFRYPLTLSHAQIEEFRRLRTHSKGVAPSDGCDGQLGDNFRPTQQLNDRVIRASF 257          
BLAST of Carbonic anhydrase-related vs. Ensembl Sea Lamprey
Match: CA2 (carbonic anhydrase 2 [Source:HGNC Symbol;Acc:HGNC:1373])

HSP 1 Score: 98.2117 bits (243), Expect = 4.663e-24
Identity = 68/263 (25.86%), Postives = 120/263 (45.63%), Query Frame = 2
Query:  188 IGGPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISV-FGGNQSIELSIDNMGQDLTAS--QTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSGRMADNFRPIQSLHNRAIRTNI 967
            I GP+ WG         K      G  QSPI+I     +Y+  L  +SV + G  +   SI N G   +     + + +  +SGGPL+  +K       +G+  ++GS+H ++G S+  EL    +N   Y +   A +K  GLA +  F+K+G  ++  L+ +         KG++        S L+P    + +Y GSL  P  +E+  WI+L   +  ++   + L   +   + +  ++  NFRP Q L  R ++ + 
Sbjct:   14 IAGPEVWG---------KHFKNADGSRQSPIDIEPASAVYEAALGALSVSYSGADA--KSISNSGHSFSVDYDDSGDSSAVLSGGPLANPYKLKQFHFHWGASDAKGSEHTVDGKSYSAELHLVHWNAAKYASFDEAKDKSDGLAVLGAFVKVGANNA-GLQKVTDALNAIADKGAKADFKNYDPSVLLPKSLDFWSYLGSLTTPPLNESAIWIVLKDPISASK---EQLAAFRSLKASDGSKLVCNFRPTQPLKGRVVQASF 261          
BLAST of Carbonic anhydrase-related vs. Ensembl Sea Lamprey
Match: ca4b (carbonic anhydrase IV b [Source:ZFIN;Acc:ZDB-GENE-080815-5])

HSP 1 Score: 85.1149 bits (209), Expect = 4.815e-19
Identity = 83/298 (27.85%), Postives = 135/298 (45.30%), Query Frame = 2
Query:  110 NSANQIWRSQEWNSKWDAKWHYKPGD-----IGGPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQS---IELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIG---KTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMP---NVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSGR--MADNFRPIQSLHNRAI 955
             SA++  ++ E+++   A W Y   D       GP+ W       ++N   +C+ G +QSPI+I    +  +  L  +   G + +   +  SI N G   T        I +SGG L  +F    +   +G+    GS+H ING  FP EL    +N + Y     A N+  GLA +     +G      +  + AL   A +   +    F     L  L+P   N+ +Y  Y GSL  PGC E VTW +  + + + E+Q+K    +  S  E+  +  M +NFRP+Q L++R +
Sbjct:    7 TSASKFIKALEYST---AHWCYDSQDSECAFCEGPRTW-------YKNS-PACS-GTSQSPIDIHTGSVKRNATLQKLKFIGYDSTPAGVTWSIQNNGH--TVQVDLQGEIAVSGGGLPGTFNAVQMHFHWGNPHGPGSEHTINGKQFPVELHIVHYNTK-YLTFDGAKNEKDGLAVLGFLYAVGPTNNNYNTIINALPSVANQVTTRTVYMF----NLDNLLPSYVNMSKYYRYSGSLTTPGCGEVVTWTVFEEPIIMDENQIKKFSSVFFSTKEDPQQILMVNNFRPVQKLNSRIV 285          
BLAST of Carbonic anhydrase-related vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006388.1 (pep scaffold:Pmarinus_7.0:GL483812:12848:14179:1 gene:ENSPMAG00000005773.1 transcript:ENSPMAT00000006388.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 3.320e-18
Identity = 33/89 (37.08%), Postives = 54/89 (60.67%), Query Frame = 2
Query:  371 NMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKI 637
            N G+ +T     +  + ISGGP+ Y  +   + + FGS   +GS+H +NG +F GE+Q   +NHE+Y N+S A   P GL  +++F+K+
Sbjct:    7 NTGRHMTLRLDKDHLVNISGGPIVYGNRLEEIRLHFGSKDGQGSEHMLNGQAFAGEVQLIHYNHELYTNVSDAARNPAGLTIVTIFMKV 95          
BLAST of Carbonic anhydrase-related vs. Ensembl Sea Lamprey
Match: ca5a (carbonic anhydrase Va [Source:ZFIN;Acc:ZDB-GENE-080220-57])

HSP 1 Score: 72.7886 bits (177), Expect = 4.092e-15
Identity = 66/243 (27.16%), Postives = 108/243 (44.44%), Query Frame = 2
Query:  260 GHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENI------TISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVT-EXXXXXXXXXXXXXXENSGRMADNFRPIQSLHNRAIRTNI 967
            G  QSPI+I   + ++D  L P+     ++S  + + N G    A    N +       T +G  +  S +         SL     +   N MS+          HE  ++ + AL    GLA + VF+++G+T +  L+ L++       KG    +     S L+P    + TYPGSL  P   ETVTW IL + + ++ E      R    +  E + RM DNFR  Q + +R++R++ 
Sbjct:   12 GRRQSPIDIQPAEGMFDSGLGPLHTHY-HRSGPMLLYNNGYSFLAEYPDNCSANGTWVGTRAGTTVIISIRLHH------SLDYITKNEHTNSMSYLCPQLHLVHWHESCESFNEALVSKKGLAVLGVFVEVGETHAR-LQELVEALPNITHKGMMHEVGTFDPSGLLPPCLDFWTYPGSLTTPPPYETVTWFILKRSMSISGEQLASFRRLYVSAAGERAVRMVDNFRMPQPIMDRSVRSSF 246          
BLAST of Carbonic anhydrase-related vs. Ensembl Nematostella
Match: EDO35860 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKA8])

HSP 1 Score: 109.768 bits (273), Expect = 3.015e-28
Identity = 73/262 (27.86%), Postives = 125/262 (47.71%), Query Frame = 2
Query:  194 GPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQ---SIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSGRMADNFRPIQSLHNRAIRTNIR 970
            GP +W         + +  CN G +QSPI+I    + +D  L  +     +      ++S+ N G     +  S    T+SGG L  ++      + +GS + +GS+H I+G +F G +    +N + Y NIS A++K  GLA + + LK+G  S+   K +        +  S +F    +L  L+P+   +  Y GSL  PGC E+VTW ++   + V+E   +      L   +    + DNFR    L+ RA+++N +
Sbjct:    1 GPSKW--------SSSFSQCN-GSSQSPIDIITSSVAFDQSLGELQFVNFDTIPTGSKISLKNNGHAFQVNMLSAGTFTVSGGGLGATYSTVQFHLHWGSKNEQGSEHLIDGKAFAGAIHIVSYNTK-YPNISAAVDKSDGLAVVGILLKVGTESAALKKFMENIGSVTKVNTSDEFAQPAKLGDLLPSNKNFYRYQGSLTTPGCQESVTWSVMANPITVSE--AQLAILRGLKQKDGVAVIQDNFRNTMPLNGRAVKSNFK 250          
BLAST of Carbonic anhydrase-related vs. Ensembl Nematostella
Match: EDO46081 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR00])

HSP 1 Score: 109.768 bits (273), Expect = 5.411e-28
Identity = 80/270 (29.63%), Postives = 130/270 (48.15%), Query Frame = 2
Query:  167 WHYKPGDIGGPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMP-NVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENS--GRMADNFRPIQSLHNRAIRTNI 967
            W Y   +  GP  W         N +  C  G  QSPINI+ ++  YD  LT + +   N +  L +++ G  + A   S+E    +G  LS  ++        GS   +GS+H I+G+ +P E+    +N + Y N S A     GLA ISV  +   T +  L  +I   +    K  +  +  + + +++P + +++  Y GSL  P C ETV WI+L +   ++E QL+  R +  +  + +    + DNFRP QSL+ R IR N 
Sbjct:    4 WSYD--EATGPSTW--------PNHFPHCG-GKMQSPININTEEAKYDGSLTDLDIKYPNTTDVLLVNHHGHAIEADILSSEPFVATGADLSSRYRLAQFHFHVGSSDIQGSEHHIHGVKYPLEMHLVHYNDK-YPNASSAQGLLDGLAVISVLFESSSTDNPALNEIIDNLQNASYKDEEITVQNVPVGKIIPTDTEKFYRYNGSLTTPPCFETVKWIVLKKTASISEKQLRQFRSVFSTSRQATKPNSLVDNFRPTQSLNGRIIRKNF 261          
BLAST of Carbonic anhydrase-related vs. Ensembl Nematostella
Match: EDO45955 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRH8])

HSP 1 Score: 86.6557 bits (213), Expect = 8.936e-20
Identity = 69/263 (26.24%), Postives = 114/263 (43.35%), Query Frame = 2
Query:  194 GPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQ---SIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSG--RMADNFRPI-QSLHNRAIRTN 964
            GP  W         N++ +CN G +QSPINI    ++YD  L  +     ++     ++ + N G     +  +     + GG L  +F      +  G   +RG++H I+G      +    +N + Y +IS A NK  GLA I V L++G  ++   K L        +           L  L+P+   +  Y GSL  P C E+VTW ++     ++            SI E  G  ++ DN+R I Q L+ R +++N
Sbjct:    1 GPDHWA--------NRYPACN-GSSQSPINIVTSSVMYDSSLGKLQFNNFDRIPSGAKIMVRNNGHAFQVNFMTPNLFYVHGGGLGANFTTAQFHMHLGEDDTRGAEHLIDGQRNAACIHIVNYNTK-YPDISTAANKSDGLAVIGVILEVGAENAGLAKVLKYVENVTKVGNVSDLAQEFSLGSLLPSNTDFFRYKGSLTTPPCYESVTWTVMKTKTTISH----DQLMKLRSIMEKDGVHKITDNYRHILQPLNGRTVKSN 249          
BLAST of Carbonic anhydrase-related vs. Ensembl Nematostella
Match: EDO40438 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S762])

HSP 1 Score: 82.0333 bits (201), Expect = 4.839e-18
Identity = 76/270 (28.15%), Postives = 127/270 (47.04%), Query Frame = 2
Query:  194 GPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELS-IDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKF---GSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKA---LIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSGRMADNFRPIQSLHNRAIRTNIRLHQQ 982
            GP +W   Y+            GH QSPI+I    +  D  L   S++   + +  S + N G+ L  +  +N N+ +SGGPL+  ++    +IKF    +  S GS+H I+      E+Q   +N   Y NI  A+    G+  ++VF ++G  +++ L     L+   E  V+K +      +      P   +Y TY GSL  P   E VTW+I    L ++E Q+   R ++ S  +    MA N RP+  ++ R IR++  L+ +
Sbjct:    1 GPLRWHKCYI--------GAEPGH-QSPIDIVTKDVTQDSSLG--SLWNTYEPVANSTLTNDGRTLQLTFANNNNV-LSGGPLTDEYQL--AMIKFHWAATEESAGSEHMIDSQGHAIEVQLVHWNKTKYRNIGEAITGEQGICILAVFFQVGNEANEGLDVIVDLLSKDEHKVVKAA------IDPKIFFPAESEYWTYEGSLTTPPLTENVTWVICQSSLILSEDQMNVFRNIRNSHGD---IMAKNSRPVCPINGRTIRSSDTLNNK 247          
BLAST of Carbonic anhydrase-related vs. Ensembl Nematostella
Match: EDO42126 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2D8])

HSP 1 Score: 80.8777 bits (198), Expect = 8.060e-18
Identity = 63/241 (26.14%), Postives = 113/241 (46.89%), Query Frame = 2
Query:  260 GHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENIT---ISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHAL--NKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSGRMADNFRPIQSLHNRAIRTNI 967
            G  QSPI+I  ++  +D  + P+ V   +   +  + N G  ++ S  S+ ++    I+ GPLS+ +KF      +G     GS+H+++G  +P E+    +N ++Y + + A+  +   GL  + VFL++ +       A +     C I         L  S ++    +  TYPGSL  P   E V WI+L   ++++  QLK    L+ +  E    +  N+RP   LH R ++   
Sbjct:   15 GKRQSPIDIVSNETKFDSTIPPVKVHY-DPFTKGKLTNTGHSVSFSGESDASVPTPDITSGPLSHKYKFAQFHFHWGKDEKEGSEHRVDGKMYPSEMHIVHYNSDLYKDAASAMSSDNKDGLCVLGVFLEVKE------DAFLLNICTCTIH--------LFFSCVL----ECWTYPGSLTTPPLSEIVNWIVLKNTIEISHHQLKLFHGLQNAKGEC---ITHNYRPPCPLHGRVVKATF 233          
BLAST of Carbonic anhydrase-related vs. Ensembl Medaka
Match: ca10a (carbonic anhydrase 10 [Source:NCBI gene;Acc:101170880])

HSP 1 Score: 178.333 bits (451), Expect = 6.511e-53
Identity = 104/296 (35.14%), Postives = 158/296 (53.38%), Query Frame = 2
Query:  167 WHYKPGDIGG----PQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQ--TAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSG-RMADNFRPIQSLHNRAIRTNIRLHQQTKIC--DFKQDFYYEVN 1027
            W YK    G     P  WG +      + W  C+ G  QSP++I    +++DP LTPI +  G + +  ++ N G+ ++        + ISGGP++YS +   + + FGS  S+GS+H +NG +F GE+Q   +NHE+Y N + A   P GL  +S+F+KI +TS+  L  ++   T  +   K     L GL +  + P    +I+Y GS+  P C ET TWI++N+ + +T  Q+ SLR L  +        M+DN RP+Q L+NR IRTNI    Q K C  +  Q   Y VN
Sbjct:   33 WAYKEVVQGSFVPVPSFWGLV-----NSAWNLCSVGKRQSPVDIETSHMIFDPFLTPIKLNTGGRKVGGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYANYTEAAKSPNGLVIVSIFMKIAETSNSFLNRMLNRDTITRITYKNDAYLLTGLNIEEIYPETSSFISYDGSMTIPPCSETATWILMNKPVYLTRMQMHSLRLLSQNQPSQIFLSMSDNVRPVQPLNNRCIRTNINFSMQGKDCPNNRAQKLQYRVN 323          
BLAST of Carbonic anhydrase-related vs. Ensembl Medaka
Match: cahz (carbonic anhydrase [Source:NCBI gene;Acc:101161087])

HSP 1 Score: 125.946 bits (315), Expect = 1.167e-33
Identity = 83/269 (30.86%), Postives = 130/269 (48.33%), Query Frame = 2
Query:  167 WHYKPGDIGGPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXX-XXXXXXXXXENSGRMADNFRPIQSLHNRAIRTNIR 970
            W Y P D  GP+ W   + ++          G  QSPINI   +  +DP L P+ +    +  +  ++N            ++ T++GGP+S +++       +G+   RGS+H ING++FP EL    +N + Y +   A +KP GLA + VFLKIG  ++  L+ ++   +    KG Q          L+P    Y TY GSL  P   E+VTWI+L + + V+ +Q+      L     E    M DNFRP Q L  R +R + +
Sbjct:    5 WGYGPSD--GPETWAENFPLA---------SGPRQSPINIVPKEAQFDPSLKPLKIRYDARDAKGILNNGHSFQVDFVDDTDSSTLTGGPISGTYRLKQFHFHWGASDERGSEHTINGITFPCELHLVHWNTK-YASFGEAADKPDGLAVVGVFLKIG-AANPKLQKVLDALDAIKTKGKQNVFANFDPKTLLPGSLDYWTYDGSLTTPPLLESVTWIVLKEQISVSPAQMAKFRSLLFTGDGEPLCNMVDNFRPPQLLKGRRVRASFK 260          
BLAST of Carbonic anhydrase-related vs. Ensembl Medaka
Match: ENSORLT00000031470.1 (carbonic anhydrase 1 [Source:NCBI gene;Acc:101168081])

HSP 1 Score: 115.546 bits (288), Expect = 8.360e-30
Identity = 83/270 (30.74%), Postives = 127/270 (47.04%), Query Frame = 2
Query:  167 WHYKPGDIGGPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSN-ENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXX-XXXXXXXXXENSGRMADNFRPIQSLHNRAIRTNIR 970
            W Y P +  GP +WG  + ++          G  QSPI+I      YD  L P+     + S  L I N G  +  +   + +  T++ GP+S  ++       +G    RGS+H +NG  +  EL    +N + Y N   A +KP GLA + VFLK+G  ++ +L+ L+        KGSQ    G   + L+P    Y TY GSL  P   E+VTWI+  + + V+  Q+      L  +  E    M DN+RP Q L  R +R + +
Sbjct:    5 WGYAPTN--GPDKWGKNFPIA---------DGVRQSPIDIVPAAASYDGGLKPL-CLKYDPSTCLEILNNGHSIQVTFIDDSDKSTLTNGPISGVYRLKQFHFHWGGADDRGSEHTVNGTKYAAELHLVHWNTK-YANFGEAASKPDGLAVVGVFLKVGD-ANPNLQKLLDAFNGIKTKGSQTSFAGFDPATLLPGCLDYWTYDGSLTTPPLLESVTWIVCKEPISVSPGQMAKFRSLLFSAQGEAECCMVDNYRPPQPLKGRRVRASFK 260          
BLAST of Carbonic anhydrase-related vs. Ensembl Medaka
Match: ca5a (carbonic anhydrase 5A [Source:NCBI gene;Acc:101173143])

HSP 1 Score: 109.383 bits (272), Expect = 4.357e-27
Identity = 77/239 (32.22%), Postives = 117/239 (48.95%), Query Frame = 2
Query:  260 GHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMP-NVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSGR--MADNFRPIQSLHNRAIRTNI 967
            G  QSPI+I + K ++D  L P+       + +   +N    L     + +  T+ GGPL   F+       +G  ++ GS+H ++   FP EL    +N + Y     A+ +  GLA I VFLK+GK   + L+ L+        K S    N    + L+P N D Y TY GSL  P   E+VTWII+ QH++V+  QL   R L  + +E   +  M +NFR  Q L  R +R++ 
Sbjct:   61 GDRQSPIDIVVRKSIFDGELKPLVTSYDPHTCQQIWNNGYSFLVEYDDTTDKSTLKGGPLKDKFRLCQFHFHWGETNAWGSEHTLDRKLFPAELHLVHWNSDKYSLFEEAVMEDNGLAVIGVFLKVGK-RHEGLQKLVDALPAIRHKDSVVEFNRFDPACLLPTNTDNYWTYHGSLTTPPLTESVTWIIMRQHIEVSHDQLAVFRSLLFTSAEEEVQRSMVNNFRVQQPLRGRTVRSSF 298          
BLAST of Carbonic anhydrase-related vs. Ensembl Medaka
Match: ca7 (carbonic anhydrase 7 [Source:NCBI gene;Acc:101170576])

HSP 1 Score: 105.145 bits (261), Expect = 6.037e-26
Identity = 85/272 (31.25%), Postives = 122/272 (44.85%), Query Frame = 2
Query:  167 WHYKPGDIGGPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTAS-QTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVI---KGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENS--GRMADNFRPIQSLHNRAIRTN 964
            W Y  GD  GP  W       H+N      +G  QSPI+I   + L D  L PI V   +    ++I N G  +      S++   I GGPL   ++       +G     GS+H ++G  +  EL    +N   Y +   A   P GLA + +FL+ G    DD + L    +   +   KGS     G     L+P+   Y TY GSL  P   E+V WI+L + + V+E QL   R L  +  E     RM +NFRP Q L  R +R++
Sbjct:    6 WGYGEGD--GPSAW-------HKN--YPVAQGSRQSPIDIIPHQALQDRSLGPI-VLNYDHCTSINISNNGHSVVVEFDDSDDRSVIQGGPLDNPYRLKQFHFHWGGKGCEGSEHTVDGYGYASELHLVHWNAVKYCSFGEASTAPDGLAVLGIFLETG----DDHRWLHMITDALYMVKFKGSGTEFKGFNPKCLLPSSLHYWTYLGSLTTPPLHESVIWIVLKEPIAVSEKQLGKFRLLLFTGEEEDQRTRMENNFRPPQPLKGRKVRSS 261          
BLAST of Carbonic anhydrase-related vs. Planmine SMEST
Match: SMESG000056463.1 (SMESG000056463.1)

HSP 1 Score: 647.121 bits (1668), Expect = 0.000e+0
Identity = 327/327 (100.00%), Postives = 327/327 (100.00%), Query Frame = 2
Query:   59 MENNYISLLALVSMILVNSANQIWRSQEWNSKWDAKWHYKPGDIGGPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSGRMADNFRPIQSLHNRAIRTNIRLHQQTKICDFKQDFYYEVNTNSP 1039
            MENNYISLLALVSMILVNSANQIWRSQEWNSKWDAKWHYKPGDIGGPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTESQLKSLRQLKLSISENSGRMADNFRPIQSLHNRAIRTNIRLHQQTKICDFKQDFYYEVNTNSP
Sbjct:    1 MENNYISLLALVSMILVNSANQIWRSQEWNSKWDAKWHYKPGDIGGPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTESQLKSLRQLKLSISENSGRMADNFRPIQSLHNRAIRTNIRLHQQTKICDFKQDFYYEVNTNSP 327          
BLAST of Carbonic anhydrase-related vs. Planmine SMEST
Match: SMESG000056463.1 (SMESG000056463.1)

HSP 1 Score: 622.083 bits (1603), Expect = 0.000e+0
Identity = 314/314 (100.00%), Postives = 314/314 (100.00%), Query Frame = 2
Query:   98 MILVNSANQIWRSQEWNSKWDAKWHYKPGDIGGPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSGRMADNFRPIQSLHNRAIRTNIRLHQQTKICDFKQDFYYEVNTNSP 1039
            MILVNSANQIWRSQEWNSKWDAKWHYKPGDIGGPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTESQLKSLRQLKLSISENSGRMADNFRPIQSLHNRAIRTNIRLHQQTKICDFKQDFYYEVNTNSP
Sbjct:    1 MILVNSANQIWRSQEWNSKWDAKWHYKPGDIGGPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTESQLKSLRQLKLSISENSGRMADNFRPIQSLHNRAIRTNIRLHQQTKICDFKQDFYYEVNTNSP 314          
BLAST of Carbonic anhydrase-related vs. Planmine SMEST
Match: SMESG000054330.1 (SMESG000054330.1)

HSP 1 Score: 262.692 bits (670), Expect = 5.952e-86
Identity = 133/315 (42.22%), Postives = 208/315 (66.03%), Query Frame = 2
Query:   89 LVSMILVNSANQIWRSQEWNSKWDAKWHYKPGDIGGPQQWGHLYLMSHENK-WMSCNKGHNQSPINISLDKLLYDPMLTPISVF-GGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSGRMADNFRPIQSLHNRAIRTNIRLHQQTKICDFKQDFYYEVN 1027
            ++  +  +  +  W SQ  + KW++ WHYK  ++GGP+ WG    M    K W  C+ G  QSP++I+ D+L+YD  LTP+ +F   N+++EL   N G+D+  +     ++TI GGPLSY ++ + +L+KFG  SSRGSDH IN  ++PGE+Q YG+N  +Y N S A++K YG+A++  F KI   S+ D  ALI  +E  + K +   + G+++  L+P+  ++ITY GS+P P C E+V WIILN+ + VTE+Q+K+LR+L+ S ++ SG +ADNFRP Q+L+ RA+RTNI+L    ++C  ++DF+Y VN
Sbjct:    1 MIIYVFFSIVSVTWASQ-LSKKWESWWHYKLKEVGGPEHWGQSTSMPEYWKHWAWCSLGRMQSPVSIATDQLIYDKQLTPLEIFEDSNENLELQALNTGKDIQFN-VEKGSVTIKGGPLSYEYEVYRILLKFGKKSSRGSDHMINNFTYPGEIQIYGYNRVLYSNYSEAISKTYGIASLVCFFKIDTKSNTDFAALIAASENVIYKDNIDTVKGIKIDMLLPSTKEFITYEGSIPHPPCYESVLWIILNEPISVTETQMKTLRKLRASKNDWSGIIADNFRPPQNLNRRALRTNIQLTLTERVCRIERDFFYSVN 313          
BLAST of Carbonic anhydrase-related vs. Planmine SMEST
Match: SMESG000078341.1 (SMESG000078341.1)

HSP 1 Score: 107.457 bits (267), Expect = 6.594e-27
Identity = 83/280 (29.64%), Postives = 142/280 (50.71%), Query Frame = 2
Query:  161 AKWHYKPGDIGGPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISV---FGGNQSIELSIDNMGQDLTASQTSNENITISGGP--LSYSFKFFSLLIKFGSL-SSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAE--KCVIKGSQKFLNG-LQLSRLMP-NVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSGRMADNFRPIQSLHNRAIRTNIR 970
            ++W Y  G + GP+ W   Y  +         KG +QSPINI ++K  ++  L    +      + S E  +++ G      +TS +++T++  P   +  FK       +GS+ +  GS+H+ING S+P EL    +N   Y N + A NKP GL  + VF++I   +  + +  IQ  E  +  +K + K  N  + L  L+P N D+Y TY GSL  P C E+VTWI+    + ++    + + + +   SE+    A NFRP+  +++R ++ + R
Sbjct:    2 SQWGY--GKLNGPETWKMSYPAA---------KGDSQSPINIIVNKTEFESELFQKKLNIKINSDYSAEQILNHTGHSFKV-ETSVDSMTVTNAPGFNNDVFKLVQFHFHWGSIGNDNGSEHQINGKSWPSELHLVHYNSTKYSNFTEAANKPDGLLVLGVFIQIAGKNL-EFQNFIQCLETIQADLKVNLKDKNSKINLKYLLPINTDRYFTYSGSLTTPPCYESVTWIVFEYPITMSR---EQIERFRKVHSEDGCETAANFRPVCPINDRKVKRSFR 265          
BLAST of Carbonic anhydrase-related vs. Planmine SMEST
Match: SMESG000078341.1 (SMESG000078341.1)

HSP 1 Score: 105.145 bits (261), Expect = 3.679e-26
Identity = 82/275 (29.82%), Postives = 138/275 (50.18%), Query Frame = 2
Query:  161 AKWHYKPGDIGGPQQWGHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIELSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSL-SSRGSDHKINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDDLKALIQTAE--KCVIKGSQKFLNG-LQLSRLMP-NVDQYITYPGSLPFPGCDETVTWIILNQHLDVTEXXXXXXXXXXXXXXENSGRMADNFRPIQSLHNRAIRTNIR 970
            ++W Y  G + GP+ W   Y  +         KG +QSPINI ++K  ++     ++  G +  +E S+D+M             +T + G  +  FK       +GS+ +  GS+H+ING S+P EL    +N   Y N + A NKP GL  + VF++I   +  + +  IQ  E  +  +K + K  N  + L  L+P N D+Y TY GSL  P C E+VTWI+    + ++    + + + +   SE+    A NFRP+  +++R ++ + R
Sbjct:    2 SQWGY--GKLNGPETWKMSYPAA---------KGDSQSPINIIVNKTEFETEQI-LNHTGHSFKVETSVDSM------------TVTNAPGFNNDVFKLVQFHFHWGSIGNDNGSEHQINGKSWPSELHLVHYNSTKYSNFTEAANKPDGLLVLGVFIQIAGKNL-EFQNFIQCLETIQADLKVNLKDKNSKINLKYLLPINTDRYFTYSGSLTTPPCYESVTWIVFEYPITMSR---EQIERFRKVHSEDGCETAANFRPVCPINDRKVKRSFR 248          
The following BLAST results are available for this feature:
BLAST of Carbonic anhydrase-related vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CA102.068e-5435.47carbonic anhydrase 10 [Source:HGNC Symbol;Acc:HGNC... [more]
CA102.068e-5435.47carbonic anhydrase 10 [Source:HGNC Symbol;Acc:HGNC... [more]
CA102.068e-5435.47carbonic anhydrase 10 [Source:HGNC Symbol;Acc:HGNC... [more]
CA106.155e-4836.29carbonic anhydrase 10 [Source:HGNC Symbol;Acc:HGNC... [more]
CA111.104e-4433.01carbonic anhydrase 11 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Carbonic anhydrase-related vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cah-23.799e-5036.24Putative carbonic anhydrase-like protein 2 [Sourc... [more]
cah-15.490e-4132.85Putative carbonic anhydrase-like protein 1 [Sourc... [more]
cah-17.026e-2935.45Putative carbonic anhydrase-like protein 1 [Sourc... [more]
cah-37.417e-1726.87Putative carbonic anhydrase 3 [Source:UniProtKB/S... [more]
cah-55.933e-1524.90Putative carbonic anhydrase 5 [Source:UniProtKB/S... [more]
back to top
BLAST of Carbonic anhydrase-related vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CARPA1.130e-6336.06gene:FBgn0029962 transcript:FBtr0343348[more]
CARPA1.130e-6336.06gene:FBgn0029962 transcript:FBtr0300019[more]
CARPB2.314e-5236.65gene:FBgn0052698 transcript:FBtr0346170[more]
CARPB2.314e-5236.65gene:FBgn0052698 transcript:FBtr0336923[more]
CARPB2.314e-5236.65gene:FBgn0052698 transcript:FBtr0307489[more]
back to top
BLAST of Carbonic anhydrase-related vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ca10a3.908e-5335.14carbonic anhydrase Xa [Source:ZFIN;Acc:ZDB-GENE-05... [more]
ca10a3.908e-5335.14carbonic anhydrase Xa [Source:ZFIN;Acc:ZDB-GENE-05... [more]
ca10b1.346e-5234.75carbonic anhydrase Xb [Source:ZFIN;Acc:ZDB-GENE-08... [more]
ca10a1.022e-4137.05carbonic anhydrase Xa [Source:ZFIN;Acc:ZDB-GENE-05... [more]
ca74.033e-3432.60carbonic anhydrase VII [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of Carbonic anhydrase-related vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CA102.227e-5336.15carbonic anhydrase 10 [Source:HGNC Symbol;Acc:HGNC... [more]
CA114.902e-4630.10carbonic anhydrase XI [Source:NCBI gene;Acc:100493... [more]
CA118.996e-4529.64carbonic anhydrase XI [Source:NCBI gene;Acc:100493... [more]
CA38.734e-3330.77carbonic anhydrase III [Source:NCBI gene;Acc:10049... [more]
proca13.675e-3229.30protein interacting with cyclin A1 [Source:Xenbase... [more]
back to top
BLAST of Carbonic anhydrase-related vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Car101.419e-5435.47carbonic anhydrase 10 [Source:MGI Symbol;Acc:MGI:1... [more]
Car101.419e-5435.47carbonic anhydrase 10 [Source:MGI Symbol;Acc:MGI:1... [more]
Car101.973e-4733.78carbonic anhydrase 10 [Source:MGI Symbol;Acc:MGI:1... [more]
Car115.520e-4533.01carbonic anhydrase 11 [Source:MGI Symbol;Acc:MGI:1... [more]
Car71.984e-3331.11carbonic anhydrase 7 [Source:MGI Symbol;Acc:MGI:10... [more]
back to top
BLAST of Carbonic anhydrase-related vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A0JN41|CAH10_BOVIN2.940e-5435.81Carbonic anhydrase-related protein 10 OS=Bos tauru... [more]
sp|Q5R4U0|CAH10_PONAB9.929e-5435.47Carbonic anhydrase-related protein 10 OS=Pongo abe... [more]
sp|P61215|CAH10_MOUSE9.929e-5435.47Carbonic anhydrase-related protein 10 OS=Mus muscu... [more]
sp|Q9N085|CAH10_MACFA9.929e-5435.47Carbonic anhydrase-related protein 10 OS=Macaca fa... [more]
sp|Q9NS85|CAH10_HUMAN9.929e-5435.47Carbonic anhydrase-related protein 10 OS=Homo sapi... [more]
back to top
BLAST of Carbonic anhydrase-related vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3R7ESL32.143e-10148.38Carbonic anhydrase-related protein 10 (Fragment) O... [more]
G7YJ227.323e-10048.06Carbonic anhydrase-related protein 10 (Fragment) O... [more]
G4VIP77.917e-9548.87Carbonic anhydrase-related OS=Schistosoma mansoni ... [more]
A0A3Q0KMH91.141e-9247.37Carbonic anhydrase-related OS=Schistosoma mansoni ... [more]
A0A094ZKY94.030e-9249.68Carbonic anhydrase-related protein 10 OS=Schistoso... [more]
back to top
BLAST of Carbonic anhydrase-related vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ca10b9.312e-4834.83carbonic anhydrase Xb [Source:ZFIN;Acc:ZDB-GENE-08... [more]
ca74.702e-3131.64carbonic anhydrase 7 [Source:NCBI gene;Acc:1030418... [more]
ca76.048e-3031.70carbonic anhydrase 7 [Source:NCBI gene;Acc:1030418... [more]
ca4c7.336e-3030.22carbonic anhydrase 4-like [Source:NCBI gene;Acc:10... [more]
ca4c1.039e-2829.89carbonic anhydrase 4-like [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Carbonic anhydrase-related vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ca86.204e-2730.20carbonic anhydrase VIII [Source:ZFIN;Acc:ZDB-GENE-... [more]
CA24.663e-2425.86carbonic anhydrase 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
ca4b4.815e-1927.85carbonic anhydrase IV b [Source:ZFIN;Acc:ZDB-GENE-... [more]
ENSPMAT00000006388.13.320e-1837.08pep scaffold:Pmarinus_7.0:GL483812:12848:14179:1 g... [more]
ca5a4.092e-1527.16carbonic anhydrase Va [Source:ZFIN;Acc:ZDB-GENE-08... [more]
back to top
BLAST of Carbonic anhydrase-related vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Carbonic anhydrase-related vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO358603.015e-2827.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460815.411e-2829.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459558.936e-2026.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404384.839e-1828.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421268.060e-1826.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Carbonic anhydrase-related vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ca10a6.511e-5335.14carbonic anhydrase 10 [Source:NCBI gene;Acc:101170... [more]
cahz1.167e-3330.86carbonic anhydrase [Source:NCBI gene;Acc:101161087... [more]
ENSORLT00000031470.18.360e-3030.74carbonic anhydrase 1 [Source:NCBI gene;Acc:1011680... [more]
ca5a4.357e-2732.22carbonic anhydrase 5A [Source:NCBI gene;Acc:101173... [more]
ca76.037e-2631.25carbonic anhydrase 7 [Source:NCBI gene;Acc:1011705... [more]
back to top
BLAST of Carbonic anhydrase-related vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056463.10.000e+0100.00SMESG000056463.1[more]
SMESG000056463.10.000e+0100.00SMESG000056463.1[more]
SMESG000054330.15.952e-8642.22SMESG000054330.1[more]
SMESG000078341.16.594e-2729.64SMESG000078341.1[more]
SMESG000078341.13.679e-2629.82SMESG000078341.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014102 ID=SMED30014102|Name=Carbonic anhydrase-related|organism=Schmidtea mediterranea sexual|type=transcript|length=1053bp
CAATCATTAAGAATTAATTTCATCCAAAAAAGATAATTTTCTTCATGAGT
TAATCCAAATGGAAAATAATTATATTTCACTGCTAGCCTTGGTAAGCATG
ATTTTGGTCAATTCAGCAAATCAAATTTGGCGATCACAAGAATGGAATTC
CAAATGGGACGCGAAATGGCATTATAAGCCTGGCGACATAGGAGGACCGC
AACAATGGGGACATCTATATCTGATGTCCCATGAAAACAAATGGATGTCA
TGCAATAAAGGTCACAATCAGAGCCCAATAAATATATCTTTGGACAAGCT
ATTATACGATCCGATGTTGACTCCGATTTCGGTTTTTGGTGGAAATCAAT
CAATTGAGCTTTCAATAGACAATATGGGCCAAGATTTAACGGCTTCCCAA
ACTTCTAACGAAAATATAACTATATCAGGCGGACCATTATCGTATTCTTT
CAAATTTTTCAGTTTATTAATAAAATTTGGTTCATTATCAAGTCGAGGAT
CTGATCATAAAATAAACGGAATGAGCTTTCCTGGAGAGCTCCAGTTTTAT
GGATTTAACCATGAAATATACGACAATATATCCCACGCCCTCAACAAACC
GTACGGTTTGGCTGCTATATCAGTGTTTCTTAAGATCGGCAAAACCTCTT
CTGACGACTTAAAAGCTCTTATACAGACTGCTGAAAAATGTGTGATAAAA
GGAAGTCAGAAATTTCTAAATGGATTGCAGTTAAGTCGACTGATGCCGAA
TGTCGATCAGTATATCACTTACCCCGGTTCTTTGCCATTTCCAGGTTGTG
ATGAAACTGTCACATGGATCATATTAAATCAGCATCTCGACGTGACGGAG
TCACAACTCAAATCGTTGCGCCAGCTGAAATTGTCTATAAGTGAAAATTC
AGGCAGAATGGCAGACAACTTTAGACCAATTCAGTCATTACATAATCGTG
CTATTAGAACTAATATCAGATTGCATCAACAGACGAAAATTTGTGACTTC
AAACAGGACTTCTATTACGAAGTCAATACAAATTCTCCATAATGGTAAAC
CAG
back to top

protein sequence of SMED30014102-orf-1

>SMED30014102-orf-1 ID=SMED30014102-orf-1|Name=SMED30014102-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=328bp
MENNYISLLALVSMILVNSANQIWRSQEWNSKWDAKWHYKPGDIGGPQQW
GHLYLMSHENKWMSCNKGHNQSPINISLDKLLYDPMLTPISVFGGNQSIE
LSIDNMGQDLTASQTSNENITISGGPLSYSFKFFSLLIKFGSLSSRGSDH
KINGMSFPGELQFYGFNHEIYDNISHALNKPYGLAAISVFLKIGKTSSDD
LKALIQTAEKCVIKGSQKFLNGLQLSRLMPNVDQYITYPGSLPFPGCDET
VTWIILNQHLDVTESQLKSLRQLKLSISENSGRMADNFRPIQSLHNRAIR
TNIRLHQQTKICDFKQDFYYEVNTNSP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004089carbonate dehydratase activity
GO:0008270zinc ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR036398CA_dom_sf
IPR018347CAH2
IPR023561Carbonic_anhydrase_a-class
IPR001148CA_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001148Alpha carbonic anhydrase domainSMARTSM01057Carb_anhydrase_2acoord: 39..303
e-value: 1.3E-64
score: 230.6
IPR001148Alpha carbonic anhydrase domainPFAMPF00194Carb_anhydrasecoord: 37..302
e-value: 4.0E-61
score: 206.8
IPR001148Alpha carbonic anhydrase domainPROSITEPS51144ALPHA_CA_2coord: 35..303
score: 49.898
IPR036398Alpha carbonic anhydrase domain superfamilyGENE3DG3DSA:3.10.200.10coord: 27..305
e-value: 2.0E-65
score: 222.9
IPR036398Alpha carbonic anhydrase domain superfamilySUPERFAMILYSSF51069Carbonic anhydrasecoord: 37..301
IPR018347Putative carbonic anhydrase-like protein 2PANTHERPTHR18952:SF138CARBONIC ANHYDRASE XA-RELATEDcoord: 33..310
IPR023561Carbonic anhydrase, alpha-classPANTHERPTHR18952CARBONIC ANHYDRASEcoord: 33..310
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.622