Kinesin-like protein

Overview
NameKinesin-like protein
Smed IDSMED30014094
Length (bp)4131
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kinesin-like protein (SMED30014094) t-SNE clustered cells

Violin plots show distribution of expression levels for Kinesin-like protein (SMED30014094) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kinesin-like protein (SMED30014094) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kinesin-like protein (SMED30014094) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014094

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30014094SMESG000016386.1 SmedASXL_016548SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30014094SMESG000016386.1 dd_Smed_v4_11012_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30014094SMESG000016386.1 dd_Smed_v4_11012_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30014094SMESG000016386.1 dd_Smed_v4_11012_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30014094SMESG000016386.1 dd_Smed_v6_11012_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30014094SMESG000016386.1 OX_Smed_1.0.22387ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30014094SMESG000016386.1 dd_Smed_v4_11012_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
testis primordiumSMED30014094SMESG000016385.1 Contig7424_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF6 (kinesin family member 6 [Source:HGNC Symbol;Acc:HGNC:21202])

HSP 1 Score: 651.744 bits (1680), Expect = 0.000e+0
Identity = 356/725 (49.10%), Postives = 487/725 (67.17%), Query Frame = 1
Query:  103 MVKQSIQIYLRIRPAEPKFPKGEYEIT-DSNSGEKLRLKVPLEIDNNYGANNKKDNYSFKYSKIFDKDSLQDSVFEAVARPVIDNFLKGYNGTVFAYGQTGSGKTFTITGGAERYSDRGIIPRALSYIFEHCNKDKTCSTSVQISYLEIYNENGYDLLDAKHDTAQKLEDLNKVTLYEDQDSNVNLKNLSIHSAVNEEDALNLLFVGDTNRMVAETPMNQASTRSHCIFTIHLTTRQTDSAVITRSKLHLVDLAGSERVYKTGVDGTLLTEAKYINLSLHYLEQVIVALSEKNRTHIPYRNSMMTAVLRDSLGGNCMTSMVATISIEKRNLMESISTCRFSQRVALIKNEAILNEAVDPQLIIKQLRDQVEQLRLQMQLTDQSEEWQNVELTEDVIRRCRNEVVNFMEENESQISRDILKDYRKINLAFDIMKELYQKTKMKISENDFPKYESKLPPIIVPDNPIATKEVIQLREIISQRDNEINILVSLLKKAKKDISERNVSDKSQLNTNVTFVKEDRSDTVPNSEIPVSEALSRESYIPVPEE----------EIIKHRILG---NLSVGREEAFEVYKNNYPLNSQIISQREELKIKYNQAKELGNAINNARETTNRIKSEISKVRIQQAISADPNQNNENVSLIMTDQEVRLRHQMEVEKARYKEAYINLKNLKTVIEHMQHLLETSKVKMMKDFEQWWQDQVNQME-KSTNIQNVSHQK 2232
            MVKQ+IQI+ R++P   K  +G Y I  D      L + +P ++ + +  NNK+++Y FK+ +IFD+D+ Q++VFE +A+PV  + L GYNGT+FAYGQTGSGKTFTITGGAERYSDRGIIPR LSYIFE   KD +   +  ISYLEIYNE GYDLLD +H+ A  LEDL KVT+ ED D N++LKNL++H A  EE+ALNLLF+GDTNRM+AETPMNQASTRSHCIFTIHL++++  SA +  +KLHLVDLAGSERV KTGV G LLTEAKYINLSLHYLEQVI+ALSEK+R+HIPYRNSMMT+VLRDSLGGNCMT+M+AT+S+EKRNL ESISTCRF+QRVALIKNEA+LNE ++P+L+IK+L+ ++++L+ ++ +   + E +   LTE  + +    + +F+E+ +S    ++  D RK++  F  +K+L      KI EN+    ESK         P+  +E  +LR+I+ QRDNEINILV++LKK KK   E        L+      +E R    P   +   E   R      P +            + H+ +G    +S+G +EAFE++K ++  +  I   ++ LK ++++AK LG +IN AR     +K EI++  IQQ   A     N  V L+   QE +LR Q+E EK RYK  +  LK LK  IEH+Q L++ +KVK+ K+FE WW ++   ++  S  + ++ H K
Sbjct:    1 MVKQTIQIFARVKPPVRKHQQGIYSIDEDEKLIPSLEIILPRDLADGF-VNNKRESYKFKFQRIFDQDANQETVFENIAKPVAGSVLAGYNGTIFAYGQTGSGKTFTITGGAERYSDRGIIPRTLSYIFEQLQKDSSKIYTTHISYLEIYNECGYDLLDPRHE-ASSLEDLPKVTILEDPDQNIHLKNLTLHQATTEEEALNLLFLGDTNRMIAETPMNQASTRSHCIFTIHLSSKEPGSATVRHAKLHLVDLAGSERVAKTGVGGHLLTEAKYINLSLHYLEQVIIALSEKHRSHIPYRNSMMTSVLRDSLGGNCMTTMIATLSLEKRNLDESISTCRFAQRVALIKNEAVLNEEINPRLVIKRLQKEIQELKDELAMV--TGEQRTEALTEAELLQLEKLITSFLEDQDSDSRLEVGADMRKVHHCFHHLKKLLNDK--KILENNTVSSESKDQDC---QEPLKEEEYRKLRDILKQRDNEINILVNMLKKEKKKAQE-------ALHLAGMDRREFRQSQSPPFRLGNPEEGQRMRLSSAPSQAQDFSILGKRSSLLHKKIGMREEMSLGCQEAFEIFKRDHADSVTIDDNKQILKQRFSEAKALGESINEARSKIGHLKEEITQRHIQQV--ALGISENMAVPLMPDQQEEKLRSQLEEEKRRYKTMFTRLKALKVEIEHLQLLMDKAKVKLQKEFEVWWAEEATNLQVNSPAVNSLDHTK 707          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF6 (kinesin family member 6 [Source:HGNC Symbol;Acc:HGNC:21202])

HSP 1 Score: 537.724 bits (1384), Expect = 1.064e-174
Identity = 301/615 (48.94%), Postives = 408/615 (66.34%), Query Frame = 1
Query:  430 GAERYSDRGIIPRALSYIFEHCNKDKTCSTSVQISYLEIYNENGYDLLDAKHDTAQKLEDLNKVTLYEDQDSNVNLKNLSIHSAVNEEDALNLLFVGDTNRMVAETPMNQASTRSHCIFTIHLTTRQTDSAVITRSKLHLVDLAGSERVYKTGVDGTLLTEAKYINLSLHYLEQVIVALSEKNRTHIPYRNSMMTAVLRDSLGGNCMTSMVATISIEKRNLMESISTCRFSQRVALIKNEAILNEAVDPQLIIKQLRDQVEQLRLQMQLTDQSEEWQNVELTEDVIRRCRNEVVNFMEENESQISRDILKDYRKINLAFDIMKELYQKTKMKISENDFPKYESKLPPIIVPDNPIATKEVIQLREIISQRDNEINILVSLLKKAKKDISERNVSDKSQLNTNVTFVKEDRSDTVPNSEIPVSEALSRESYIPVPEE----------EIIKHRILG---NLSVGREEAFEVYKNNYPLNSQIISQREELKIKYNQAKELGNAINNARETTNRIKSEISKVRIQQAISADPNQNNENVSLIMTDQEVRLRHQMEVEKARYKEAYINLKNLKTVIEHMQHLLETSKVKMMKDFEQWWQDQVNQME-KSTNIQNVSHQK 2232
            GAERYSDRGIIPR LSYIFE   KD +   +  ISYLEIYNE GYDLLD +H+ A  LEDL KVT+ ED D N++LKNL++H A  EE+ALNLLF+GDTNRM+AETPMNQASTRSHCIFTIHL++++  SA +  +KLHLVDLAGSERV KTGV G LLTEAKYINLSLHYLEQVI+ALSEK+R+HIPYRNSMMT+VLRDSLGGNCMT+M+AT+S+EKRNL ESISTCRF+QRVALIKNEA+LNE ++P+L+IK+L+ ++++L+ ++ +   + E +   LTE  + +    + +F+E+ +S    ++  D RK++  F  +K+L      KI EN+    ESK         P+  +E  +LR+I+ QRDNEINILV++LKK KK   E        L+      +E R    P   +   E   R      P +            + H+ +G    +S+G +EAFE++K ++  +  I   ++ LK ++++AK LG +IN AR     +K EI++  IQQ   A     N  V L+   QE +LR Q+E EK RYK  +  LK LK  IEH+Q L++ +KVK+ K+FE WW ++   ++  S  + ++ H K
Sbjct:    2 GAERYSDRGIIPRTLSYIFEQLQKDSSKIYTTHISYLEIYNECGYDLLDPRHE-ASSLEDLPKVTILEDPDQNIHLKNLTLHQATTEEEALNLLFLGDTNRMIAETPMNQASTRSHCIFTIHLSSKEPGSATVRHAKLHLVDLAGSERVAKTGVGGHLLTEAKYINLSLHYLEQVIIALSEKHRSHIPYRNSMMTSVLRDSLGGNCMTTMIATLSLEKRNLDESISTCRFAQRVALIKNEAVLNEEINPRLVIKRLQKEIQELKDELAMV--TGEQRTEALTEAELLQLEKLITSFLEDQDSDSRLEVGADMRKVHHCFHHLKKLLNDK--KILENNTVSSESKDQDC---QEPLKEEEYRKLRDILKQRDNEINILVNMLKKEKKKAQE-------ALHLAGMDRREFRQSQSPPFRLGNPEEGQRMRLSSAPSQAQDFSILGKRSSLLHKKIGMREEMSLGCQEAFEIFKRDHADSVTIDDNKQILKQRFSEAKALGESINEARSKIGHLKEEITQRHIQQV--ALGISENMAVPLMPDQQEEKLRSQLEEEKRRYKTMFTRLKALKVEIEHLQLLMDKAKVKLQKEFEVWWAEEATNLQVNSPAVNSLDHTK 599          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: TUBA1C (tubulin alpha 1c [Source:HGNC Symbol;Acc:HGNC:20768])

HSP 1 Score: 413.305 bits (1061), Expect = 5.042e-131
Identity = 204/437 (46.68%), Postives = 306/437 (70.02%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDG-LAKDQFACGGL-STRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + I++GQAG Q+G++ WEL+  EHGI+ DG +  D+   GG  S  + + ETGA + VPR +FVDLEP++IDE++  +YR LFHP+ L+ G  D++NNY R H  +  +++D VLD++RK  + C+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E S++PAP++S  +VEPYN++L T  +L   + AF++DNEA++DIC+  L ++RP++ N+NRL++Q+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL T++P+++AE A  + L   ++T   F   +  VKCD  +G+YM+  LL+RGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++ ++ CM++N T++ +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE++A + KDYEE  AD
Sbjct:    2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAVAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGAD 438          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: TUBA3C (tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:12408])

HSP 1 Score: 412.92 bits (1060), Expect = 5.321e-131
Identity = 203/437 (46.45%), Postives = 305/437 (69.79%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDG-LAKDQFACGGL-STRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + I++GQAG Q+G++ WEL+  EHGI+ DG +  D+   GG  S  + + ETGA + VPR +FVDLEP+++DE++  +YR LFHP+ L+ G  D++NNY R H  +  +++D VLD++RK  +LC+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E +++PAP++S  +VEPYN++L T  +L   + AF++DNEA++DIC+  L ++RP++ N+NRL+ Q+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL T++P+++AE A  + L   ++T   F   +  VKCD  +G+YM+  +L+RGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++ ++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE+LA + KDYEE   D
Sbjct:    2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVD 438          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: TUBA3D (tubulin alpha 3d [Source:HGNC Symbol;Acc:HGNC:24071])

HSP 1 Score: 412.92 bits (1060), Expect = 5.321e-131
Identity = 203/437 (46.45%), Postives = 305/437 (69.79%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDG-LAKDQFACGGL-STRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + I++GQAG Q+G++ WEL+  EHGI+ DG +  D+   GG  S  + + ETGA + VPR +FVDLEP+++DE++  +YR LFHP+ L+ G  D++NNY R H  +  +++D VLD++RK  +LC+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E +++PAP++S  +VEPYN++L T  +L   + AF++DNEA++DIC+  L ++RP++ N+NRL+ Q+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL T++P+++AE A  + L   ++T   F   +  VKCD  +G+YM+  +L+RGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++ ++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE+LA + KDYEE   D
Sbjct:    2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVD 438          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: tba-4 (Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:G5EDD4])

HSP 1 Score: 425.246 bits (1092), Expect = 4.507e-136
Identity = 208/437 (47.60%), Postives = 306/437 (70.02%), Query Frame = -1
Query: 2527 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDGLAKDQFACGGLSTRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD*N 3831
            +E++ I++GQAG Q+G++ WEL+  EHGI+ DG    +    G S  + + +TG  R+VPR IFVDLEP+++DEI+  +Y+ LFHP+ ++ G  D++NNY R H  +  +L+D  LD++R+  + CSGLQG    HS GGGTGSG+ +LL+E+L+  Y K  K E S++PAP++S  +VEPYN++L T  +L   + AF++DNEA++DICK  L VDRPS+ N+NR+++QVVS +T  +RF G +  D+ EFQTNLV YPR+HFPL +++P+++AE A  + L  +D+T   F   +  VKCD  NG+YM+  LL+RGDV   DV  A+T IK++  ++F  WCPTG K+ +N      V G DLA++P++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE+LA + KDYEE  AD N
Sbjct:    2 REVISIHVGQAGVQIGNACWELYCLEHGIQPDGTMPSEQQNEGGSFTTFFSDTGNGRYVPRSIFVDLEPTVVDEIRTGNYKKLFHPEQMITGKEDAANNYARGHYTVGKELIDTTLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICKRNLDVDRPSYTNLNRIISQVVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLASYTPLISAEKAYHEALSVNDITNSCFEPANQMVKCDPRNGKYMAVCLLYRGDVVPKDVNTAITAIKTKRSVQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLSNTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALEKDYEEVGADSN 438          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: tba-2 (Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P34690])

HSP 1 Score: 422.165 bits (1084), Expect = 8.185e-135
Identity = 207/437 (47.37%), Postives = 305/437 (69.79%), Query Frame = -1
Query: 2527 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDGLAKDQFACGGLSTRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD*N 3831
            +E++ I++GQAG Q+G++ WEL+  EHGI+ DG    Q    G S  + + +TG+ R+VPR IFVDLEP+++DEI+  +Y+ LFHP+ ++ G  D++NNY R H  +  +L+D VLD++R+  + CSGLQG    HS GGGTGSG+ +LL+E+L+  Y K  K E S++PAP++S  +VEPYN++L T  +L   + AF++DNEA++DIC+  L V+RPS+ N+NR+++QVVS +T  +RF G +  D+ EFQTNLV YPR+HFPL  ++P+++AE A  + L   D+T   F   +  VKCD  +G+YM+  LL+RGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++P++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE+LA + KDYEE  AD N
Sbjct:    2 REVISIHVGQAGVQIGNACWELYCLEHGIQPDGTMPTQSTNEGESFTTFFSDTGSGRYVPRSIFVDLEPTVVDEIRTGTYKKLFHPEQMITGKEDAANNYARGHYTVGKELIDTVLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDVERPSYTNLNRIISQVVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLAAYTPLISAEKAYHEALSVSDITNSCFEPANQMVKCDPRHGKYMAVCLLYRGDVVPKDVNTAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLSNTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALEKDYEEVGADSN 438          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: tba-2 (Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P34690])

HSP 1 Score: 422.165 bits (1084), Expect = 8.185e-135
Identity = 207/437 (47.37%), Postives = 305/437 (69.79%), Query Frame = -1
Query: 2527 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDGLAKDQFACGGLSTRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD*N 3831
            +E++ I++GQAG Q+G++ WEL+  EHGI+ DG    Q    G S  + + +TG+ R+VPR IFVDLEP+++DEI+  +Y+ LFHP+ ++ G  D++NNY R H  +  +L+D VLD++R+  + CSGLQG    HS GGGTGSG+ +LL+E+L+  Y K  K E S++PAP++S  +VEPYN++L T  +L   + AF++DNEA++DIC+  L V+RPS+ N+NR+++QVVS +T  +RF G +  D+ EFQTNLV YPR+HFPL  ++P+++AE A  + L   D+T   F   +  VKCD  +G+YM+  LL+RGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++P++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE+LA + KDYEE  AD N
Sbjct:    2 REVISIHVGQAGVQIGNACWELYCLEHGIQPDGTMPTQSTNEGESFTTFFSDTGSGRYVPRSIFVDLEPTVVDEIRTGTYKKLFHPEQMITGKEDAANNYARGHYTVGKELIDTVLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDVERPSYTNLNRIISQVVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLAAYTPLISAEKAYHEALSVSDITNSCFEPANQMVKCDPRHGKYMAVCLLYRGDVVPKDVNTAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLSNTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALEKDYEEVGADSN 438          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: tba-2 (Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P34690])

HSP 1 Score: 422.165 bits (1084), Expect = 8.185e-135
Identity = 207/437 (47.37%), Postives = 305/437 (69.79%), Query Frame = -1
Query: 2527 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDGLAKDQFACGGLSTRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD*N 3831
            +E++ I++GQAG Q+G++ WEL+  EHGI+ DG    Q    G S  + + +TG+ R+VPR IFVDLEP+++DEI+  +Y+ LFHP+ ++ G  D++NNY R H  +  +L+D VLD++R+  + CSGLQG    HS GGGTGSG+ +LL+E+L+  Y K  K E S++PAP++S  +VEPYN++L T  +L   + AF++DNEA++DIC+  L V+RPS+ N+NR+++QVVS +T  +RF G +  D+ EFQTNLV YPR+HFPL  ++P+++AE A  + L   D+T   F   +  VKCD  +G+YM+  LL+RGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++P++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE+LA + KDYEE  AD N
Sbjct:    2 REVISIHVGQAGVQIGNACWELYCLEHGIQPDGTMPTQSTNEGESFTTFFSDTGSGRYVPRSIFVDLEPTVVDEIRTGTYKKLFHPEQMITGKEDAANNYARGHYTVGKELIDTVLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDVERPSYTNLNRIISQVVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLAAYTPLISAEKAYHEALSVSDITNSCFEPANQMVKCDPRHGKYMAVCLLYRGDVVPKDVNTAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLSNTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALEKDYEEVGADSN 438          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: tba-1 (Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:O18688])

HSP 1 Score: 419.853 bits (1078), Expect = 6.150e-134
Identity = 205/435 (47.13%), Postives = 303/435 (69.66%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDGLAKDQFACGGLSTRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E++ I++GQAG Q+G++ WEL+  EHGI+ DG         G S  + + +TG  R+VPR IFVDLEP+++DEI+  +Y+ LFHP+ ++ G  D++NNY R H  +  +L+D VLD++R+  + CSGLQG    HS GGGTGSG+ +LL+E+L+  Y K  K E S++PAP++S  +VEPYN++L T  +L   + AF++DNEA++DIC+  L VDRPS+ N+NR+++QVVS +T  +RF G +  D+ EFQTNLV YPR+HFPL  ++P+++A+ A  + L  +D+T   F   +  VKCD  +G+YM+  LL+RGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++P++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE+LA + KDYEE  AD
Sbjct:    2 REVISIHVGQAGVQIGNACWELYCLEHGIQPDGTMPSDQQADGESFTTFFSDTGNGRYVPRSIFVDLEPTVVDEIRTGTYKKLFHPEQMITGKEDAANNYARGHYTVGKELIDTVLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLSVDRPSYTNLNRIISQVVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLAAYTPLISADKAYHEALSVNDITNSCFEPANQMVKCDPRHGKYMAVCLLYRGDVVPKDVNTAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLSNTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALEKDYEEVGAD 436          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: alphaTub84B (gene:FBgn0003884 transcript:FBtr0081639)

HSP 1 Score: 411.764 bits (1057), Expect = 7.486e-131
Identity = 202/437 (46.22%), Postives = 305/437 (69.79%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDG-LAKDQFACGGL-STRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + I++GQAG Q+G++ WEL+  EHGI+ DG +  D+   GG  S  + + ETGA + VPR +FVDLEP+++DE++  +YR LFHP+ L+ G  D++NNY R H  +  +++D VLD++RK  + C+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E +++PAP++S  +VEPYN++L T  +L   + AF++DNEA++DIC+  L ++RP++ N+NRL+ Q+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL+T++P+++AE A  + L   ++T   F   +  VKCD  +G+YM+  +L+RGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++ ++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE+LA + KDYEE   D
Sbjct:    2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGMD 438          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: alphaTub85E (gene:FBgn0003886 transcript:FBtr0082087)

HSP 1 Score: 408.297 bits (1048), Expect = 1.519e-129
Identity = 202/437 (46.22%), Postives = 302/437 (69.11%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDG-LAKDQFACGGL-STRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + ++IGQAG Q+G++ WEL+  EHGI+ DG +  D+   GG  S  + + ETGA + VPR +FVDLEP+++DE++  +YR LFHP+ L+ G  D++NNY R H  +  +++D VLD++RK  + C+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E S++PAP++S  +VEPYN++L T  +L   + AF++DNEA++DIC+  L ++RP++ N+NRL+ Q+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL T++P+++ E A  + L   ++T   F   +  VKCD   G+YM+  +L+RGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++ ++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE+LA + KDYEE   D
Sbjct:    2 RECISVHIGQAGVQIGNACWELYCLEHGIQPDGHMPSDKTVGGGDDSFSTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDVVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYMNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISVEKAYHEQLTVAEITNACFEPANQMVKCDPRRGKYMACCMLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFAEAREDLAALEKDYEEVGID 438          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: alphaTub84D (gene:FBgn0003885 transcript:FBtr0081538)

HSP 1 Score: 407.912 bits (1047), Expect = 1.992e-129
Identity = 201/437 (46.00%), Postives = 304/437 (69.57%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDG-LAKDQFACGGL-STRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + I++GQAG Q+G++ WEL+  EHGI+ DG +  D+   GG  S  + + ETGA + VPR +FVDLEP+++DE++  +YR LFHP+ L+ G  D++NNY R H  +  +++D VLD++RK  + C+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E +++PAP++S  +VEPYN++L T  +L   + AF++DNEA++DIC+  L ++RP++ N+NRL+ Q+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL+T++P+++AE A  + L   ++T   F   +  VK D  +G+YM+  +L+RGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++ ++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE+LA + KDYEE   D
Sbjct:    2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNACFEPANQMVKVDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGMD 438          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: alphaTub67C (gene:FBgn0087040 transcript:FBtr0076393)

HSP 1 Score: 384.03 bits (985), Expect = 2.353e-120
Identity = 193/448 (43.08%), Postives = 294/448 (65.62%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDG--LAKDQFACGGLST-----------RSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E++ I IGQ G Q+G++ WEL+  EHGI  DG    K++    G S            R+ + ETG  + VPR IFVDLEP++ID+++    R L+HP+ L+ G  D++NNY R    +  +++D+V  +++K  E C  LQG L  HS+GGGTGSG+ +LL+E+L+  Y K  K + +++P+P++S  +VEPYNALL T +++   +  F++DNEA++DIC   LGVDRP++ N+NRL+AQ+VS  T  +RF G M  D+ EFQTNLV +PR+HFPL+ ++P+++AE +  +      +T   F   +  VKCD   G++M+  +L+RGDV   DV  AV+ IKS+  I+F  WCPTG K+ +N  K A V   DLA+  ++CCM++N T+I  A+  +  KF+L+++K+AF+HW+VGEG+EE EF   RE +A + +D+EE   D
Sbjct:    2 REVVSIQIGQCGIQIGNACWELYLLEHGINLDGSLKTKEELTASGSSASVGHDTSANDARTFFTETGNGKQVPRSIFVDLEPTVIDDVRNGCMRELYHPEQLISGKEDAANNYARGRYSIGKEVIDRVTSRLQKIAEQCDSLQGFLIFHSLGGGTGSGFTSLLVERLSTDYSKKCKLDFAVYPSPKVSTAVVEPYNALLTTHSTMDHSDCVFMVDNEAIYDICNNSLGVDRPAYRNLNRLIAQIVSSTTASLRFSGSMNVDLNEFQTNLVPFPRIHFPLVAYAPLMSAERSAHEQHAITTLTNACFESSNMMVKCDPRAGKFMACCMLYRGDVVPKDVNAAVSAIKSKRHIQFVDWCPTGFKIGINYEKPAFVPDGDLAKTSRACCMLSNTTAISVAFSNLSYKFDLMFKKRAFVHWYVGEGMEEGEFTEARENIAVLERDFEEVGLD 449          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: CG7794 (gene:FBgn0038565 transcript:FBtr0083540)

HSP 1 Score: 311.997 bits (798), Expect = 4.256e-94
Identity = 170/435 (39.08%), Postives = 269/435 (61.84%), Query Frame = -1
Query: 2536 EIMFINIGQAGCQVGSSYWELFNEEHGIRNDGLAKDQFACGGLSTRSIYDETGAYRFV-PRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKF-ELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASA 3828
            EI+ I+IGQAG Q+ ++ WELF  EHGI  +G            T   ++ T     V PR + +D EP++IDEI+  SYR LFHPD L+ G  DS +N+ R +N ++ +LLD+ ++ +R+  + C  L+G L   +IGGG+GSG  T ++E+L + + K     E  ++P+P +S ++VEPYNALLA   S+   +++FI+DNEA++DIC   L V  P++ N+NR++AQVVS  T   RF G       E QTNLV YPR+H+PLI ++P++   +++F  + T  +T   F+  +  V+C+ S+G+YM++ LL+RGD+   ++  A+  IK     RF  W PTG K+ ++      V G DLA   ++C  ++N+T+I+ AW  ++ KF+ LY+++AF++ +VGEG+EE  F    E +  ++ DY E  A
Sbjct:    6 EIIQIHIGQAGVQIANACWELFCLEHGILANGRLTQSPMDDSFLT--FFEFTSHQPCVQPRLVMIDTEPTVIDEIRTGSYRNLFHPDTLITGKDDSGSNFARGYNLMASELLDRSMNAIRRVADRCRNLRGFLVFRAIGGGSGSGLGTRIMERLVEDFGKKMTVVEFLVYPSPSISPVIVEPYNALLAAHFSMDCADVSFIVDNEALYDICANTLNVPAPTYTNLNRIIAQVVSSFTASQRFGGGSTVSFQELQTNLVPYPRIHYPLINYAPLVPISHSQFVNMSTAQLTGQCFQMSNQMVRCNPSHGKYMASVLLYRGDIAPNEINTALENIKRNRSFRFVDWSPTGFKIGVSPMPPYYVPGGDLAPTNRACVAISNNTNIRIAWCRLVNKFDKLYQRRAFVYHYVGEGLEEGNFNEASENICQLVHDYLEVDA 438          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif6 (kinesin family member 6 [Source:ZFIN;Acc:ZDB-GENE-061027-130])

HSP 1 Score: 610.912 bits (1574), Expect = 0.000e+0
Identity = 324/690 (46.96%), Postives = 456/690 (66.09%), Query Frame = 1
Query:  103 MVKQSIQIYLRIRPAEPKFPKGEYEITDSNSGEKLRLKVPLEIDNNYGANNKKDNYSFKYSKIFDKDSLQDSVFEAVARPVIDNFLKGYNGTVFAYGQTGSGKTFTITGGAERYSDRGIIPRALSYIFEHCNKDKTCSTSVQISYLEIYNENGYDLLDAKHDTAQKLEDLNKVTLYEDQDSNVNLKNLSIHSAVNEEDALNLLFVGDTNRMVAETPMNQASTRSHCIFTIHLTTRQTDSAVITRSKLHLVDLAGSERVYKTGVDGTLLTEAKYINLSLHYLEQVIVALSEKNRTHIPYRNSMMTAVLRDSLGGNCMTSMVATISIEKRNLMESISTCRFSQRVALIKNEAILNEAVDPQLIIKQLRDQVEQLRLQMQLTDQSEEWQNVELTEDVIRRCRNEVVNFMEENESQISRDILKDYRKINLAFDIMKELYQKTKMKISENDFPKYESKLPPIIVPDNPIATKEVIQLREIISQRDNEINILVSLLKKAKKDISERNVSDKSQLNTNVTFVKEDRSDTVPNSEIPVSEALSRESYIPVPEEEIIKHRILGNLSVGREEAFEVYKNNYPLNSQIISQREELKIKYNQAKELGNAINNARETTNRIKSEISKVRIQQAISADPNQNNENVSLIMTDQEVRLRHQMEVEKARYKEAYINLKNLKTVIEHMQHLLETSKVKMMKDFEQWW 2172
            MVKQ+I+I+ R++P   K P  EY       G  L   VP +  + +  NNK++NY F++ K+FD+ + Q+ VFE +A+PV DN L GYNGT+FAYGQTGSGKTFTITGGAE Y+DRGIIPR LSY++ + + + T   +  ISYLEIYNE+GYDLL+ +H+ A +LEDL +VT+ ED D N++LKNLS+  + NEE+ALNLLF+GDTNRM+AETPMNQASTRSHCIFTIHL +++  SA +  SKLHLVDLAGSERV KTGV G +LTEAKYINLSLHYLEQVI+ALSEK+R+HIPYRNSMMT+VLRDSLGGNCMT+M+AT+S+EK+N+ ES+STCRF+QRVALIKNEA+LNE +DP L+I  L+ + + L+ Q+ L   + E ++ +LT++ I++    V  ++E+ + +++ D+  D RKI   F ++       K ++ E         L  ++   +  + ++V +L E+++ RDNEI+ILV++LK+ KK +           +      K    +  P +      A    S   +  + ++  + +  LS G++E FEV+  ++  +  I  +R  L+ ++ +AK LG  +N  R   N +K E+   R Q A+        E+    +   E ++  Q+E EK  YK     LK+LKT IEH+Q LLE SKVK+  DFE WW
Sbjct:    1 MVKQTIEIFARVKPT--KKPTSEYFADCDEQGGSLLFLVPRDAADGF-INNKRENYKFRFQKVFDQTASQEEVFENIAKPVADNVLAGYNGTIFAYGQTGSGKTFTITGGAEHYNDRGIIPRTLSYLYRYFSMNNTMIYTTHISYLEIYNESGYDLLNPQHE-ASRLEDLPRVTIMEDPDQNIHLKNLSLLQSANEEEALNLLFLGDTNRMIAETPMNQASTRSHCIFTIHLCSKELGSARVRCSKLHLVDLAGSERVGKTGVGGQILTEAKYINLSLHYLEQVIIALSEKDRSHIPYRNSMMTSVLRDSLGGNCMTTMIATVSVEKKNIGESLSTCRFAQRVALIKNEALLNEELDPALLIVHLKKENQSLKEQLAL--MTGEQRSDKLTQEEIQQLEGLVNVYLEDPDCEVTLDLGPDMRKIQFCFSLL-------KARVREKPCAGSSIPLTGMLDGKDRRSHEDVQKLEEMLAHRDNEISILVNMLKREKKKLQ----------DVTSQMTKPQNKNESPTTLEAAESAKYDSSNGDIHAQHLMTGKRVPELSAGQQEVFEVFLRDHKEHLSIEDKRAVLQQRFVEAKALGEQVNQIRTRVNYLKGELKNRRKQMAVQGLTGNQTESE---LDPFEEKILTQIEEEKKNYKITSGCLKDLKTEIEHLQLLLEKSKVKIQSDFENWW 664          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: tuba4l (tubulin, alpha 4 like [Source:ZFIN;Acc:ZDB-GENE-030131-5588])

HSP 1 Score: 416.001 bits (1068), Expect = 2.505e-132
Identity = 208/436 (47.71%), Postives = 304/436 (69.72%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDGLAKDQF-ACGGLSTRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + I+IGQAG Q+G+S WEL+  EHG + DG   D   +    S  + + ETGA ++VPR +F+DLEP+++DEI+   YR L+HP+ L+ G  D++NNY R H  +  +++D VLD++RK  + C+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E S++PAP++S  +VEPYN++L T  +L   + +F++DNEA++DICK  L ++RPS+ N+NRL+AQ+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL+T+SPI++AE A  + L   ++T   F   +  VKCD   G+YM+  LL+RGDV   DV  A+  IK+R  I+F  WCPTG K+ +N      V G DLA++ ++ CM++N T+I +AWG +  KF+L+Y K+AF+HW+VGEG+EE EF   RE++A + KDYEE +AD
Sbjct:    2 RECISIHIGQAGIQMGNSCWELYCLEHGFQPDGTIVDSSRSLADSSFGTFFSETGAGKYVPRAVFIDLEPTVVDEIRNGHYRQLYHPEQLISGKEDAANNYARGHYTIGKEIVDSVLDRMRKMADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSVYPAPQVSTAVVEPYNSILTTHTTLEHSDCSFMVDNEAIFDICKRNLDIERPSYTNLNRLIAQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYSPIISAEKAYHEQLSVPEITNACFEPANQMVKCDPRRGKYMACCLLYRGDVVPKDVNAAIANIKTRRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWGRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVAAD 437          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: tuba4l (tubulin, alpha 4 like [Source:ZFIN;Acc:ZDB-GENE-030131-5588])

HSP 1 Score: 415.616 bits (1067), Expect = 5.474e-132
Identity = 208/436 (47.71%), Postives = 304/436 (69.72%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDGLAKDQF-ACGGLSTRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + I+IGQAG Q+G+S WEL+  EHG + DG   D   +    S  + + ETGA ++VPR +F+DLEP+++DEI+   YR L+HP+ L+ G  D++NNY R H  +  +++D VLD++RK  + C+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E S++PAP++S  +VEPYN++L T  +L   + +F++DNEA++DICK  L ++RPS+ N+NRL+AQ+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL+T+SPI++AE A  + L   ++T   F   +  VKCD   G+YM+  LL+RGDV   DV  A+  IK+R  I+F  WCPTG K+ +N      V G DLA++ ++ CM++N T+I +AWG +  KF+L+Y K+AF+HW+VGEG+EE EF   RE++A + KDYEE +AD
Sbjct:    9 RECISIHIGQAGIQMGNSCWELYCLEHGFQPDGTIVDSSRSLADSSFGTFFSETGAGKYVPRAVFIDLEPTVVDEIRNGHYRQLYHPEQLISGKEDAANNYARGHYTIGKEIVDSVLDRMRKMADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSVYPAPQVSTAVVEPYNSILTTHTTLEHSDCSFMVDNEAIFDICKRNLDIERPSYTNLNRLIAQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYSPIISAEKAYHEQLSVPEITNACFEPANQMVKCDPRRGKYMACCLLYRGDVVPKDVNAAIANIKTRRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWGRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVAAD 444          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: tuba8l (tubulin, alpha 8 like [Source:ZFIN;Acc:ZDB-GENE-030131-9167])

HSP 1 Score: 412.92 bits (1060), Expect = 4.156e-131
Identity = 204/437 (46.68%), Postives = 302/437 (69.11%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDGLAKDQFACGGL--STRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + I++GQAG Q+G++ WEL+  EHGI+ DG        G    S  + + ETG+ + VPR +FVDLEP++IDE++  +YR LFHP+ L+ G  D++NNY R H  +  +++D VL++VRK  + C+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E +++PAP++S  +VEPYN++L T  +L   + AF++DNEA++DIC+  L ++RPS+ N+NRL+ Q+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL+T+SPI++AE A  + L   ++T   F   +  VKCD  +G+YM+  +L+RGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++ ++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE+LA + KDYEE  AD
Sbjct:    2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGNMPSDKTIGKSDDSFNTFFSETGSGKHVPRAVFVDLEPAVIDEVRSGTYRQLFHPEQLISGKEDAANNYARGHYTVGKEIIDMVLERVRKLTDQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYSPIISAEKAYHEQLSVSEITSACFEPSNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIANIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGAD 438          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: tuba1b (tubulin, alpha 1b [Source:ZFIN;Acc:ZDB-GENE-030822-1])

HSP 1 Score: 412.92 bits (1060), Expect = 4.243e-131
Identity = 206/437 (47.14%), Postives = 306/437 (70.02%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDG-LAKDQFACGGL-STRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + I++GQAG Q+G++ WEL+  EHGI+ DG +  D+   GG  S  + + ETGA + VPR +FVDLEP++IDE++  +YR LFHP+ L+ G  D++NNY R H  +  +L+D VLD+VRK  + C+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E S++PAP++S  +VEPYN++L T  +L   + AF++DNEA++DIC+  L ++RP++ N+NRL++Q+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL T++P+++AE A  + L   ++T   F   +  VKCD  +G+YM+  LL+RGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++ ++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE++A + KDYEE  A+
Sbjct:    2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKELIDLVLDRVRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGAE 438          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: kif6 (kinesin family member 6 [Source:NCBI gene;Acc:100127668])

HSP 1 Score: 664.07 bits (1712), Expect = 0.000e+0
Identity = 356/727 (48.97%), Postives = 483/727 (66.44%), Query Frame = 1
Query:  103 MVKQSIQIYLRIRPAEPKFPKGEYEIT-DSNSGEKLRLKVPLEIDNNYGANNKKDNYSFKYSKIFDKDSLQDSVFEAVARPVIDNFLKGYNGTVFAYGQTGSGKTFTITGGAERYSDRGIIPRALSYIFEHCNKDKTCSTSVQISYLEIYNENGYDLLDAKHDTAQKLEDLNKVTLYEDQDSNVNLKNLSIHSAVNEEDALNLLFVGDTNRMVAETPMNQASTRSHCIFTIHLTTRQTDSAVITRSKLHLVDLAGSERVYKTGVDGTLLTEAKYINLSLHYLEQVIVALSEKNRTHIPYRNSMMTAVLRDSLGGNCMTSMVATISIEKRNLMESISTCRFSQRVALIKNEAILNEAVDPQLIIKQLRDQVEQLRLQMQLTDQSEEWQNVELTEDVIRRCRNEVVNFMEENESQISRDILKDYRKINLAFDIMKELYQKTKMKISENDFPKYESKLPPIIVPDNPIATKEVIQLREIISQRDNEINILVSLLKKAKKDISERNVS-DKSQLNTNV----TFVKEDRSDTVPNSEI--PVSEALSRESYIPVPEEEIIKHRILGNLSVGREEAFEVYKNNYPLNSQIISQREELKIKYNQAKELGNAINNARETTNRIKSEISKVRIQQA----ISADPNQNNENVSLIMTDQEVRLRHQMEVEKARYKEAYINLKNLKTVIEHMQHLLETSKVKMMKDFEQWWQDQVNQMEKSTNIQNVSHQKSPPAT 2247
            MVKQ+I+I+ R++P+  + P G Y ++ +      L + VP ++ + +  NNK+++Y F++ + FD+D  QD++FE++A+PV ++ L GYNGT+FAYGQTGSGKTFTITGGAERYSDRGIIPR LSY+FE   KD +   +  +SYLEIYNE GYDLLD +H+ A KLEDL KVT+ ED D N++LKNLS+  A NEE+ALNLLF+GDTNRM+AETPMNQASTRS+CIFTI +++++  SA + RSKLHLVDLAGSERV KTGV G LLTEAKYINLSLHYLEQVI+AL+EKNR+HIPYRNSMMT+VLRDSLGGNCMT+M+AT+S++KRN+ ESISTCRF+QRVALIKNEAILNE  DPQLII +LR +++ L+ ++ L   + E +  ELTED   R   +V  F+E+ + + S D+  D RKI   F  +K+L    K + S    P   ++ P    P      +E+ +LR+I+ QRDNEINILVS+LKK KK   +       S+LN       +  +    D  P S +   V + +  + +           +    +S+GR+EAFE++K +YP    I   +  LK ++ +AK LG  +N  R   N++K ++ + RIQ+A     S+   QN  +       +      QME EK RYK  +  LKNLKT IEH+Q LLE +KVK+ KDFE WW ++   ++    +       S P +
Sbjct:    1 MVKQAIRIFARVKPS--RKPAGIYSVSNEEERASSLEILVPRDLADGF-VNNKRESYKFRFQETFDQDVKQDTIFESIAKPVAESVLTGYNGTIFAYGQTGSGKTFTITGGAERYSDRGIIPRTLSYMFEQFQKDSSKVYTAHVSYLEIYNECGYDLLDPRHE-ASKLEDLPKVTIMEDPDQNIHLKNLSLLQASNEEEALNLLFLGDTNRMIAETPMNQASTRSNCIFTIQVSSKEPGSATVGRSKLHLVDLAGSERVAKTGVGGQLLTEAKYINLSLHYLEQVIIALAEKNRSHIPYRNSMMTSVLRDSLGGNCMTTMIATLSLDKRNIDESISTCRFAQRVALIKNEAILNEETDPQLIIVRLRKEIQGLKGELALL--TGEQRTEELTEDETLRLEEQVRGFLEDRDPESSLDMGADMRKIQYCFAFIKKLLHGKKEEESRASSPVNAAERPSSSAP----RPEEIKKLRDILQQRDNEINILVSMLKKEKKKTQDAMFEMAPSRLNAPTRHSDSSAQSGSLDQSPKSSVSAAVEDQMGSQEW----RSHSFPRKTGEEMSLGRQEAFEIFKRDYPDRVTIEDNKRLLKQRFAEAKSLGEEVNKVRSRINQMKGDVEQRRIQRAALGIFSSSDEQNQYDPVEEELRE------QMEEEKKRYKGLFSRLKNLKTEIEHLQLLLEKAKVKLQKDFEGWWVEEAAHLQAKQEVHKARMATSAPPS 707          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: kif6 (kinesin family member 6 [Source:NCBI gene;Acc:100127668])

HSP 1 Score: 609.757 bits (1571), Expect = 0.000e+0
Identity = 339/726 (46.69%), Postives = 466/726 (64.19%), Query Frame = 1
Query:  103 MVKQSIQIYLRIRPAEPKFPKGEYEIT-DSNSGEKLRLKVPLEIDNNYGANNKKDNYSFKYSKIFDKDSLQDSVFEAVARPVIDNFLKGYNGTVFAYGQTGSGKTFTITGGAERYSDRGIIPRALSYIFEHCNKDKTCSTSVQISYLEIYNENGYDLLDAKHDTAQKLEDLNKVTLYEDQDSNVNLKNLSIHSAVNEEDALNLLFVGDTNRMVAETPMNQASTRSHCIFTIHLTTRQTDSAVITRSKLHLVDLAGSERVYKTGVDGTLLTEAKYINLSLHYLEQVIVALSEKNRTHIPYRNSMMTAVLRDSLGGNCMTSMVATISIEKRNLMESISTCRFSQRVALIKNEAILNEAVDPQLIIKQLRDQVEQLRLQMQLTDQSEEWQNVELTEDVIRRCRNEVVNFMEENESQISRDILKDYRKINLAFDIMKELYQKTKMKISENDFPKYESKLPPIIVPDNPIATKEVIQLREIISQRDNEINILVSLLKKAKKDISERNVS-DKSQLNTNV----TFVKEDRSDTVPNSEI--PVSEALSRESYIPVPEEEIIKHRILGNLSVGREEAFEVYKNNYPLNSQIISQREELKIKYNQAKELGNAINNARETTNRIKSEISKVR-IQQAISADPNQNNENVSLIMTDQEVRLRHQMEVEKARYKEAYINLKNLKTVIEHMQHLLETSKVKMMKDFEQWWQDQVNQMEKSTNIQNVSHQKSPPATSK 2253
            MVKQ+I+I+ R++P+  + P G Y ++ +      L + VP ++ + +  NNK+++Y F++ + FD+D  QD++FE++A+PV ++ L GYNGT+FAYGQTGSGKTFTITGGAERYSDRGIIPR LSY+FE   KD +   +  +SYLEIYNE GYDLLD +H+ A KLEDL KVT+ ED D N++LKNLS+  A NEE+ALNLLF+GDTNRM+AE P        +CIFTI +++++  SA + RSKLHLVDLAGSERV KTGV G LLTEAKYINLSLHYLEQVI+AL+EKNR+HIPYRNSMMT+VLRDSLGGNCMT+M+AT+S++KRN+ ESISTCRF+QRVALIKNEAILNE  DPQLII +LR +++ L+ ++ L   + E +  ELTED   R   +V  F+E+ + + S D+  D RKI   F  +K+L    K + S    P   ++ P    P      +E+ +LR+I+ QRDNEINILVS+LKK KK   +       S+LN       +  +    D  P S +   V + +  + +           +    +S+GR+EAFE++K +YP    I   +  LK +Y+     G        T  ++   +S +      I +  ++ N+   +    +E     QME EK RYK  +  LKNLKT IEH+Q LLE +KVK+ KDFE WW ++   ++    +       S P + +
Sbjct:    1 MVKQAIRIFARVKPS--RKPAGIYSVSNEEERASSLEILVPRDLADGF-VNNKRESYKFRFQETFDQDVKQDTIFESIAKPVAESVLTGYNGTIFAYGQTGSGKTFTITGGAERYSDRGIIPRTLSYMFEQFQKDSSKVYTAHVSYLEIYNECGYDLLDPRHE-ASKLEDLPKVTIMEDPDQNIHLKNLSLLQASNEEEALNLLFLGDTNRMIAEPP-----PAPNCIFTIQVSSKEPGSATVGRSKLHLVDLAGSERVAKTGVGGQLLTEAKYINLSLHYLEQVIIALAEKNRSHIPYRNSMMTSVLRDSLGGNCMTTMIATLSLDKRNIDESISTCRFAQRVALIKNEAILNEETDPQLIIVRLRKEIQGLKGELALL--TGEQRTEELTEDETLRLEEQVRGFLEDRDPESSLDMGADMRKIQYCFAFIKKLLHGKKEEESRASSPVNAAERPSSSAP----RPEEIKKLRDILQQRDNEINILVSMLKKEKKKTQDAMFEMAPSRLNAPTRHSDSSAQSGSLDQSPKSSVSAAVEDQMGSQEW----RSHSFPRKTGEEMSLGRQEAFEIFKRDYPDRVTIEDNKRLLKQRYSVLSRGGG------RTDGQLLGFLSFLSPPPTGIFSSSDEQNQYDPVEEELRE-----QMEEEKKRYKGLFSRLKNLKTEIEHLQLLLEKAKVKLQKDFEGWWVEEAAHLQAKQEVHKARMATSAPPSPQ 696          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: kif6 (kinesin family member 6 [Source:NCBI gene;Acc:100127668])

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 327/686 (47.67%), Postives = 439/686 (63.99%), Query Frame = 1
Query:  205 LRLKVPLEIDNNYGANNKKDNYSFKYSKIFDKDSLQDSVFEAVARPVIDNFLKGYNGTVFAYGQTGSGKTFTITGGAERYSDRGIIPRALSYIFEHCNKDKTCSTSVQISYLEIYNENGYDLLDAKHDTAQKLEDLNKVTLYEDQDSNVNLKNLSIHSAVNEEDALNLLFVGDTNRMVAETPMNQASTRSHCIFTIHLTTRQTDSAVITRSKLHLVDLAGSERVYKTGVDGTLLTEAKYINLSLHYLEQVIVALSEKNRTHIPYRNSMMTAVLRDSLGGNCMTSMVATISIEKRNLMESISTCRFSQRVALIKNEAILNEAVDPQLIIKQLRDQVEQLRLQMQLTDQSEEWQNVELTEDVIRRCRNEVVNFMEENESQISRDILKDYRKINLAFDIMKELYQKTKMKISENDFPKYESKLPPIIVPDNPIATKEVIQLREIISQRDNEINILVSLLKKAKKDISERNVS-DKSQLNTNV----TFVKEDRSDTVPNSEI--PVSEALSRESYIPVPEEEIIKHRILGNLSVGREEAFEVYKNNYPLNSQIISQREELKIKYNQAKELGNAINNARETTNRIKSEISKVRIQQAISADPNQNNENVSLIMTDQEVRLRHQMEV-EKARYKEAYINLKNLKTVIEHMQHLLETSKVKMMKDFEQWWQDQVNQMEKSTNIQNVSHQKSP 2238
            L + VP ++ + +  NNK+++Y F++ + FD+D  QD++FE++A+PV ++ L GYNGT+FAYGQTGSGKTFTITGGAERYSDRGIIPR LSY+FE   KD +   +  +SYLEIYNE GYDLLD +H+ A KLEDL KVT+ ED D N++LKNLS+  A NEE+ALNLLF+GDTNRM+AE P        +CIFTI +++++  SA + RSKLHLVDLAGSERV KTGV G LLTEAKYINLSLHYLEQVI+AL+EKNR+HIPYRNSMMT+VLRDSLGGNCMT+M+AT+S++KRN+ ESISTCRF+QRVALIKNEAILNE  DPQLII +LR +++ L+ ++ L   + E +  ELTED   R   +V  F+E+ + + S D+  D RKI   F  +K L+ K K + S    P   ++ P    P      +E+ +LR+I+ QRDNEINILVS+LKK KK   +       S+LN       +  +    D  P S +   V + +  + +           +    +S+GR+EAFE++K +YP    I   +  LK ++ +AK LG                  K+  Q      P+Q       + +       H + V  + RYK  +  LKNLKT IEH+Q LLE +KVK+ KDFE WW ++   ++           +SP
Sbjct:   14 LEILVPRDLADGF-VNNKRESYKFRFQETFDQDVKQDTIFESIAKPVAESVLTGYNGTIFAYGQTGSGKTFTITGGAERYSDRGIIPRTLSYMFEQFQKDSSKVYTAHVSYLEIYNECGYDLLDPRHE-ASKLEDLPKVTIMEDPDQNIHLKNLSLLQASNEEEALNLLFLGDTNRMIAEPP-----PAPNCIFTIQVSSKEPGSATVGRSKLHLVDLAGSERVAKTGVGGQLLTEAKYINLSLHYLEQVIIALAEKNRSHIPYRNSMMTSVLRDSLGGNCMTTMIATLSLDKRNIDESISTCRFAQRVALIKNEAILNEETDPQLIIVRLRKEIQGLKGELALL--TGEQRTEELTEDETLRLEEQVRGFLEDRDPESSLDMGADMRKIQYCFAFIKLLHGK-KEEESRASSPVNAAERPSSSAP----RPEEIKKLRDILQQRDNEINILVSMLKKEKKKTQDAMFEMAPSRLNAPTRHSDSSAQSGSLDQSPKSSVSAAVEDQMGSQEW----RSHSFPRKTGEEMSLGRQEAFEIFKRDYPDRVTIEDNKRLLKQRFAEAKSLGE----------------EKIPFQ-----SPSQFFPRSRWVYS-------HFIAVPSRRRYKGLFSRLKNLKTEIEHLQLLLEKAKVKLQKDFEGWWVEEAAHLQVGAQGWAFPCPESP 653          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: kif6 (kinesin family member 6 [Source:NCBI gene;Acc:100127668])

HSP 1 Score: 522.316 bits (1344), Expect = 2.996e-172
Identity = 261/452 (57.74%), Postives = 338/452 (74.78%), Query Frame = 1
Query:  205 LRLKVPLEIDNNYGANNKKDNYSFKYSKIFDKDSLQDSVFEAVARPVIDNFLKGYNGTVFAYGQTGSGKTFTITGGAERYSDRGIIPRALSYIFEHCNKDKTCSTSVQISYLEIYNENGYDLLDAKHDTAQKLEDLNKVTLYEDQDSNVNLKNLSIHSAVNEEDALNLLFVGDTNRMVAETPMNQASTRSHCIFTIHLTTRQTDSAVITRSKLHLVDLAGSERVYKTGVDGTLLTEAKYINLSLHYLEQVIVALSEKNRTHIPYRNSMMTAVLRDSLGGNCMTSMVATISIEKRNLMESISTCRFSQRVALIKNEAILNEAVDPQLIIKQLRDQVEQLRLQMQLTDQSEEWQNVELTEDVIRRCRNEVVNFMEENESQISRDILKDYRKINLAFDIMKELYQKTKMKISENDFPKYESKLPPIIVPDNPIATKEVIQLREIISQRDNEINIL 1560
            L + VP ++ + +  NNK+++Y F++ + FD+D  QD++FE++A+PV ++ L GYNGT+FAYGQTGSGKTFTITGGAERYSDRGIIPR LSY+FE   KD +   +  +SYLEIYNE GYDLLD +H+ A KLEDL KVT+ ED D N++LKNLS+  A NEE+ALNLLF+GDTNRM+AE P        +CIFTI +++++  SA + RSKLHLVDLAGSERV KTGV G LLTEAKYINLSLHYLEQVI+AL+EKNR+HIPYRNSMMT+VLRDSLGGNCMT+M+AT+S++KRN+ ESISTCRF+QRVALIKNEAILNE  DPQLII +LR +++ L+ ++ L   + E +  ELTED   R   +V  F+E+ + + S D+  D RKI   F  +K+L    K + S    P   ++ P    P      +E+ +LR+I+ QRDNEI+IL
Sbjct:   14 LEILVPRDLADGF-VNNKRESYKFRFQETFDQDVKQDTIFESIAKPVAESVLTGYNGTIFAYGQTGSGKTFTITGGAERYSDRGIIPRTLSYMFEQFQKDSSKVYTAHVSYLEIYNECGYDLLDPRHE-ASKLEDLPKVTIMEDPDQNIHLKNLSLLQASNEEEALNLLFLGDTNRMIAEPP-----PAPNCIFTIQVSSKEPGSATVGRSKLHLVDLAGSERVAKTGVGGQLLTEAKYINLSLHYLEQVIIALAEKNRSHIPYRNSMMTSVLRDSLGGNCMTTMIATLSLDKRNIDESISTCRFAQRVALIKNEAILNEETDPQLIIVRLRKEIQGLKGELALL--TGEQRTEELTEDETLRLEEQVRGFLEDRDPESSLDMGADMRKIQYCFAFIKKLLHGKKEEESRASSPVNAAERPSSSAP----RPEEIKKLRDILQQRDNEISIL 452          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: tuba1c (tubulin alpha 1c [Source:NCBI gene;Acc:394675])

HSP 1 Score: 415.231 bits (1066), Expect = 7.075e-132
Identity = 206/437 (47.14%), Postives = 306/437 (70.02%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDG-LAKDQFACGGL-STRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + I++GQAG Q+G++ WEL+  EHGI+ DG +  D+   GG  S  + + ETGA + VPR +FVDLEP++IDE++  +YR LFHP+ L+ G  D++NNY R H  +  +++D VLD++RK  + C+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E +++PAP++S  +VEPYN++L T  +L   + AF++DNEA++DIC+  L ++RPS+ N+NRL++Q+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL T++P+++AE A  + L   D+T   F   +  VKCD  +G+YM+  LL+RGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++ ++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE++A + KDYEE  AD
Sbjct:    2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVADITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGAD 438          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif6 (kinesin family member 6 [Source:MGI Symbol;Acc:MGI:1098238])

HSP 1 Score: 660.988 bits (1704), Expect = 0.000e+0
Identity = 353/726 (48.62%), Postives = 492/726 (67.77%), Query Frame = 1
Query:  103 MVKQSIQIYLRIRPAEPKFPKGEYEI-TDSNSGEKLRLKVPLEIDNNYGANNKKDNYSFKYSKIFDKDSLQDSVFEAVARPVIDNFLKGYNGTVFAYGQTGSGKTFTITGGAERYSDRGIIPRALSYIFEHCNKDKTCSTSVQISYLEIYNENGYDLLDAKHDTAQKLEDLNKVTLYEDQDSNVNLKNLSIHSAVNEEDALNLLFVGDTNRMVAETPMNQASTRSHCIFTIHLTTRQTDSAVITRSKLHLVDLAGSERVYKTGVDGTLLTEAKYINLSLHYLEQVIVALSEKNRTHIPYRNSMMTAVLRDSLGGNCMTSMVATISIEKRNLMESISTCRFSQRVALIKNEAILNEAVDPQLIIKQLRDQVEQLRLQMQLTDQSEEWQNVELTEDVIRRCRNEVVNFMEENESQISRDILKDYRKINLAFDIMKELYQKTKMKISENDFPKYESKLPPIIVPDNPIATKEVIQLREIISQRDNEINILVSLLKKAKKDISERNVSDKSQLNTNVTFVKEDRSDTVPNSEIPV---SEALSRESYIPVPEE----EIIKHR---------ILGNLSVGREEAFEVYKNNYPLNSQIISQREELKIKYNQAKELGNAINNARETTNRIKSEISKVRIQQAISADPNQNNENVSLIMTDQEVRLRHQMEVEKARYKEAYINLKNLKTVIEHMQHLLETSKVKMMKDFEQWWQDQVNQME---KSTNIQNV 2220
            MVKQ+IQI+ R++P   K  +G Y I  D      L + +P ++ + +  NNK+++Y FK+ +IFD+++ Q+ +FE +A+PV ++ L GYNGT+FAYGQTGSGKTFTITGGAERYSDRGIIPR LSYIFE   KD +   +  ISYLEIYNE GYDLLD +H+ A KLEDL KVT+ ED D N++LKNLS+H A  EE+ALNLLF+GDTNRM+AETPMNQASTRSHCIFT+HL++++  SA +  +KLHLVDLAGSERV KTGV G LLTEAKYINLSLHYLEQVI+ALSEK+RTHIPYRNSMMT+VLRDSLGGNCMT+M+AT+S+EKRN+ ESISTCRF+QRVALIKNEAILNE +DP+L+I +L+ ++E L+ ++ +   + E +   LTE  + +    + +++E+ + +   ++  D RKI+  F   K+L      K  EN      ++         P+  +E  +L  ++ QRDNEINILV++LKK KK        D  Q N+++     ++SDT P    P    S A+ R  +   P       I +HR         +   +S+GR+EAFE++K ++  +  I   ++ LK ++++AK LG +IN AR    ++K  I++  +QQ ++   ++N    S     QE +LR Q+E EK RYK A+++LK LK  IEH+Q L++ +KVK+ K+FE WW ++   ++    +TN+Q+ 
Sbjct:    1 MVKQTIQIFARVKPTVRKQQQGIYSIDEDEKLTHSLEIVLPRDLADGF-VNNKRESYKFKFQRIFDQEAKQEIIFEIIAKPVAESTLAGYNGTIFAYGQTGSGKTFTITGGAERYSDRGIIPRTLSYIFEQLQKDSSKIYTTHISYLEIYNECGYDLLDPRHE-ASKLEDLPKVTILEDPDQNIHLKNLSLHQATTEEEALNLLFLGDTNRMIAETPMNQASTRSHCIFTVHLSSKEPGSATVRHAKLHLVDLAGSERVSKTGVGGLLLTEAKYINLSLHYLEQVIIALSEKHRTHIPYRNSMMTSVLRDSLGGNCMTTMIATLSLEKRNIDESISTCRFAQRVALIKNEAILNEEIDPRLMIVRLQKEIEDLKAELAMA--TGEQRTEALTEAELLQLEKLIASYLEDQDPESRLEVGADMRKIHHCFHHFKKLLNDK--KTLENTVSSESTRQ----ACQEPLRDEEYTKLLGLLKQRDNEINILVNMLKKEKK-----KTQDALQ-NSSL-----EKSDTRPPQNSPFIAGSPAVPRTPFSSAPSHTQDLSICRHRSSLLHKKTGMREEMSLGRQEAFEIFKRDHADSVTIEDNKQVLKQRFSEAKALGESINEARSKIGQLKDAINQRHLQQ-VALGISENTVPAS-TPDPQEEKLRAQLEEEKGRYKTAFMHLKALKVEIEHLQLLMDKAKVKLQKEFEAWWAEEATSLQVNSPATNLQDA 703          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Tuba1c (tubulin, alpha 1C [Source:MGI Symbol;Acc:MGI:1095409])

HSP 1 Score: 413.305 bits (1061), Expect = 2.644e-131
Identity = 205/437 (46.91%), Postives = 306/437 (70.02%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDG-LAKDQFACGGL-STRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + I++GQAG Q+G++ WEL+  EHGI+ DG +  D+   GG  S  + + ETGA + VPR +FVDLEP++IDE++  +YR LFHP+ L+ G  D++NNY R H  +  +++D VLD++RK  + C+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E S++PAP++S  +VEPYN++L T  +L   + AF++DNEA++DIC+  L ++RP++ N+NRL++Q+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL T++P+++AE A  + L   ++T   F   +  VKCD  +G+YM+  LL+RGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++ ++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE++A + KDYEE  AD
Sbjct:    2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGAD 438          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Tuba3a (tubulin, alpha 3A [Source:MGI Symbol;Acc:MGI:1095406])

HSP 1 Score: 412.92 bits (1060), Expect = 3.653e-131
Identity = 203/437 (46.45%), Postives = 305/437 (69.79%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDG-LAKDQFACGGL-STRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + I++GQAG Q+G++ WEL+  EHGI+ DG +  D+   GG  S  + + ETGA + VPR +FVDLEP+++DE++  +YR LFHP+ L+ G  D++NNY R H  +  +++D VLD++RK  +LC+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E +++PAP++S  +VEPYN++L T  +L   + AF++DNEA++DIC+  L ++RP++ N+NRL+ Q+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL T++P+++AE A  + L   ++T   F   +  VKCD  +G+YM+  +L+RGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++ ++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE+LA + KDYEE   D
Sbjct:    2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVD 438          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Tuba3b (tubulin, alpha 3B [Source:MGI Symbol;Acc:MGI:1095408])

HSP 1 Score: 412.92 bits (1060), Expect = 3.653e-131
Identity = 203/437 (46.45%), Postives = 305/437 (69.79%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDG-LAKDQFACGGL-STRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + I++GQAG Q+G++ WEL+  EHGI+ DG +  D+   GG  S  + + ETGA + VPR +FVDLEP+++DE++  +YR LFHP+ L+ G  D++NNY R H  +  +++D VLD++RK  +LC+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E +++PAP++S  +VEPYN++L T  +L   + AF++DNEA++DIC+  L ++RP++ N+NRL+ Q+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL T++P+++AE A  + L   ++T   F   +  VKCD  +G+YM+  +L+RGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++ ++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE+LA + KDYEE   D
Sbjct:    2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVD 438          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Tuba1b (tubulin, alpha 1B [Source:MGI Symbol;Acc:MGI:107804])

HSP 1 Score: 412.149 bits (1058), Expect = 7.879e-131
Identity = 204/437 (46.68%), Postives = 305/437 (69.79%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDG-LAKDQFACGGL-STRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + I++GQAG Q+G++ WEL+  EHGI+ DG +  D+   GG  S  + + ETGA + VPR +FVDLEP++IDE++  +YR LFHP+ L+ G  D++NNY R H  +  +++D VLD++RK  + C+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E S++PAP++S  +VEPYN++L T  +L   + AF++DNEA++DIC+  L ++RP++ N+NRL++Q+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL T++P+++AE A  + L   ++T   F   +  VKCD  +G+YM+  LL+RGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++ ++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE++A + KDYEE   D
Sbjct:    2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVD 438          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|Q6ZMV9|KIF6_HUMAN (Kinesin-like protein KIF6 OS=Homo sapiens OX=9606 GN=KIF6 PE=1 SV=3)

HSP 1 Score: 651.744 bits (1680), Expect = 0.000e+0
Identity = 356/725 (49.10%), Postives = 487/725 (67.17%), Query Frame = 1
Query:  103 MVKQSIQIYLRIRPAEPKFPKGEYEIT-DSNSGEKLRLKVPLEIDNNYGANNKKDNYSFKYSKIFDKDSLQDSVFEAVARPVIDNFLKGYNGTVFAYGQTGSGKTFTITGGAERYSDRGIIPRALSYIFEHCNKDKTCSTSVQISYLEIYNENGYDLLDAKHDTAQKLEDLNKVTLYEDQDSNVNLKNLSIHSAVNEEDALNLLFVGDTNRMVAETPMNQASTRSHCIFTIHLTTRQTDSAVITRSKLHLVDLAGSERVYKTGVDGTLLTEAKYINLSLHYLEQVIVALSEKNRTHIPYRNSMMTAVLRDSLGGNCMTSMVATISIEKRNLMESISTCRFSQRVALIKNEAILNEAVDPQLIIKQLRDQVEQLRLQMQLTDQSEEWQNVELTEDVIRRCRNEVVNFMEENESQISRDILKDYRKINLAFDIMKELYQKTKMKISENDFPKYESKLPPIIVPDNPIATKEVIQLREIISQRDNEINILVSLLKKAKKDISERNVSDKSQLNTNVTFVKEDRSDTVPNSEIPVSEALSRESYIPVPEE----------EIIKHRILG---NLSVGREEAFEVYKNNYPLNSQIISQREELKIKYNQAKELGNAINNARETTNRIKSEISKVRIQQAISADPNQNNENVSLIMTDQEVRLRHQMEVEKARYKEAYINLKNLKTVIEHMQHLLETSKVKMMKDFEQWWQDQVNQME-KSTNIQNVSHQK 2232
            MVKQ+IQI+ R++P   K  +G Y I  D      L + +P ++ + +  NNK+++Y FK+ +IFD+D+ Q++VFE +A+PV  + L GYNGT+FAYGQTGSGKTFTITGGAERYSDRGIIPR LSYIFE   KD +   +  ISYLEIYNE GYDLLD +H+ A  LEDL KVT+ ED D N++LKNL++H A  EE+ALNLLF+GDTNRM+AETPMNQASTRSHCIFTIHL++++  SA +  +KLHLVDLAGSERV KTGV G LLTEAKYINLSLHYLEQVI+ALSEK+R+HIPYRNSMMT+VLRDSLGGNCMT+M+AT+S+EKRNL ESISTCRF+QRVALIKNEA+LNE ++P+L+IK+L+ ++++L+ ++ +   + E +   LTE  + +    + +F+E+ +S    ++  D RK++  F  +K+L      KI EN+    ESK         P+  +E  +LR+I+ QRDNEINILV++LKK KK   E        L+      +E R    P   +   E   R      P +            + H+ +G    +S+G +EAFE++K ++  +  I   ++ LK ++++AK LG +IN AR     +K EI++  IQQ   A     N  V L+   QE +LR Q+E EK RYK  +  LK LK  IEH+Q L++ +KVK+ K+FE WW ++   ++  S  + ++ H K
Sbjct:    1 MVKQTIQIFARVKPPVRKHQQGIYSIDEDEKLIPSLEIILPRDLADGF-VNNKRESYKFKFQRIFDQDANQETVFENIAKPVAGSVLAGYNGTIFAYGQTGSGKTFTITGGAERYSDRGIIPRTLSYIFEQLQKDSSKIYTTHISYLEIYNECGYDLLDPRHE-ASSLEDLPKVTILEDPDQNIHLKNLTLHQATTEEEALNLLFLGDTNRMIAETPMNQASTRSHCIFTIHLSSKEPGSATVRHAKLHLVDLAGSERVAKTGVGGHLLTEAKYINLSLHYLEQVIIALSEKHRSHIPYRNSMMTSVLRDSLGGNCMTTMIATLSLEKRNLDESISTCRFAQRVALIKNEAVLNEEINPRLVIKRLQKEIQELKDELAMV--TGEQRTEALTEAELLQLEKLITSFLEDQDSDSRLEVGADMRKVHHCFHHLKKLLNDK--KILENNTVSSESKDQDC---QEPLKEEEYRKLRDILKQRDNEINILVNMLKKEKKKAQE-------ALHLAGMDRREFRQSQSPPFRLGNPEEGQRMRLSSAPSQAQDFSILGKRSSLLHKKIGMREEMSLGCQEAFEIFKRDHADSVTIDDNKQILKQRFSEAKALGESINEARSKIGHLKEEITQRHIQQV--ALGISENMAVPLMPDQQEEKLRSQLEEEKRRYKTMFTRLKALKVEIEHLQLLMDKAKVKLQKEFEVWWAEEATNLQVNSPAVNSLDHTK 707          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|P34690|TBA2_CAEEL (Tubulin alpha-2 chain OS=Caenorhabditis elegans OX=6239 GN=tba-2 PE=1 SV=1)

HSP 1 Score: 422.165 bits (1084), Expect = 1.041e-133
Identity = 207/437 (47.37%), Postives = 305/437 (69.79%), Query Frame = -1
Query: 2527 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDGLAKDQFACGGLSTRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD*N 3831
            +E++ I++GQAG Q+G++ WEL+  EHGI+ DG    Q    G S  + + +TG+ R+VPR IFVDLEP+++DEI+  +Y+ LFHP+ ++ G  D++NNY R H  +  +L+D VLD++R+  + CSGLQG    HS GGGTGSG+ +LL+E+L+  Y K  K E S++PAP++S  +VEPYN++L T  +L   + AF++DNEA++DIC+  L V+RPS+ N+NR+++QVVS +T  +RF G +  D+ EFQTNLV YPR+HFPL  ++P+++AE A  + L   D+T   F   +  VKCD  +G+YM+  LL+RGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++P++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE+LA + KDYEE  AD N
Sbjct:    2 REVISIHVGQAGVQIGNACWELYCLEHGIQPDGTMPTQSTNEGESFTTFFSDTGSGRYVPRSIFVDLEPTVVDEIRTGTYKKLFHPEQMITGKEDAANNYARGHYTVGKELIDTVLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDVERPSYTNLNRIISQVVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLAAYTPLISAEKAYHEALSVSDITNSCFEPANQMVKCDPRHGKYMAVCLLYRGDVVPKDVNTAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLSNTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALEKDYEEVGADSN 438          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|P91910|TBA3_CAEEL (Tubulin alpha-3 chain OS=Caenorhabditis elegans OX=6239 GN=mec-12 PE=1 SV=1)

HSP 1 Score: 419.853 bits (1078), Expect = 8.431e-133
Identity = 207/437 (47.37%), Postives = 303/437 (69.34%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDGLAKDQFACGGL--STRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E++ I+IGQAG Q+G++ WEL+  EHGI+ DG      + GG   S  + + ETG+ R VPR + VDLEP++IDEI+  +YR+LFHP+ L+ G  D++NNY R H  +  +++D  LD++R+  + C+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E S++PAP++S  +VEPYN++L T  +L   + +F++DNEA++DIC+  L ++RPS+ N+NRL+ Q+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL TFSP+++AE A  + L   ++T   F   +  VKCD  +G+YM+  LLFRGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++P++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE+LA + KDYEE   D
Sbjct:    2 REVISIHIGQAGVQIGNACWELYCLEHGIQPDGQMPSDKSLGGSDDSFSTFFSETGSGRHVPRAVMVDLEPTVIDEIRTGTYRSLFHPEQLITGKEDAANNYARGHYTIGKEIIDLTLDRIRRLADNCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKAKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCSFMVDNEAIYDICRRNLDIERPSYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATFSPVISAEKAYHEQLSVAEITNMCFEPHNQMVKCDPRHGKYMAVCLLFRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVD 438          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|P50719|TBA_HAECO (Tubulin alpha chain OS=Haemonchus contortus OX=6289 PE=2 SV=1)

HSP 1 Score: 418.698 bits (1075), Expect = 2.331e-132
Identity = 206/437 (47.14%), Postives = 303/437 (69.34%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDGLAKDQFACGGL--STRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E++ I+IGQAG Q+G++ WEL+  EHGI+ DG      + GG   S  + + ETG+ R VPR + +DLEP++IDEI+  +YR+LFHP+ L+ G  D++NNY R H  +  +++D  LD++R+  + C+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E S++PAP++S  +VEPYN++L T  +L   + +F++DNEA++DIC+  L ++RPS+ N+NRL+ Q+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL TFSP+++AE A  + L   ++T   F   +  VKCD  +G+YM+  LLFRGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++P++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE+LA + KDYEE   D
Sbjct:    2 REVISIHIGQAGVQIGNACWELYCLEHGIQPDGQMPSDKSLGGCDDSFSTFFSETGSGRHVPRAVMIDLEPTVIDEIRTGTYRSLFHPEQLITGKEDAANNYARGHYTIGKEIIDLTLDRIRRLADNCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKAKLEFSVYPAPQVSTAVVEPYNSILTTHTTLEHSDCSFMVDNEAIYDICRRNLDIERPSYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATFSPVISAEKAYHEQLSVAEITNMCFEPHNQMVKCDPRHGKYMAVCLLFRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVD 438          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|Q6AYZ1|TBA1C_RAT (Tubulin alpha-1C chain OS=Rattus norvegicus OX=10116 GN=Tuba1c PE=1 SV=1)

HSP 1 Score: 414.846 bits (1065), Expect = 6.101e-131
Identity = 206/437 (47.14%), Postives = 306/437 (70.02%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDG-LAKDQFACGGL-STRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + I++GQAG Q+G++ WEL+  EHGI+ DG +  D+   GG  S  + + ETGA + VPR +FVDLEP++IDE++  +YR LFHP+ L+ G  D++NNY R H  +  +++D VLD++RK  + C+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E S++PAP++S  +VEPYN++L T  +L   + AF++DNEA++DIC+  L ++RP++ N+NRL++Q+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL T++P+++AE A  + L   ++T   F   +  VKCD  +G+YM+  LL+RGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLAR+ ++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE++A + KDYEE  AD
Sbjct:    2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLARVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGAD 438          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A3S1HFL7 (Kinesin-like protein OS=Elysia chlorotica OX=188477 GN=EGW08_013838 PE=3 SV=1)

HSP 1 Score: 686.026 bits (1769), Expect = 0.000e+0
Identity = 360/696 (51.72%), Postives = 482/696 (69.25%), Query Frame = 1
Query:  103 MVKQSIQIYLRIRPAEP-KFPKGEYEITDSNSG-EKLRLKVPLEIDNNYGANNKKDNYSFKYSKIFDKDSLQDSVFEAVARPVIDNFLKGYNGTVFAYGQTGSGKTFTITGGAERYSDRGIIPRALSYIFEHCNKDKTCSTSVQISYLEIYNENGYDLLDAKHDTAQKLEDLNKVTLYEDQDSNVNLKNLSIHSAVNEEDALNLLFVGDTNRMVAETPMNQASTRSHCIFTIHLTTRQTDSAVITRSKLHLVDLAGSERVYKTGVDGTLLTEAKYINLSLHYLEQVIVALSEKNRTHIPYRNSMMTAVLRDSLGGNCMTSMVATISIEKRNLMESISTCRFSQRVALIKNEAILNEAVDPQLIIKQLRDQVEQLRLQMQLTDQSEEWQNVELTEDVIRRCRNEVVNFMEENESQISRDILKDYRKINLAFDIMKELYQKTKMKISENDFPKYESKLPPIIVPD-NPIATKEVIQLREIISQRDNEINILVSLLKKAKKDISERNVSDKSQLNTNVTFVKEDRSDTVPNSEIPVSEALSRESYIPVPEEEIIKHRILGNLSVGREEAFEVYKNNYPLNSQIISQREELKIKYNQAKELGNAINNARETTNRIKSEISKVRIQQAISADPNQNNENVSLIMTDQEVRLRHQMEVEKARYKEAYINLKNLKTVIEHMQHLLETSKVKMMKDFEQWWQDQ 2181
            MVKQ+IQI+ R++P++  K     YEI D  +G  +L++ VP E+ + +  NNKK+NYSF++ K+FD+ + QD VF+AVA+PVIDN ++GYNGT+FAYGQTGSGKTFTITGGAERY DRGIIPR+LSYIFE   K      +  ISYLE+YNENGYDLLD KH+ A KLEDL KV+L ED D N++LKNL++HSA +EE+ALNLLF+GDTNRM+AETPMNQAS+RSHCIFT+HLT+++  SA I R+KLHLVDLAGSERV KTGV+GTLLTEAKYINLSLHYLEQVI+ALSEKNR H+PYRNSMMT+VLRDSLGGNCMTSM+AT S+EKR++ ESISTCRF+QRVA+IKN+  LNE +DP+L+I +L+ +  +LR   QLT  + E  +  LT D I RC   V N++++ + +   ++  D RKI   F I+K L  +   +      P+  S+    + PD  P    E  +L+E++ QRDNEINILV++LKK +K  ++   ++K  ++ N T  K D  D             +  S  PVP         +GN+S+GR+EAF+++  +Y    +I + +E LK +Y++AK LG  +N +++  + +   ISK+              E      T  E  +R +M  EK  YKE + +L+ +KT IEH+QH LE SKV++MKDFE WW +Q
Sbjct:    1 MVKQTIQIFARVKPSKAVKTGVCLYEIDDDEAGNPRLQIVVPRELASGF-INNKKENYSFRFDKVFDQKTSQDEVFDAVAKPVIDNAIQGYNGTIFAYGQTGSGKTFTITGGAERYMDRGIIPRSLSYIFETFQKYPDKVFTAHISYLELYNENGYDLLDPKHE-ATKLEDLPKVSLMEDSDQNMHLKNLTVHSAQSEEEALNLLFMGDTNRMIAETPMNQASSRSHCIFTVHLTSKEEGSATIRRAKLHLVDLAGSERVSKTGVNGTLLTEAKYINLSLHYLEQVIIALSEKNRQHVPYRNSMMTSVLRDSLGGNCMTSMIATCSMEKRSMDESISTCRFAQRVAMIKNDVSLNEELDPRLLISKLKRENAELR--DQLTMATGEQLSEMLTPDEIERCEEAVRNYLQDPDPECILNVGHDLRKIQKCFKILKRLILEKPQQPHSPRQPELSSR--EAMTPDVGPYRDAETTRLKELVEQRDNEINILVNMLKKERKRAAD---AEKGNVSVNQTNTKSDAGDGFGEGGASQRRRNTLNSSYPVPPP-------VGNMSLGRQEAFDIFMRDYRDRKKIDTNKEILKQRYSEAKALGQQLNKSKQKMSNLNLLISKLNTLTDFGVAEGMEGE------TQMEKEIRKEMNAEKHIYKETFSSLREMKTEIEHLQHFLEKSKVQLMKDFELWWAEQ 674          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A210Q483 (Kinesin-like protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT10234 PE=3 SV=1)

HSP 1 Score: 684.1 bits (1764), Expect = 0.000e+0
Identity = 362/680 (53.24%), Postives = 482/680 (70.88%), Query Frame = 1
Query:  184 DSNSGEKLRLKVPLEIDNNYGANNKKDNYSFKYSKIFDKDSLQDSVFEAVARPVIDNFLKGYNGTVFAYGQTGSGKTFTITGGAERYSDRGIIPRALSYIFEHCNKDKTCSTSVQISYLEIYNENGYDLLDAKHDTAQKLEDLNKVTLYEDQDSNVNLKNLSIHSAVNEEDALNLLFVGDTNRMVAETPMNQASTRSHCIFTIHLTTRQTDSAVITRSKLHLVDLAGSERVYKTGVDGTLLTEAKYINLSLHYLEQVIVALSEKNRTHIPYRNSMMTAVLRDSLGGNCMTSMVATISIEKRNLMESISTCRFSQRVALIKNEAILNEAVDPQLIIKQLRDQVEQLRLQMQLTDQSEEWQNVELTEDVIRRCRNEVVNFMEENESQISRDILKDYRKINLAFDIMKELYQKTKMKISENDFPKYESKLPPIIVPD-NPIATKEVIQLREIISQRDNEINILVSLLKKAKKDISERNVSDKSQLNTNVTFVKEDRSDTVPNSEIPV--SEALSRESYIPVP--------EEEIIKHRILGNLSVGREEAFEVYKNNYPLNSQIISQREELKIKYNQAKELGNAINNARETTNRIKSEISKVRIQQAISA--DPNQNNENVSLIMTDQEVRLRHQMEVEKARYKEAYINLKNLKTVIEHMQHLLETSKVKMMKDFEQWWQDQV 2184
            D +   +L   VP ++   +  NNKK+NY F++ ++FD+ S Q+ VFEAV++PVIDN L GYNGT+FAYGQTGSGKTFTITGGAERY+DRGIIPR++SY++E   KD   +  + ISYLEIYNENG+DLLD KH+ A KLEDL KV L ED D N++LKNLS+H A +EE+ALNLLF+GDTNRM+AETPMNQASTRSHCIFTIH+T+R+T SA I R+KLHLVDLAGSERV K+GV GTLLTEAKYINLSLH+LEQVI+AL++KNR HIPYRNSMMT+VLRDSLGGNCMT+M+AT SIEKRNL ESISTCRF+QRVA+IKN+ ++NE +DP+L+I++L+ +++QL+ ++ +   + E +  +LT++ ++RC+  V  ++E+ + ++S  I  D RKI   F I+K+ +   K  ++E       S  P    PD  P +  E  +L+E++ QRDNEINILVS+LKK KK    R  + +S+L     F    R+ +V + E P   + A+SRES              EE  K +ILG++S GR+EAFE ++ +YP    I   + +LK +Y +AK LG  +N  R+  N +K +I + R+Q A+    DPN    +      D+E  LR  ME EK  YK+++  LK LKT IEH+QHLLE SKVK+MKDFE WW +Q 
Sbjct:   48 DDDGQPRLTFVVPRDLAEGF-INNKKENYKFRFQQVFDQKSKQEDVFEAVSKPVIDNVLSGYNGTIFAYGQTGSGKTFTITGGAERYADRGIIPRSISYLYEQFEKDTERTYELHISYLEIYNENGFDLLDPKHE-ASKLEDLPKVGLMEDSDQNIHLKNLSVHQASSEEEALNLLFLGDTNRMIAETPMNQASTRSHCIFTIHVTSRETGSATIRRAKLHLVDLAGSERVSKSGVGGTLLTEAKYINLSLHFLEQVIIALADKNRQHIPYRNSMMTSVLRDSLGGNCMTTMIATCSIEKRNLDESISTCRFAQRVAMIKNDVMVNEELDPKLMIQKLKREIQQLKEELAMA--TGEQRTDDLTDEDLQRCQEAVEQYLEDTDPEVSLSIGADMRKIETCFRILKK-HVLDKPSVTE----VVRSPPPEAPPPDTGPYSDTENRKLKELVQQRDNEINILVSMLKKEKK----RASNAESELTNMGKFAV--RTSSV-SGEAPSYNNVAMSRESTGSRSSKPNSARRREEHAKSKILGDMSKGRQEAFETFRRDYPQQETIEQNKVQLKQRYAEAKSLGENVNKTRKKINHLKGQIEQHRMQLAMQGLVDPNNPEPD------DEEQELRADMEEEKDSYKQSFTRLKTLKTEIEHLQHLLEKSKVKLMKDFEMWWAEQA 705          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A267EM16 (Kinesin-like protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027733g1 PE=3 SV=1)

HSP 1 Score: 681.789 bits (1758), Expect = 0.000e+0
Identity = 356/731 (48.70%), Postives = 485/731 (66.35%), Query Frame = 1
Query:  103 MVKQSIQIYLRIRPAEPKFPKGEYEI-TDSNSGEKLRLKVPLEIDNNYGANNKKDNYSFKYSKIFDKDSLQDSVFEAVARPVIDNFLKGYNGTVFAYGQTGSGKTFTITGGAERYSDRGIIPRALSYIFEHCNKDKTCSTSVQISYLEIYNENGYDLLDAKHDTAQKLEDLNKVTLYEDQDSNVNLKNLSIHSAVNEEDALNLLFVGDTNRMVAETPMNQASTRSHCIFTIHLTTRQTDSAVITRSKLHLVDLAGSERVYKTGVDGTLLTEAKYINLSLHYLEQVIVALSEKNRTHIPYRNSMMTAVLRDSLGGNCMTSMVATISIEKRNLMESISTCRFSQRVALIKNEAILNEAVDPQLIIKQLRDQVEQLRLQMQLTDQSEEWQNVELTEDVIRRCRNEVVNFMEENESQISRDILKDYRKINLAFDIMKELYQKTKMKISENDFPKYESKLPPIIVPDNPIATKEVIQLREIISQRDNEINILVSLLKKAKKDISERNVS-----------------DKSQLNTNVTFVK-EDRSDTVPNSE-IPVSEALSRESYIPV---PE--------------EEIIKHRILGN-LSVGREEAFEVYKNNYPLNSQIISQREELKIKYNQAKELGNAINNARETTNRIKSEISKVRIQQAISADPNQNNENVSLIMTDQEVRLRHQMEVEKARYKEAYINLKNLKTVIEHMQHLLETSKVKMMKDFEQWWQDQ 2181
            MVKQ+IQI+ R++P   K     Y++ +D+    ++    P E+ +    NNKK+ + F++ ++F  D  Q+ VFE VARPVI+N L GYNGT+FAYGQTGSGKTFT+TGGAERY+DRGIIPR LSYIF +  +      S+ +SYLEIYNENGYDLLD KH+ A +LEDL KVTL+ED    ++LKNLS+H A +EEDALNLLFVGDTNRM+AETPMNQASTRSHCIFT HLT ++  SA + R+KLHLVDLAGSERV KTGV+G LLTEAKYINLSLHYLEQVIVALSE++R+H+PYRNSMMT+VLRDSLGGNCMT+M+AT+S+E  NL E+ISTCRF+QRVALIKN+A+LNE +DP L+I +LR +V QL+   ++   + E ++ ELTE+ ++ CR  V  F+ +  +     +  D RK+   F ++++   K     +E   P+    + P      P+ATKEV +LRE ISQRDNEI ILV +LK+ K+  +E +V                  D+S    N TF K  D + ++ +S  +P   A  +    P    P               E+  K RILG  LS+GR+EAFE++K +Y  N +I   ++ L+  Y  AK+LG ++N +R+   R+K+ + + R+++A+ ++ +          + +E  LR  ME  KA Y++++  LK+LK  IEH QH LE  KV+++KDFE WW +Q
Sbjct:    9 MVKQTIQIFCRLKPPSSKARLSNYDVDSDAEGKPRISFVCPRELTDG-SVNNKKEQFKFRFERVFATDCRQEDVFEHVARPVINNVLSGYNGTIFAYGQTGSGKTFTVTGGAERYADRGIIPRTLSYIFAYFEQRPEFEFSLGVSYLEIYNENGYDLLDPKHEAA-RLEDLPKVTLFEDAGQQIHLKNLSVHPAASEEDALNLLFVGDTNRMIAETPMNQASTRSHCIFTAHLTVKEVGSATVRRAKLHLVDLAGSERVSKTGVNGLLLTEAKYINLSLHYLEQVIVALSERSRSHVPYRNSMMTSVLRDSLGGNCMTTMIATLSVESANLGETISTCRFAQRVALIKNDAVLNEELDPSLLISRLRSEVAQLK--AEIAALTGEQRDDELTEEELQMCRTAVDAFLADANASPLASVGFDGRKLGQCFRLIRD-AAKAGATPAEPAPPQQIVTIAP-----EPLATKEVRELRETISQRDNEIVILVGMLKQEKRRAAEASVMLQQMAESPGANAANLQLDQSPKKFNRTFSKPADTAASMSHSACLPSVAAQPQRQQPPTLHQPTESTGGESDRLSQQLEQSAKARILGGQLSLGRQEAFELFKRDYAGNPEIERHKQGLRDNYGLAKQLGASVNESRQAIERLKAGLERARLRRALGSESD----------SSEEAALRADMEQSKAEYRDSFQRLKSLKAEIEHQQHQLEMLKVRLVKDFEAWWAEQ 719          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A3M7QED8 (Kinesin-like protein OS=Brachionus plicatilis OX=10195 GN=BpHYR1_005880 PE=3 SV=1)

HSP 1 Score: 680.248 bits (1754), Expect = 0.000e+0
Identity = 364/708 (51.41%), Postives = 491/708 (69.35%), Query Frame = 1
Query:  103 MVKQSIQIYLRIRPAEPKFPKGEYEITDSNSGEKLRLKVPLEIDNNYGANNKKDNYSFKYSKIFDKDSLQDSVFEAVARPVIDNFLKGYNGTVFAYGQTGSGKTFTITGGAERYSDRGIIPRALSYIFEHCNKDKTCSTSVQISYLEIYNENGYDLLDAKHDTAQKLEDLNKVTLYEDQDSNVNLKNLSIHSAVNEEDALNLLFVGDTNRMVAETPMNQASTRSHCIFTIHLTTRQTDSAVITRSKLHLVDLAGSERVYKTGVDGTLLTEAKYINLSLHYLEQVIVALSEKNRTHIPYRNSMMTAVLRDSLGGNCMTSMVATISIEKRNLMESISTCRFSQRVALIKNEAILNEAVDPQLIIKQLRDQVEQLRLQMQLTDQSEEWQNVELTEDVIRRCRNEVVNFMEENESQISRDILKDYRKINLAFDIMKELYQKTKMKISENDFPKYESKLPPIIVPDNPIA-----------TKEVIQLREIISQRDNEINILVSLLKKAKKDISERNVSDKSQLNTNVTFVKEDRSDTVPNSEIPVSEALSRESYIPVPEEEIIKHRILGNLSVGREEAFEVYKNNYPLNSQIISQREELKIKYNQAKELGNAINNARETTNRIKSEISKVRIQ-QAISA--DPNQNNENVSLIMTDQEVRLRHQMEVEKARYKEAYINLKNLKTVIEHMQHLLETSKVKMMKDFEQWWQDQV 2184
            MVKQ+IQI+ RI+P + K  K  YEI   +S + +   VP ++   +  NNKK+ Y FK+ +IF++D++QD VF+ VA PVI+N L GYNGT+FAYGQTGSGKTFTITGG E+Y+DRGIIPR++SY FE  +K    S ++ ISYLEIYNENGYDLLD +H  + KLEDL KVTL ED+D+N++LKNLSIH A NEE+ALNLLF+GDTNRM+AETPMNQASTRSHCIFT+H+T R+T SA I ++KLHLVDLAGSER+ KT  +G LLTEAKYINLSLHYLEQVIVAL+EKNRTH+PYRNSMMT+VLRDSLGGNCMT+M+AT SIEK+NL ESISTCRF+QRVA+IKNEAI+NE +DP+L+I +L+ +VE+L+ Q+ + +  E +   +L++D I + +   + ++E+ ++  S ++  D RKIN  F ++K++Y +   K          SK+ P+  P N  A           +KE+  L++ + QRDNEI+ILV++LKK KK   +     +  L   V  +    S +  N ++P      +E     P     K +IL N+S+GR+EAFE++K +Y  N +I  Q++ LK  Y +AK LG  IN AR     +KS+  ++ ++ +A ++  DP QN+E  S          R  ME EK  Y+E +  LKNLKT IEH Q+L+E S+VK+ KDFE WW +Q 
Sbjct:    1 MVKQTIQIFCRIKPTKAK--KSLYEIDCKDSSDIITFSVPKDVSEGF-INNKKEEYKFKFERIFNQDTIQDDVFKQVAEPVIENVLSGYNGTIFAYGQTGSGKTFTITGGPEKYTDRGIIPRSISYFFEMFSKKPEYSFTMHISYLEIYNENGYDLLDPQHQVS-KLEDLPKVTLMEDEDNNIHLKNLSIHPANNEEEALNLLFLGDTNRMIAETPMNQASTRSHCIFTLHITARETGSATIRKAKLHLVDLAGSERIGKTNANGILLTEAKYINLSLHYLEQVIVALAEKNRTHVPYRNSMMTSVLRDSLGGNCMTTMIATCSIEKKNLDESISTCRFAQRVAMIKNEAIVNEELDPRLVINRLKREVEELKNQLSIANNGEAFDG-DLSQDEIEKLKILTLRYLEDRDNDSSLNVGADMRKINFCFKLLKDMYIQLLAK----------SKIAPVPGPSNQPANVTIIDASHYDSKELKDLKDTLRQRDNEISILVNMLKKEKKKFEDLM---QGLLKPPVHVL----SSSGSNDDLP------KEFNKNHP-----KRQILQNMSLGRQEAFEIFKRDYVGNQEIEEQKKFLKKSYAEAKMLGELINTARTKLQHLKSKSEQIYLKLEATNSLNDPRQNSEYES---------TRKTMEFEKENYRENFEKLKNLKTQIEHAQYLIEKSQVKLQKDFEIWWTEQC 666          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A267G5D0 (Kinesin-like protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027733g3 PE=3 SV=1)

HSP 1 Score: 677.552 bits (1747), Expect = 0.000e+0
Identity = 352/733 (48.02%), Postives = 480/733 (65.48%), Query Frame = 1
Query:  103 MVKQSIQIYLRIRPAEPKFPKGEYEI-TDSNSGEKLRLKVPLEIDNNYGANNKKDNYSFKYSKIFDKDSLQDSVFEAVARPVIDNFLKGYNGTVFAYGQTGSGKTFTITGGAERYSDRGIIPRALSYIFEHCNKDKTCSTSVQISYLEIYNENGYDLLDAKHDTAQKLEDLNKVTLYEDQDSNVNLKNLSIHSAVNEEDALNLLFVGDTNRMVAETPMNQASTRSHCIFTIHLTTRQTDSAVITRSKLHLVDLAGSERVYKTGVDGTLLTEAKYINLSLHYLEQVIVALSEKNRTHIPYRNSMMTAVLRDSLGGNCMTSMVATISIEKRNLMESISTCRFSQRVALIKNEAILNEAVDPQLIIKQLRDQVEQLRLQMQLTDQSEEWQNVELTEDVIRRCRNEVVNFMEENESQISRDILKDYRKINLAFDIMKELYQKTKMKISENDFPKYESKLPPIIVPDNPIATKEVIQLREIISQRDNEINILVSLLKKAKKDISERNVS-----------------DKSQLNTNVTFVKEDRSDTVP----NSEIPVSEALSRESYIPV---PE--------------EEIIKHRILGN-LSVGREEAFEVYKNNYPLNSQIISQREELKIKYNQAKELGNAINNARETTNRIKSEISKVRIQQAISADPNQNNENVSLIMTDQEVRLRHQMEVEKARYKEAYINLKNLKTVIEHMQHLLETSKVKMMKDFEQWWQDQ 2181
            MVKQ+IQI+ R++P   K     Y++ +D+    ++    P E+ +    NNKK+ + F++ ++F  D  Q+ VFE VARPVI+N L GYNGT+FAYGQTGSGKTFT+TGGAERY+DRGIIPR LSYIF +  +      S+ +SYLEIYNENGYDLLD KH+ A +LEDL KVTL+ED    ++LKNLS+H A +EEDALNLLFVGDTNRM+AETPMNQASTRSHCIFT HLT ++  SA + R+KLHLVDLAGSERV KTGV+G LLTEAKYINLSLHYLEQVIVALSE++R+H+PYRNSMMT+VLRDSLGGNCMT+M+AT+S+E  NL E+ISTCRF+QRVA+IKN+A+LNE +DP L+I +LR +V QL+   ++   + E ++ ELTE+ +  CR  V  F+ +  +     +  D RK+   F ++++  +            +       + +   P+ATKEV +LRE ISQRDNEI ILV +LK+ K+  +E +V                  D+S    N TF K   SDT      ++ +P   A  +    P    P               E+  K RILG  LS+GR+EAFE++K +Y  N +I   ++ L+  Y  AK+LG ++N +R+   R+K+ + + R+++A+ ++ +          + +E  LR  ME  KA Y++++  LK+LK  IEH QH LE  KV+++KDFE WW +Q
Sbjct:    2 MVKQTIQIFCRLKPPSSKARVSNYDVDSDAEGKPRISFVCPRELTDG-SVNNKKEQFKFRFERVFATDCRQEDVFEHVARPVINNVLSGYNGTIFAYGQTGSGKTFTVTGGAERYADRGIIPRTLSYIFAYFEQRPEFEFSLGVSYLEIYNENGYDLLDPKHEAA-RLEDLPKVTLFEDAGQQIHLKNLSVHPAASEEDALNLLFVGDTNRMIAETPMNQASTRSHCIFTAHLTVKEVGSATVRRAKLHLVDLAGSERVSKTGVNGLLLTEAKYINLSLHYLEQVIVALSERSRSHVPYRNSMMTSVLRDSLGGNCMTTMIATLSVESANLGETISTCRFAQRVAIIKNDAVLNEELDPSLLISRLRSEVAQLK--AEIAALTGEQRDDELTEEELHLCRAAVDAFLADTNASPLASVGFDGRKLGQCFRLIRDAAKAAATPAEPAPPQQI------VTIAPEPLATKEVRELRETISQRDNEIVILVGMLKQEKRRAAEASVMLQQMAESPGANAANLQLDQSPKKFNRTFSKP--SDTAASMSHSASLPSVAAQPQRQQPPALHQPTESTGGESDRLSQQLEQSAKARILGGQLSLGRQEAFELFKRDYAGNPEIERHKQRLRDNYGLAKQLGASVNESRQAIERLKAGLERARLRRALGSESD----------SSEEAALRADMEQSKAEYRDSFQRLKSLKAEIEHQQHQLEMLKVRLVKDFEAWWAEQ 712          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000025205.2 (tubulin alpha-8 chain-like [Source:NCBI gene;Acc:103041851])

HSP 1 Score: 417.157 bits (1071), Expect = 1.019e-132
Identity = 206/436 (47.25%), Postives = 305/436 (69.95%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDGL-AKDQFACGGLSTRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + ++IGQAG Q+G+S WEL+  EHGI+ DG+ A    A    S  + + +TGA ++VPR +F+DLEP+++DEI+   YR L+HP+ L+ G  D++NNY R H  +  +++D VLD++RK  + C+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E S++PAP++S  +VEPYN++L T  +L   + +F++DNEA++D+CK  L ++RPS+ N+NRL+AQ+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL+T+SPI++AE A  + L   ++T   F   +  VKCD  +G+YM+  LL+RGDV   DV  A+  IK+R  I+F  WCPTG K+ +N      V G DLA++ ++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE++A + KDYEE  AD
Sbjct:    2 RECISVHIGQAGVQMGNSCWELYCLEHGIQPDGMIAPGSSAMSDSSFGTFFSDTGAGKYVPRAVFIDLEPAVVDEIRNGHYRQLYHPEQLISGKEDAANNYARGHYTIGKEIVDSVLDRMRKMADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSVYPAPQVSTAVVEPYNSILTTHTTLEHSDCSFMVDNEAIFDLCKRNLDIERPSYNNLNRLIAQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYSPIISAEKAYHEQLSVSEITNSCFEPTNQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIASIKTRRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGAD 437          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: tuba1a (tubulin alpha chain [Source:NCBI gene;Acc:103037973])

HSP 1 Score: 414.075 bits (1063), Expect = 1.406e-131
Identity = 206/437 (47.14%), Postives = 305/437 (69.79%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDG-LAKDQFACGGL-STRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + I++GQAG Q+G++ WEL+  EHGI+ DG +  D+   GG  S  + + ETGA + VPR +FVDLEP++IDE++  +YR LFHP+ L+ G  D++NNY R H  +  +++D VLD+VRK  + C+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E S++PAP++S  +VEPYN++L T  +L   + AF++DNEA++DIC+  L ++RPS+ N+NRL++Q+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL T++P+++AE A  + L   ++T   F   +  VKCD  +G+YM+  LL+RGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++ ++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE++A + KDYEE   D
Sbjct:    2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRVRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVD 438          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: tuba8l2 (tubulin alpha chain-like [Source:NCBI gene;Acc:103042625])

HSP 1 Score: 413.69 bits (1062), Expect = 1.570e-131
Identity = 203/437 (46.45%), Postives = 304/437 (69.57%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDGLAKDQFACGGL--STRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + +++GQAG Q+G++ WEL+  EHGI+ DG    Q   GG   S  + + ETGA ++VPR IFVDLEP++IDE++  +YR LFHP+ L+ G  D++NNY R H  +  +++D VLD++RK  + C+GLQG L  HS GGGTGSG+ +LL+E+L+  + K  K E +++PAP++S  +VEPYN++L T  +L   + AF++DNEA++DIC+  L ++RPS+ N+NRL++Q+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL T++P+++AE A  + L   ++T   F   +  VKCD  +G+YM+  LL+RGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++ ++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE++A + KDYEE   D
Sbjct:    2 RECISVHVGQAGVQMGNTCWELYCLEHGIQPDGQMPSQKPVGGHDDSFTTFFSETGAGKYVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNYARGHYTIGKEIIDSVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDFGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNSCFEPSNQMVKCDPRHGKYMACCLLYRGDVVPKDVNVAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGID 438          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000019222.2 (tubulin alpha-1 chain [Source:NCBI gene;Acc:103031418])

HSP 1 Score: 412.535 bits (1059), Expect = 4.957e-131
Identity = 204/437 (46.68%), Postives = 300/437 (68.65%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDGLAKDQFACGGL--STRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + I++GQAG Q+G++ WEL+  EHGI+ DG        GG   S  + + ETG+ + VPR +FVDLEPS+IDE++   YR LFHP+ L+ G  D++NNY R H  +  +++D VL++VRK  + C+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E +++PAP++S  +VEPYN++L T  +L   + AF++DNEA++DIC+  L ++RPS+ N+NRL+ Q+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL+T+SPI++ E A  + L   ++T   F   +  VKCD  +G+YM+  +L+RGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++ ++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE+LA + KDYEE   D
Sbjct:    2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGTMPSDKTIGGGDDSFNTFFSETGSGKHVPRAVFVDLEPSVIDEVRSGIYRQLFHPEQLISGKEDAANNYARGHYTVGKEIIDVVLERVRKLTDQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYSPIISTEKAYHEQLSVAEITSACFEPSNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIANIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGTD 438          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000030346.1 (tubulin alpha-1B chain [Source:NCBI gene;Acc:111195381])

HSP 1 Score: 412.149 bits (1058), Expect = 6.187e-131
Identity = 204/437 (46.68%), Postives = 305/437 (69.79%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDG-LAKDQFACGGL-STRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + I++GQAG Q+G++ WEL+  EHGI+ DG +  D+   GG  S  + + ETGA + VPR +FVDLEP++IDE++  +YR LFHP+ L+ G  D++NNY R H  +  +++D VLD++RK  + C+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E S++PAP++S  +VEPYN++L T  +L   + AF++DNEA++DIC+  L ++RP++ N+NRL++Q+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL T++P+++AE A  + L   ++T   F   +  VKCD  +G+YM+  LL+RGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++ ++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE++A + KDYEE   D
Sbjct:    2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVD 438          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: kif6 (kinesin family member 6 [Source:ZFIN;Acc:ZDB-GENE-061027-130])

HSP 1 Score: 656.751 bits (1693), Expect = 0.000e+0
Identity = 349/730 (47.81%), Postives = 486/730 (66.58%), Query Frame = 1
Query:  103 MVKQSIQIYLRIRPAEPKFPKGEYEIT-DSNSGEKLRLKVPLEIDNNYGANNKKDNYSFKYSKIFDKDSLQDSVFEAVARPVIDNFLKGYNGTVFAYGQTGSGKTFTITGGAERYSDRGIIPRALSYIFEHCNKDKTCSTSVQISYLEIYNENGYDLLDAKHDTAQKLEDLNKVTLYEDQDSNVNLKNLSIHSAVNEEDALNLLFVGDTNRMVAETPMNQASTRSHCIFTIHLTTRQTDSAVITRSKLHLVDLAGSERVYKTGVDGTLLTEAKYINLSLHYLEQVIVALSEKNRTHIPYRNSMMTAVLRDSLGGNCMTSMVATISIEKRNLMESISTCRFSQRVALIKNEAILNEAVDPQLIIKQLRDQVEQLRLQMQLTDQSEEWQNVELTEDVIRRCRNEVVNFMEENESQISRDILKDYRKINLAFDIMK--ELYQKTKMKISENDFPKYESKLPPIIVPDNPIATKEVIQLREIISQRDNEINILVSLLKKAKKDISE-----RNVSDKSQLNTNVTFVKEDRSDTVPNS-EIPVSEALSRESYIPVPEEEIIKHRILGNLSVGREEAFEVYKNNYPLNSQIISQREELKIKYNQAKELGNAINNARETTNRIKSEISKVRIQQAISADPNQNNENVSLIMTDQEVR--LRHQMEVEKARYKEAYINLKNLKTVIEHMQHLLETSKVKMMKDFEQWWQDQV-------NQMEKSTNIQNVSHQKSP 2238
            MVKQ+IQIY R++PA  +   G Y +  D      L   VP ++   +  NNK+++Y F++ KIFD+ + Q+ +FE +ARPV D+ L GYNGT+FAYGQTGSGKTFTITGGAER++DRGIIPR L Y+FE   KD     +  ISYLEIYNENGYDLL+ +H+ A KLEDL KVTL ED D  V+LKNLS+H A ++E+ALNLLF+GDTNRM+AETPMNQASTRSHCIFT+H+  R+  S  + RSKLHLVDLAGSERV KTGV G LLTEAKYINLSLHYLEQVI+ALSEKNR+H+PYRNSMMT+VLRDSLGGNCMT+M+AT++++KRN+ ESISTCRF+QRVALIKNEAILNE VDP+L+I +L+ +++QLR ++ L       ++++  E  +++    V  ++E+ ++  S ++  D RKI+  F ++K  E   +     SE + P   +        D P +  ++ +L+E++ QRDNEI++LVS+LKK +K + +     + +++     +   +V    S    NS     +  + R++++    E +    + G  S GR+EAF++++ +Y  N  I   +  LK +Y +AK LG  +N AR   N +KS I   R+Q+A        +E +  +     V   LR ++E EK+ YKEA+  LK LKT IEH+QHLLE +K+K+ +DF+ WW  +V       +++ K+T   NV H   P
Sbjct:    1 MVKQTIQIYARLKPA--RRNAGLYSVEEDDGRTPLLEFVVPRDLAEGF-VNNKRESYKFQFKKIFDQQAKQEEIFETIARPVADSVLSGYNGTIFAYGQTGSGKTFTITGGAERFADRGIIPRILGYLFEQFQKDTNRVYTAHISYLEIYNENGYDLLNPRHE-ASKLEDLPKVTLMEDTDQIVHLKNLSLHQASSQEEALNLLFLGDTNRMIAETPMNQASTRSHCIFTLHVCGREPGSTTLCRSKLHLVDLAGSERVSKTGVGGILLTEAKYINLSLHYLEQVIIALSEKNRSHVPYRNSMMTSVLRDSLGGNCMTTMIATLAVDKRNIDESISTCRFAQRVALIKNEAILNEEVDPRLVIVRLKKEIQQLRDELALVTGQPRTEDLDAVE--LQQLEEMVRGYVEDADADASLEVGADMRKIHHCFSLLKVPEGQGRASSGGSERENPSKNN--------DGPGSESDIQRLKELVQQRDNEISVLVSMLKKERKHVQDVGRQLQALTEWVPAQSRDHYVSSSSSFNGTNSASASATNGMRRKTHVTFFLEPV----VYGEKSTGRKEAFDIFRRDYADNITIEDNKYILKQRYAEAKALGETVNQARSKINLLKSNIDHRRMQRAAKG----VSEGLPGVDESDPVEEDLRARIEGEKSSYKEAFTRLKVLKTEIEHLQHLLEKAKLKLQRDFDDWWAGEVARRVSAKHRIYKATASTNVPHDPQP 708          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: TUBA3C (tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:12408])

HSP 1 Score: 318.161 bits (814), Expect = 1.834e-98
Identity = 161/349 (46.13%), Postives = 244/349 (69.91%), Query Frame = -1
Query: 2797 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDG-LAKDQFACGGL-STRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTG 3831
            +E + I++GQAG Q+G++ WEL+  EHGI+ DG +  D+   GG  S  + + ETGA + VPR +FVDLEP+++DE++  +YR LFHP+ L+ G  D++NNY R H  +  +++D VLD++RK  + C+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E +++PAP++S  +VEPYN++L T  +L   + AF++DNEA++DIC+  L ++RP++ N+NRL+ Q+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL T++P+++AE A  + L   ++T   F   +  VKCD  +G+YM+  +L+RGDV   DV  A+  IK++  I+F  WCPTG
Sbjct:    2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG 350          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001139.1 (pep scaffold:Pmarinus_7.0:GL478075:30403:34872:1 gene:ENSPMAG00000001018.1 transcript:ENSPMAT00000001139.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 276.174 bits (705), Expect = 2.172e-83
Identity = 158/355 (44.51%), Postives = 225/355 (63.38%), Query Frame = -1
Query: 2797 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDG---LAKDQFACGGLSTRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTL-----FHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTG 3831
            ++ + I+IGQAG Q+G++ WEL+  EHGI+ DG      D  +    S  + + ETG+ + VPR IF+DLEPS+I E      RTL          +L G    S+   R       K+  +VL + R Q E C+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E  ++PAP++S  +VEPYNA+L T  +L   + +F++DNEA++DIC+ KL +D PS+ N+NRL+AQ+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL T++P+++AE A  + L   ++T   F   +  VKCD  NG+YM+  LL+RGD+   DV  A+ +IKSR  +RF  WCPTG
Sbjct:    3 RDCISIHIGQAGVQMGNACWELYCLEHGIKPDGHLATHPDVTSVVDSSFNTFFSETGSGKHVPRAIFIDLEPSVIGE--PCGLRTLTVGGXLRMSMMLAGREVRSSRIWRGQKGGGRKICSRVLRRNRPQSERCTGLQGFLLFHSFGGGTGSGFTSLLMERLSADYGKKSKLEFCIYPAPQVSTAVVEPYNAILTTHTTLEHSDCSFMVDNEAIYDICRKKLDIDFPSYFNLNRLIAQMVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLTTYAPVISAEKAYHEQLSVAEITNACFEPSNQMVKCDPRNGKYMACCLLYRGDIVPKDVNTAIAIIKSRRAVRFVDWCPTG 355          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: KIF9 (kinesin family member 9 [Source:HGNC Symbol;Acc:HGNC:16666])

HSP 1 Score: 272.322 bits (695), Expect = 2.425e-77
Identity = 215/729 (29.49%), Postives = 366/729 (50.21%), Query Frame = 1
Query:  115 SIQIYLRIRPAEPKFPKGEYEITDSNSGEKLRLKVPLEIDNNYGANNKKDNYSFKYSKIFDKDSLQDSVFEAVARPVIDNFLKGYNGTVFAYGQTGSGKTFTITGGAERYSDRGIIPRALSYIFEHCNKDKTCSTSVQISYLEIYNENGYDLLDAKHDTAQKLEDLNKVTLYEDQDSNVNLKNLSIHSAVNEEDALNLLFVGDTNRMVAETPMNQASTRSHCIFTIHLTTRQ--TDSAVITRSKLHLVDLAGSERVYKTGVDGTLLTEAKYINLSLHYLEQVIVALSEKNRTHIPYRNSMMTAVLRDSLGGNCMTSMVATISIEKRNLMESISTCRFSQRVALIKNEAILNEAVDPQLIIKQLRDQVEQLRLQMQLTDQSEEWQNVE---LTEDVIRRCRNEVVNFMEENESQISRDILKDYRKINLAFDIMKELYQKTKMKISENDFPKY----ESKLPPIIVPDNPIATK-EVIQLREIISQRDN--------EINILVSLLKKAKKD------------ISERNVSDKSQLNTNVTFVKED--RSDTVPNSEIPVSEALSRESYIPVPEEEIIKHRILGNLSVGREEAFEVYKNNYPLNSQIISQREELKIKYNQAK--ELGNAINNARETTNRIKSEISKVRIQQAISADPNQNNEN-------VSLIMTDQEVRLRHQMEVEKARYKEAYINLKNLKTVIEHMQHLLETSKVKMMKDFEQWWQD 2178
             +++ LR RP+ P+F + + +I  ++    +RLK   E +     NN+   +SFK       ++ Q+ V+   AR V+   L GYNGT+  YGQTG+GK++T+TG  E +S+RGIIPR L  +F    +      +V++SYLEIYNE+  DL           + ++K     D+   V++K L+     ++E+AL  LF G+ NR VA   +N+ S+RSHCIFT+++ +R     ++  T SKL+LVDLAGSER+ K   +G +  EA YIN SL +LEQ ++AL+++ R H+P+R S +T VL+D++GGNC T ++A I  E   + E++ST RF+ R+A +    +  E  DPQ  +K L  ++  L+ ++ + D     + V    L E  +   +++V  +++ + ++I+   L + R+I   F   K ++ + + ++  N   K+      K P + V     +T+ EV+   E+  +RD            + +S +  AKK+            IS+R      QL  +  FV E   R   V +    VSE L+R +Y            I G+       AFE +K         I +  +L  K  Q K  EL   IN        +K EI   R  +A+ A   +  E          +++ ++E     +M   +++Y+  Y  L+++K  ++  QH +   + +++ +F  W+ +
Sbjct:    6 CVRVVLRTRPS-PRFAESQIDINPTDKTVNIRLK---EHNQKEIVNNQVTEWSFKVDGSLH-NTNQEMVYRETAREVVSRTLDGYNGTIMCYGQTGAGKSYTMTGSTENFSERGIIPRVLEQVFHDIEERVEQDITVRVSYLEIYNESLCDLC-----AMPACQAIDKQLSIMDERGMVSVKGLTCQLVSSQEEALTKLFEGEMNRAVACHTLNKKSSRSHCIFTLYIESRSKTITNSKYTMSKLNLVDLAGSERLGKATSEGQVEREATYINKSLSFLEQAVIALADRRREHVPFRQSKLTHVLKDAIGGNCNTVLIANIIGETEQIEETLSTLRFAARMACVPVNPVPIELHDPQRTVKDLEKEIRLLKNELAMHDILANRKKVSYEPLLEHQVAEIQSQVRRYLDGSLNEIT---LANVRQIQEVFAQFKVIFLQQEEEVEANLRQKFSLQERRKGPSLDVIQKAGSTENEVVLAGEL--ERDGFGLGLAPTSSKLYLSPVVTAKKNRNKKTLKDSASSISKRERPGSPQLRES-PFVGEGGQREHDVTSVASEVSEQLNRSNYC-----------IYGSTPPMPAVAFEAFKAERGSEINRIFKENKLIYKEKQTKAIELAKHINT-------LKQEIDVAR--EALEAKTKKRQEQGEFMSSEGQMVIDEEEYCFLLRMRELQSQYRLHYEELRDIKAEVQWCQHQVNLCRQRLVSEFGTWYAE 698          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: kif3a (kinesin family member 3A [Source:ZFIN;Acc:ZDB-GENE-050417-71])

HSP 1 Score: 244.588 bits (623), Expect = 1.666e-68
Identity = 144/325 (44.31%), Postives = 196/325 (60.31%), Query Frame = 1
Query:  271 SFKYSKIFDKDSLQDSVFEAVARPVIDNFLKGYNGTVFAYGQTGSGKTFTITGGAERYSDRGIIPRALSYIFEHCNK-DKTCSTSVQISYLEIYNENGYDLLDAKHDTAQKLEDLNKVTLYEDQDSNVNLKNLSIHSAVNEEDALNLLFVGDTNRMVAETPMNQASTRSHCIFTIHL--TTRQTDSAVITR-SKLHLVDLAGSERVYKTGVDGTLLTEAKYINLSLHYLEQVIVALSEKNRTHIPYRNSMMTAVLRDSLGGNCMTSMVATISIEKRNLMESISTCRFSQRVALIKNEAILNEAVDPQ-LIIKQLRDQVEQLRLQM 1230
            +F +  +F  +S Q  V+   ARP++D+ L+GYNGT+FAYGQTG+GKTFT+ G       RGIIP + ++IF H  K +      V++SYLEIYNE   DLL    D  Q+LE      + E  D  V +K+LS     N +D   ++ +G  NR V  T MN+ S+RSH IFTI +  + +  D  +  R  KLHLVDLAGSER  KTG  G  L EA  INLSL  L  VI AL +   TH+PYRNS +T +L+DSLGGN  T M A I     N  E+IST R++ R   IKN+A +NE  DP+  +++Q + ++E L+ ++
Sbjct:   61 TFTFDTVFGTESKQVDVYNLTARPIVDSVLEGYNGTIFAYGQTGTGKTFTMEGIRAVPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVKDLLGK--DQTQRLE------VKERPDVGVYVKDLSAFVVNNADDMDRIMTLGHKNRSVGSTNMNEHSSRSHAIFTITIECSEKGVDGNMHVRMGKLHLVDLAGSERQTKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINE--DPKDALLRQFQKEIEDLKKKL 375          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: TUB3 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; expressed at lower level than Tub1p; TUB3 has a paralog, TUB1, that arose from the whole genome duplication [Source:SGD;Acc:S000004593])

HSP 1 Score: 402.519 bits (1033), Expect = 2.804e-128
Identity = 201/440 (45.68%), Postives = 303/440 (68.86%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDG-----LAKDQFACGGLSTRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E++ IN+GQAGCQ+G++ WEL++ EHGI+ DG     L+K +    G ST   + ETG  +FVPR I+VDLEP++IDE++   ++ LFHP+ L+ G  D++NNY R H  +  +++D+V +++RK  + C GLQG L THS+GGGTGSG  +LL+E L+  Y K  K E +++PAP++S  +VEPYN +L T  +L   +  F++DNEA++DICK  LG+ RPSF N+N L+AQV+S +T  +RF G +  D+ EFQTNLV YPR+HFPL++++PIL+ + A  +     ++T   F   +  VKCD + G+YM+  LL+RGDV   DV+RAV  +K++  ++   WCPTG K+ +     + +  S+LA + ++ CM++N T+I DAW  + +KF+L+Y K+AF+HW+VGEG+EE EF   RE+LA + +DY E  AD
Sbjct:    2 REVISINVGQAGCQIGNACWELYSLEHGIKEDGHLEDGLSKPKGGEEGFST--FFHETGYGKFVPRAIYVDLEPNVIDEVRTGRFKELFHPEQLINGKEDAANNYARGHYTVGREIVDEVEERIRKMADQCDGLQGFLFTHSLGGGTGSGLGSLLLENLSYEYGKKSKLEFAVYPAPQLSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDICKRNLGISRPSFSNLNGLIAQVISSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAPILSKKRATHESNSVSEITNACFEPGNQMVKCDPTKGKYMANCLLYRGDVVTRDVQRAVEQVKNKKTVQMVDWCPTGFKIGICYEPPSVIPSSELANVDRAVCMLSNTTAIADAWKRIDQKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALERDYIEVGAD 439          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: TUB1 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; relative distribution to nuclear foci increases upon DNA replication stress; TUB1 has a paralog, TUB3, that arose from the whole genome duplication [Source:SGD;Acc:S000004550])

HSP 1 Score: 394.045 bits (1011), Expect = 4.590e-125
Identity = 204/440 (46.36%), Postives = 298/440 (67.73%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIR-----NDGLAKDQFACGGLSTRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E++ IN+GQAGCQ+G++ WEL++ EHGI+      DGL+K +    G ST   + ETG  +FVPR I+VDLEP++IDE++   Y+ LFHP+ L+ G  D++NNY R H  +  ++L  VLD++RK  + C GLQG L THS+GGGTGSG  +LL+E+L+  Y K  K E +++PAP++S  +VEPYN +L T  +L   +  F++DNEA++D+CK  L + RPSF N+N L+AQVVS +T  +RF G +  D+ EFQTNLV YPR+HFPL+++SP+L+   A  +     ++T   F   +  VKCD  +G+YM+  LL+RGDV   DV+RAV  +K++  ++   WCPTG K+ +          S LA + ++ CM++N TSI +AW  + RKF+L+Y K+AF+HW+VGEG+EE EF   RE+LA + +DY E  AD
Sbjct:    2 REVISINVGQAGCQIGNACWELYSLEHGIKPDGHLEDGLSKPKGGEEGFST--FFHETGYGKFVPRAIYVDLEPNVIDEVRNGPYKDLFHPEQLISGKEDAANNYARGHYTVGREILGDVLDRIRKLADQCDGLQGFLFTHSLGGGTGSGLGSLLLEELSAEYGKKSKLEFAVYPAPQVSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDMCKRNLDIPRPSFANLNNLIAQVVSSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYSPVLSKSKAFHESNSVSEITNACFEPGNQMVKCDPRDGKYMATCLLYRGDVVTRDVQRAVEQVKNKKTVQLVDWCPTGFKIGICYEPPTATPNSQLATVDRAVCMLSNTTSIAEAWKRIDRKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALERDYIEVGAD 439          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: TUB2 (Beta-tubulin; associates with alpha-tubulin (Tub1p and Tub3p) to form tubulin dimer, which polymerizes to form microtubules; mutation in human ortholog is associated with congenital fibrosis of the extraocular muscles (CFEOM) with polymicrogyria [Source:SGD;Acc:S000001857])

HSP 1 Score: 260.381 bits (664), Expect = 9.118e-77
Identity = 146/431 (33.87%), Postives = 243/431 (56.38%), Query Frame = -1
Query: 2545 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDGLAKDQFACGGLSTRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSRIR--FASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEE 3831
            +EI+ I+ GQ G Q+G+++WE    EHG+  +G                ++E  + ++VPR I VDLEP  ID ++ S+   LF PDN + G   + N + + H     +L+D V+D +R++ E C  LQG   THS+GGGTGSG  TLLI ++ + +P       S+ P+P+ S+ +VEPYNA L+    +   +  F +DNEA++DIC+  L +++PS+G++N LV+ V+SG+TT +R+ GQ+  D+ +   NLV +PRLHF ++ ++P+    +  F  L   ++TQ +F   +     D  NGRY++ A  FRG V + +V   +  ++S+    F  W P  +        Q  V       L  +   +AN TSIQ+ +  V  +F  ++++KAF+HW+  EG++E EF      +  ++ +Y++
Sbjct:    2 REIIHISTGQCGNQIGAAFWETICGEHGLDFNGTYHGHDDIQKERLNVYFNEASSGKWVPRSINVDLEPGTIDAVRNSAIGNLFRPDNYIFGQSSAGNVWAKGHYTEGAELVDSVMDVIRREAEGCDSLQGFQITHSLGGGTGSGMGTLLISKIREEFPDRMMATFSVLPSPKTSDTVVEPYNATLSVHQLVEHSDETFCIDNEALYDICQRTLKLNQPSYGDLNNLVSSVMSGVTTSLRYPGQLNSDLRKLAVNLVPFPRLHFFMVGYAPLTAIGSQSFRSLTVPELTQQMFDAKNMMAAADPRNGRYLTVAAFFRGKVSVKEVEDEMHKVQSKNSDYFVEWIPNNV--------QTAVCSVAPQGLDMAATFIANSTSIQELFKRVGDQFSAMFKRKAFLHWYTSEGMDELEFSEAESNMNDLVSEYQQ 424          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KIP3 (Kinesin-related antiparallel sliding motor protein; involved in mitotic spindle positioning; sliding activity promotes bipolar spindle assembly and maintenance of genome stability; inhibits spindle elongation, destabilizing late anaphase spindle microtubules that polymerize beyond the midzone [Source:SGD;Acc:S000003184])

HSP 1 Score: 183.726 bits (465), Expect = 4.610e-48
Identity = 128/364 (35.16%), Postives = 203/364 (55.77%), Query Frame = 1
Query:  274 FKYSKIFDKDSLQDSVFEAVARPVIDNFLKGYNGTVFAYGQTGSGKTFTITGGAERYSDRGIIPRALSYIFEHCN--KDKTCSTSVQISYLEIYNENGYDLLDAKHDTAQKLEDLNKVTLYEDQDSNVNLKNLSIHSAVNEEDALNLLFVGDTNRMVAETPMNQASTRSHCIFTIHL--TTRQTD-SAVITRSKLHLVDLAGSERVYKTGVDGTLLTEAKYINLSLHYLEQVI--VALSEKNRT-HIPYRNSMMTAVLRDSLGGNCMTSMVATISIEKRNLMESISTCRFSQRVALIKNEAILNEAVDPQLIIKQLRDQVEQLRLQMQLTDQSEEWQNVELT-----EDVIRRCRNEVVNFMEE 1326
            F + K+FD+ S Q  V++    P++D+ L G+N TVFAYG TG GKT+T++G     S  GII  A+  +F      KD+     + +SYLEIYNE   DLL  K +T  K     ++ + ED  +++ + NLS H     ED ++L+  G+ NR  + T  N+ S+RSH +  IH+  T +  D ++  T + L ++DLAGSER   T   G  L E   IN SL  L   I  + L++ +R+ HIPYR+S +T +L+ SLGGNC T M+  IS    +  E+++T +++ R   IK + I N+    + +   L+   EQ R   +L ++ E+  +++LT     ++ I+   NE VN +++
Sbjct:  153 FVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGTP---SQPGIIFLAMEELFNKITDLKDEK-DFEISLSYLEIYNERIRDLL--KPETPSK-----RLVIREDTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTKIIRNQQSLSRHVGSYLKMITEQKRQIEELREREEKMISLKLTKYKLNKEKIQLAINECVNRVQQ 505          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KIP1 (Kinesin-related motor protein; required for mitotic spindle assembly, chromosome segregation, and 2 micron plasmid partitioning; functionally redundant with Cin8p for chromosomal but not plasmid functions [Source:SGD;Acc:S000000159])

HSP 1 Score: 184.882 bits (468), Expect = 9.855e-48
Identity = 130/365 (35.62%), Postives = 201/365 (55.07%), Query Frame = 1
Query:  271 SFKYSKIFDKDSLQDSVFEAVARPVIDNFLKGYNGTVFAYGQTGSGKTFTITGGAERYSD------------RGIIPRALSYIFEHC---NKDKTCSTSVQISYLEIYNENGYDLLDAKHDTAQKLEDLNK-VTLYEDQDSNVN-----LKNLSIHSAVNEEDALNLLFVGDTNRMVAETPMNQASTRSHCIFTIHLTTRQTDSA-------VITRSKLHLVDLAGSERVYKTGVDGTLLTEAKYINLSLHYLEQVIVALSEKNRTHIPYRNSMMTAVLRDSLGGNCMTSMVATISIEKRNLMESISTCRFSQRVALIKNEAILNEAVDPQLIIKQLRDQVEQLRLQMQLTDQSEEWQNVELTED 1281
            ++++ ++F  +S Q++VF A A+  I   L GYN T+FAYGQTG+GKT+T++G      D             GIIPR L  +F+     NK+     SV+IS+LE+YNEN  DLL    D    + D  + + ++++ ++N +     ++ + I+SA    + LNLL  G   R VA T  N  S+RSH +FTI     + DS         +   KL+LVDLAGSE + ++G +     EA  IN SL  L +VI AL + +  HIPYR S +T +L+DSLGG   T ++ATIS  K ++ E+ ST  ++ R   IKN   +N+++     +K    ++E+LR  ++    S   Q + +T+D
Sbjct:  101 TYQFDQVFGAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKE----YSVKISFLELYNENLKDLLSDSEDDDPAVNDPKRQIRIFDNNNNNSSIMVKGMQEIFINSA---HEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVD-HSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQVNQSLSKDTCLKDYIQEIEKLRNDLK---NSRNKQGIFITQD 454          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO32880 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STU5])

HSP 1 Score: 541.962 bits (1395), Expect = 2.894e-180
Identity = 272/493 (55.17%), Postives = 356/493 (72.21%), Query Frame = 1
Query:  103 MVKQSIQIYLRIRPAEPKFPKGEYEITDSNSGEK-LRLKVPLEIDNNYGANNKKDNYSFKYSKIFDKDSLQDSVFEAVARPVIDNFLKGYNGTVFAYGQTGSGKTFTITGGAERYSDRGIIPRALSYIFEHCNKDKTCSTSVQISYLEIYNENGYDLLDAKHDTAQKLEDLNKVTLYEDQDSNVNLKNLSIHSAVNEEDALNLLFVGDTNRMVAETPMNQASTRSHCIFTIHLTTRQTDSAVITRSKLHLVDLAGSERVYKTGVDGTLLTEAKYINLSLHYLEQVIVALSEKNRTHIPYRNSMMTAVLRDSLGGNCMTSMVATISIEKRNLMESISTCRFSQRVALIKNEAILNEAVDPQLIIKQLRDQVEQLRLQMQLTDQSEEWQNVELTEDVIRRCRNEVVNFMEENESQISRDILKDYRKINLAFDIMKELYQKTKMKISENDFPKYESKLPPIIVPDNPIATKEVIQLREIISQRDNEINILVSLLKK 1578
            MVKQ IQIY R++P + K   G YEI + +SG   +   +P E+ + Y  NNK++ Y F+++K+FD+   QD VFE+VA+ V DN L GYNGT+FAYGQTGSGKTFTITGGAERY DRG+IPR LSYIF++  K      +V ISYLEIYNE GYDLLD KH+ A KLEDL KV+L ED D+N++LKNLS+H A NEE+ALN LF+GDTNRM+AETPMNQASTRSHCIFTIH++TR++  A I R+KLHLVDLAGSER+ KTGV G  L EAKYIN+SLH+LEQVIVALSEK+R+HIPYRNSMMT+VLRDSLGGNCMT+M+AT S+EK+N+ ESISTCRF+QRVA+IKN+ +LNE +DP+L+I QL+ +++QL+ ++ +    +E+   +L ++   R R  V +F+E+ +   +  +  D RKI+  F ++K                                   E  +L+E+I QRDNEI+IL   +++
Sbjct:    1 MVKQGIQIYARVKPTKAK--TGTYEIVEDDSGSSVIEYTIPKELSDGY-INNKREVYKFRFNKVFDQKCSQDEVFESVAQGVADNVLSGYNGTIFAYGQTGSGKTFTITGGAERYQDRGLIPRTLSYIFDYFEKHPDNVYTVHISYLEIYNEKGYDLLDPKHE-ASKLEDLPKVSLLEDADNNIHLKNLSLHQANNEEEALNCLFLGDTNRMIAETPMNQASTRSHCIFTIHVSTRESGKATIRRAKLHLVDLAGSERIAKTGVAGIQLAEAKYINVSLHFLEQVIVALSEKSRSHIPYRNSMMTSVLRDSLGGNCMTTMIATCSVEKKNIDESISTCRFAQRVAMIKNDVLLNEEIDPKLMIAQLKREIQQLKAELAMA-TGQEYTG-QLDDNEYDRLRRLVNSFIEDPDPDAALSVGADMRKIDFCFKLLK----------------------------------TETSKLKELIKQRDNEISILCKAMEE 453          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO38091 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDY0])

HSP 1 Score: 410.994 bits (1055), Expect = 6.169e-131
Identity = 204/437 (46.68%), Postives = 304/437 (69.57%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDG-LAKDQFACGGL-STRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + I++GQAG Q+G++ WEL+  EHGI+ DG +  D+   GG  S  + + ETGA + VPR +FVDLEP+++DE++  +YR LFHP+ L+ G  D++NNY R H  +  +L+D VLD++RK  + C+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E +++PAP++S  +VEPYN++L T  +L   + AF++DNEA++DIC+  L ++RP++ N+NRL+ Q+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL T++P+++AE A  + L   ++T   F   +  VKCD  +G+YM+  LL+RGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++ ++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE+LA + KDYEE   D
Sbjct:    2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKELIDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVD 438          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO44804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUT1])

HSP 1 Score: 410.994 bits (1055), Expect = 6.927e-131
Identity = 203/437 (46.45%), Postives = 304/437 (69.57%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDG-LAKDQFACGGL-STRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + I++GQAG Q+G++ WEL+  EHGI+ DG +  D+   GG  S  + + ETGA + VPR +FVDLEP+++DE++  +YR LFHP+ L+ G  D++NNY R H  +  +++D VLD++RK  + C+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E +++PAP++S  +VEPYN++L T  +L   + AF++DNEA++DIC+  L ++RP++ N+NRL+ Q+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL T++P+++AE A  + L   ++T   F   +  VKCD  +G+YM+  LL+RGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++ ++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE+LA + KDYEE   D
Sbjct:    2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVD 438          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO38067 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDY3])

HSP 1 Score: 410.609 bits (1054), Expect = 8.159e-131
Identity = 204/437 (46.68%), Postives = 304/437 (69.57%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDG-LAKDQFACGGL-STRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + I++GQAG Q+G++ WEL+  EHGI+ DG +  D+   GG  S  + + ETGA + VPR +FVDLEP+++DE++  +YR LFHP+ L+ G  D++NNY R H  +  +L+D VLD++RK  + C+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E +++PAP++S  +VEPYN++L T  +L   + AF++DNEA++DIC+  L ++RP++ N+NRL+ Q+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL T++P+++AE A  + L   ++T   F   +  VKCD  +G+YM+  LL+RGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++ ++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE+LA + KDYEE   D
Sbjct:    2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKELIDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLEFAIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVD 438          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO41766 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3G2])

HSP 1 Score: 410.609 bits (1054), Expect = 1.104e-130
Identity = 205/437 (46.91%), Postives = 303/437 (69.34%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDG-LAKDQFACGGL-STRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + I++GQAG Q+G++ WEL+  EHGI+ DG +  D+   GG  S  + + ETGA + VPR +FVDLEP+++DE++  SYR LFHP+ L+ G  D++NNY R H  +  + +D+VLD++RK  + CSGLQG    HS GGGTGSG+ +LL+E+L+  Y K  K E +++PAP +++ +VEPYN++L T  +L   + AF++DNEA++DIC+  L ++RPS+ N+NRL+ Q+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL T++P+++AE A  + L   ++T   F   +  VKCD  +G+YM+  LLFRGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++ ++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE+LA + KDYEE   D
Sbjct:    2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTQGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGSYRQLFHPEQLITGKEDAANNYARGHYTIGKQQVDQVLDRLRKLADQCSGLQGFFIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLEFAVYPAPHIASAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLIGQIVSSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQLVKCDPRHGKYMACCLLFRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVD 438          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: kif6 (kinesin family member 6 [Source:NCBI gene;Acc:101160372])

HSP 1 Score: 544.658 bits (1402), Expect = 3.177e-175
Identity = 279/540 (51.67%), Postives = 389/540 (72.04%), Query Frame = 1
Query:  103 MVKQSIQIYLRIRPAEPKFPKGEYEITDSN-SGEKLRLKVPLEIDNNYGANNKKDNYSFKYSKIFDKDSLQDSVFEAVARPVIDNFLKGYNGTVFAYGQTGSGKTFTITGGAERYSDRGIIPRALSYIFEHCNKDKTCSTSVQISYLEIYNENGYDLLDAKHDTAQKLEDLNKVTLYEDQDSNVNLKNLSIHSAVNEEDALNLLFVGDTNRMVAETPMNQASTRSHCIFTIHLTTRQTDSAVITRSKLHLVDLAGSERVYKTGVDGTLLTEAKYINLSLHYLEQVIVALSEKNRTHIPYRNSMMTAVLRDSLGGNCMTSMVATISIEKRNLMESISTCRFSQRVALIKNEAILNEAVDPQLIIKQLRDQVEQLRLQMQLTDQSEEWQNVELTEDVIRRCRNEVVNFMEENESQISRDILKDYRKINLAFDIMKELYQKTKMKISENDFPKYE-SKLPP-------IIVPD-NPIATKEVIQLREIISQRDNEINILVSLLKKAKKDISERNVSDKSQLNTNVTFVKEDRSDTVPN-SEIP 1689
            MV+Q+IQI+ RI+P     P   + + + + +G  L   +P ++ + +  NNK+++Y F++ K+FD+ + Q+ +FE +ARPV D+ L G+NG +FAYGQTGSGKTFTITGGAERY+DRGIIPR LSY+FE  ++D +   ++ ISYLEIYNE GYDLLD +H+ A +LEDL KV + ED D N++L+NLS+  A NEE+ALNLLF+GDTNRM+AETP+NQASTRSHCIFT+HL  R+  SA + RSKLHLVDLAGS+RV KTG++G LLTEAKYINLSLH+LEQVI+ALSE++R+HIPYRNSM+T+VLRDSLGGNCMT+M+AT++++KRNL ESISTCRF+QRVALIKNEAILNE +DP L+I  L++++  L L+ QL     E ++ +LT D + +    +  F+ + +   +  + +D RK+  +F   K        KI E +  +++ S+ PP       +  P  +P+   +V  L+E++ QRDNEI+ILV +LKK KK   +  V    QL + +T  ++  S ++PN S +P
Sbjct:    1 MVQQTIQIFGRIKPTGK--PAAVFSVDNEDPTGASLDFLLPRDLSDGF-VNNKRESYKFRFKKVFDQHAKQEDIFENIARPVADSVLAGFNGAIFAYGQTGSGKTFTITGGAERYADRGIIPRTLSYLFERFSQDSSTVYTMHISYLEIYNELGYDLLDPRHE-ASRLEDLPKVLIMEDADQNIHLRNLSLQQAANEEEALNLLFLGDTNRMIAETPLNQASTRSHCIFTVHLCRREPGSATLQRSKLHLVDLAGSDRVSKTGLNGVLLTEAKYINLSLHFLEQVILALSERSRSHIPYRNSMLTSVLRDSLGGNCMTTMIATLAVDKRNLDESISTCRFAQRVALIKNEAILNEELDPVLLIAHLKEEI--LTLKKQLATMMGEQKDEQLTADEMLKLEEMIEAFLNDPDPDGTLSLGRDMRKVQHSFSYFKR-------KILEKESERHQCSQQPPAATQREDVYFPHMSPV---DVNSLKEMLQQRDNEISILVKMLKKEKKRADDAAV----QL-SRITDCQKLSSQSLPNYSTVP 519          

HSP 2 Score: 73.559 bits (179), Expect = 1.143e-12
Identity = 46/148 (31.08%), Postives = 76/148 (51.35%), Query Frame = 1
Query: 1768 LSVGREEAFEVYKNNYPLNSQIISQREELKIKYNQAKELGNAINNARETTNRIKSEISKVRIQQA-----ISADPNQNNENVSLIMTDQEVRLRHQMEVEKARYKEAYINLKNLKTVIEHMQHLLETSKVKMMKDFEQWWQDQVNQME 2196
            LS G++EAFE++  ++     I   ++ +K +  +A+ L   +N  R T   ++ ++   R Q A     ++  P +  + V       E  L  Q+  EK  YK A   LK L T IEH+Q LLE  KVK+ KDF++WW  + + ++
Sbjct:  629 LSAGKQEAFEIFIKDHEEQQIIEDHKQLIKKRSAEARTLSEQLNQVRNTIAELRKQLQTRRRQSAAQSVEVNQPPGEKFDPV-------EEELCEQIRREKIVYKSAIGRLKALSTEIEHLQLLLERVKVKIQKDFQKWWTQEASSLQ 769          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: ENSORLT00000020148.2 (protein O-fucosyltransferase 2 [Source:NCBI gene;Acc:100125468])

HSP 1 Score: 414.846 bits (1065), Expect = 1.556e-131
Identity = 205/437 (46.91%), Postives = 304/437 (69.57%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDGLAKDQFACGGL--STRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + +++GQAG Q+G++ WEL+  EHGI+ DG    Q   GG   S  + + ETGA ++VPR IFVDLEP++IDE++  +YR LFHP+ L+ G  D++NNY R H  +  +++D VLD++RK  + C+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E +++PAP++S  +VEPYN++L T  +L   + AF++DNEA++DIC+  L ++RPS+ N+NRL++Q+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL T++PI++AE A  + L   ++T   F   +  VKCD  +G+YM+  LL+RGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++ ++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE++A + KDYEE   D
Sbjct:   34 RECISVHVGQAGVQMGNTCWELYCLEHGIQPDGQMLTQKPIGGHDDSFTTFFSETGAKKYVPRAIFVDLEPTVIDEVRSGTYRQLFHPEQLISGKEDAANNYARGHYTIGREIIDSVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPIISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGID 470          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: ENSORLT00000033163.1 (tubulin alpha-1A chain [Source:NCBI gene;Acc:105354455])

HSP 1 Score: 413.69 bits (1062), Expect = 1.988e-131
Identity = 205/437 (46.91%), Postives = 305/437 (69.79%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDG-LAKDQFACGGL-STRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + I++GQAG Q+G++ WEL+  EHGI+ DG +  D+   GG  S  + + ETGA + VPR +FVDLEP++IDE++  +YR LFHP+ L+ G  D++NNY R H  +  +++D VLD++RK  + C+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E S++PAP++S  +VEPYNA+L T  +L   + AF++DNEA++DIC+  L ++RP++ N+NRL++Q+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL T++P+++AE A  + L   ++T   F   +  VKCD  +G+YM+  LL+RGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++ ++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE++A + KDYEE   D
Sbjct:    2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNAILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVD 438          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: ENSORLT00000020578.2 (tubulin alpha-1A chain [Source:NCBI gene;Acc:105354455])

HSP 1 Score: 413.69 bits (1062), Expect = 1.988e-131
Identity = 205/437 (46.91%), Postives = 305/437 (69.79%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDG-LAKDQFACGGL-STRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + I++GQAG Q+G++ WEL+  EHGI+ DG +  D+   GG  S  + + ETGA + VPR +FVDLEP++IDE++  +YR LFHP+ L+ G  D++NNY R H  +  +++D VLD++RK  + C+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E S++PAP++S  +VEPYNA+L T  +L   + AF++DNEA++DIC+  L ++RP++ N+NRL++Q+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL T++P+++AE A  + L   ++T   F   +  VKCD  +G+YM+  LL+RGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++ ++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE++A + KDYEE   D
Sbjct:    2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNAILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVD 438          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: ENSORLT00000034557.1 (tubulin alpha chain [Source:NCBI gene;Acc:101168810])

HSP 1 Score: 413.305 bits (1061), Expect = 2.887e-131
Identity = 204/437 (46.68%), Postives = 305/437 (69.79%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDG-LAKDQFACGGL-STRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + +++GQAG Q+G++ WEL+  EHGI+ DG +  D+   GG  S  + + ETGA + VPR +FVDLEP++IDE++  +YR LFHP+ L+ G  D++NNY R H  +  +++D VLD++RK  + C+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E S++PAP++S  +VEPYN++L T  +L   + AF++DNEA++DIC+  L ++RPS+ N+NRL++Q+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL T++P+++AE A  + L   ++T   F   +  VKCD  +G+YM+  LL+RGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++ ++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE++A + KDYEE   D
Sbjct:    2 RECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVD 438          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000016386.1 (SMESG000016386.1)

HSP 1 Score: 1475.3 bits (3818), Expect = 0.000e+0
Identity = 715/715 (100.00%), Postives = 715/715 (100.00%), Query Frame = 1
Query:  103 MVKQSIQIYLRIRPAEPKFPKGEYEITDSNSGEKLRLKVPLEIDNNYGANNKKDNYSFKYSKIFDKDSLQDSVFEAVARPVIDNFLKGYNGTVFAYGQTGSGKTFTITGGAERYSDRGIIPRALSYIFEHCNKDKTCSTSVQISYLEIYNENGYDLLDAKHDTAQKLEDLNKVTLYEDQDSNVNLKNLSIHSAVNEEDALNLLFVGDTNRMVAETPMNQASTRSHCIFTIHLTTRQTDSAVITRSKLHLVDLAGSERVYKTGVDGTLLTEAKYINLSLHYLEQVIVALSEKNRTHIPYRNSMMTAVLRDSLGGNCMTSMVATISIEKRNLMESISTCRFSQRVALIKNEAILNEAVDPQLIIKQLRDQVEQLRLQMQLTDQSEEWQNVELTEDVIRRCRNEVVNFMEENESQISRDILKDYRKINLAFDIMKELYQKTKMKISENDFPKYESKLPPIIVPDNPIATKEVIQLREIISQRDNEINILVSLLKKAKKDISERNVSDKSQLNTNVTFVKEDRSDTVPNSEIPVSEALSRESYIPVPEEEIIKHRILGNLSVGREEAFEVYKNNYPLNSQIISQREELKIKYNQAKELGNAINNARETTNRIKSEISKVRIQQAISADPNQNNENVSLIMTDQEVRLRHQMEVEKARYKEAYINLKNLKTVIEHMQHLLETSKVKMMKDFEQWWQDQVNQMEKSTNIQNVSHQKSPPAT 2247
            MVKQSIQIYLRIRPAEPKFPKGEYEITDSNSGEKLRLKVPLEIDNNYGANNKKDNYSFKYSKIFDKDSLQDSVFEAVARPVIDNFLKGYNGTVFAYGQTGSGKTFTITGGAERYSDRGIIPRALSYIFEHCNKDKTCSTSVQISYLEIYNENGYDLLDAKHDTAQKLEDLNKVTLYEDQDSNVNLKNLSIHSAVNEEDALNLLFVGDTNRMVAETPMNQASTRSHCIFTIHLTTRQTDSAVITRSKLHLVDLAGSERVYKTGVDGTLLTEAKYINLSLHYLEQVIVALSEKNRTHIPYRNSMMTAVLRDSLGGNCMTSMVATISIEKRNLMESISTCRFSQRVALIKNEAILNEAVDPQLIIKQLRDQVEQLRLQMQLTDQSEEWQNVELTEDVIRRCRNEVVNFMEENESQISRDILKDYRKINLAFDIMKELYQKTKMKISENDFPKYESKLPPIIVPDNPIATKEVIQLREIISQRDNEINILVSLLKKAKKDISERNVSDKSQLNTNVTFVKEDRSDTVPNSEIPVSEALSRESYIPVPEEEIIKHRILGNLSVGREEAFEVYKNNYPLNSQIISQREELKIKYNQAKELGNAINNARETTNRIKSEISKVRIQQAISADPNQNNENVSLIMTDQEVRLRHQMEVEKARYKEAYINLKNLKTVIEHMQHLLETSKVKMMKDFEQWWQDQVNQMEKSTNIQNVSHQKSPPAT
Sbjct:    1 MVKQSIQIYLRIRPAEPKFPKGEYEITDSNSGEKLRLKVPLEIDNNYGANNKKDNYSFKYSKIFDKDSLQDSVFEAVARPVIDNFLKGYNGTVFAYGQTGSGKTFTITGGAERYSDRGIIPRALSYIFEHCNKDKTCSTSVQISYLEIYNENGYDLLDAKHDTAQKLEDLNKVTLYEDQDSNVNLKNLSIHSAVNEEDALNLLFVGDTNRMVAETPMNQASTRSHCIFTIHLTTRQTDSAVITRSKLHLVDLAGSERVYKTGVDGTLLTEAKYINLSLHYLEQVIVALSEKNRTHIPYRNSMMTAVLRDSLGGNCMTSMVATISIEKRNLMESISTCRFSQRVALIKNEAILNEAVDPQLIIKQLRDQVEQLRLQMQLTDQSEEWQNVELTEDVIRRCRNEVVNFMEENESQISRDILKDYRKINLAFDIMKELYQKTKMKISENDFPKYESKLPPIIVPDNPIATKEVIQLREIISQRDNEINILVSLLKKAKKDISERNVSDKSQLNTNVTFVKEDRSDTVPNSEIPVSEALSRESYIPVPEEEIIKHRILGNLSVGREEAFEVYKNNYPLNSQIISQREELKIKYNQAKELGNAINNARETTNRIKSEISKVRIQQAISADPNQNNENVSLIMTDQEVRLRHQMEVEKARYKEAYINLKNLKTVIEHMQHLLETSKVKMMKDFEQWWQDQVNQMEKSTNIQNVSHQKSPPAT 715          

HSP 2 Score: 65.4698 bits (158), Expect = 2.621e-10
Identity = 50/51 (98.04%), Postives = 51/51 (100.00%), Query Frame = 3
Query: 2292 EYPLIQXXXXXXXXXXXXXXXXXRPDIPLTGDPKVDSDIQRFIAARNKLRQ 2444
            +YPLIQSSRFSSSNSSVWSQSLSRPDIPLTGDPKVDSDIQRFIAARNKLRQ
Sbjct:  716 KYPLIQSSRFSSSNSSVWSQSLSRPDIPLTGDPKVDSDIQRFIAARNKLRQ 766          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000016385.1 (SMESG000016385.1)

HSP 1 Score: 893.264 bits (2307), Expect = 0.000e+0
Identity = 441/441 (100.00%), Postives = 441/441 (100.00%), Query Frame = -1
Query: 2533 MTVELPRPQEIMFINIGQAGCQVGSSYWELFNEEHGIRNDGLAKDQFACGGLSTRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSRIRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3855
            MTVELPRPQEIMFINIGQAGCQVGSSYWELFNEEHGIRNDGLAKDQFACGGLSTRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNKLSDKLLDKVLDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSRIRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD
Sbjct:    1 MTVELPRPQEIMFINIGQAGCQVGSSYWELFNEEHGIRNDGLAKDQFACGGLSTRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNKLSDKLLDKVLDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSRIRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 441          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000079660.1 (SMESG000079660.1)

HSP 1 Score: 415.231 bits (1066), Expect = 3.762e-132
Identity = 207/437 (47.37%), Postives = 303/437 (69.34%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDGLAKDQFACGGLST--RSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + I+IGQAG Q+G+S WEL+  EHGI+ DG    +    G      + + ETG  ++VPR IFVDLEPS+IDE++  SY+ LFHP+ L+ G  D++NNY R H  +  +++D+VL+++RK  + C+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E  ++PAP++S  +VEPYN++L T  +L   ++AF++DNEA+++IC+  LG++RPS+ N+NRL+ QVVS +T  +RF+G +  D+ EFQTNLV YPR+HFPL T++PI++ E A  + L   ++T   F  ++  VKCD  NG+YMS  LL+RGDV   DV  AV +IK+R  I+F  WCPTG K+ +N      V G D+A + ++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE++A + KDYEE   D
Sbjct:    2 RECISIHIGQAGVQMGNSCWELYCLEHGIQQDGQKPSENPKFGNEDCFSTFFSETGNGKYVPRAIFVDLEPSVIDEVRNGSYKELFHPEQLISGKEDAANNYARGHYTVGKEIVDQVLNRIRKVADNCTGLQGFLMFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFGIYPAPQISTAVVEPYNSILTTHTTLEHSDVAFMVDNEAIYEICRKNLGIERPSYTNLNRLIGQVVSSITASLRFEGSLNVDLNEFQTNLVPYPRIHFPLATYAPIISGERAFHEQLSVAEITNSCFEPNNQMVKCDPRNGKYMSCCLLYRGDVVPKDVNAAVNIIKTRKSIQFVDWCPTGFKVGINSQPPTAVPGGDMATVKRAVCMLSNTTAIAEAWARLNHKFDLMYAKRAFVHWYVGEGMEEGEFAEAREDIAALEKDYEEVCID 438          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000009951.1 (SMESG000009951.1)

HSP 1 Score: 414.461 bits (1064), Expect = 6.892e-132
Identity = 206/437 (47.14%), Postives = 305/437 (69.79%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDG-LAKDQFACGGL-STRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + I++GQAG Q+G++ WEL+  EHGI+ DG +  D+   GG  S  + + ETGA + VPR +FVDLEP+++DE++  +YR LFHP+ L+ G  D++NNY R H  +  +++D VLD++RK  + C+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E S++PAP++S  +VEPYN++L T  +L   + AF++DNEA++DIC+  L ++RP++ N+NRLV Q+VS +T  +RF G +  D+ EFQTNLV YPR+HFPL TF+P+++AE A  + L   ++T   F   +  VKCD  +G+YM+  +L+RGDV   DV  A+  IK++  I+F  WCPTG K+ +N      V G DLA++ ++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE+LA + KDYEE  AD
Sbjct:    2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSVYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLVGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATFAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGAD 438          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000017700.1 (SMESG000017700.1)

HSP 1 Score: 409.838 bits (1052), Expect = 3.366e-130
Identity = 204/438 (46.58%), Postives = 303/438 (69.18%), Query Frame = -1
Query: 2533 QEIMFINIGQAGCQVGSSYWELFNEEHGIRNDGL---AKDQFACGGLSTRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCGILDSSNNYGRAHNXXXXXXXXXXXDQVRKQFELCSGLQGMLCTHSIGGGTGSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASLSEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFKGQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDLFRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSR--IRFASWCPTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFELLYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD 3831
            +E + ++IGQAG Q+G++ WEL+  EHGI+ DG     K QF        + + + G  +FVPR IFVDLEPS+IDE++  SYR LFHP+ L+ G  D++NNY R H  +  +++D+V D++RK  + C+GLQG L  HS GGGTGSG+ +LL+E+L+  Y K  K E +++PAP++S  +VEPYN++L T  +L   ++AF++DNEA++DIC  KLG++RP++ N+N+++ QVVS +T  +RF G +  D+ EFQTNLV YPR+HFPL T++PI++A+ A  + L   ++T   F   +  VKCD  +G+YMS  LL+RGDV   DV  A++ IKS+  I+F  WCPTG K+ +N      V G DLA++ ++ CM++N T+I +AW  +  KF+L+Y K+AF+HW+VGEG+EE EF   RE++A + +DYEE   D
Sbjct:    2 RECISVHIGQAGVQMGNACWELYCLEHGIQQDGQMPSEKPQFG-NEDCFNTFFSDCGNGKFVPRAIFVDLEPSVIDEVRTGSYRQLFHPEQLVSGKEDAANNYARGHYTIGKEIIDQVSDRIRKMADNCTGLQGFLIFHSFGGGTGSGFTSLLMEKLSVDYGKKSKLEFAVYPAPQVSTAVVEPYNSILTTHTTLEHSDVAFMVDNEAIYDICSRKLGIERPTYTNLNKIIGQVVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLATYAPIISADKAFHEQLSVSEITNSCFEPSNQMVKCDPRHGKYMSCCLLYRGDVVPKDVNAAISFIKSKKTIQFVDWCPTGFKVGINSQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLNHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDIAALERDYEEVGID 438          
The following BLAST results are available for this feature:
BLAST of Kinesin-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIF60.000e+049.10kinesin family member 6 [Source:HGNC Symbol;Acc:HG... [more]
KIF61.064e-17448.94kinesin family member 6 [Source:HGNC Symbol;Acc:HG... [more]
TUBA1C5.042e-13146.68tubulin alpha 1c [Source:HGNC Symbol;Acc:HGNC:2076... [more]
TUBA3C5.321e-13146.45tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:1240... [more]
TUBA3D5.321e-13146.45tubulin alpha 3d [Source:HGNC Symbol;Acc:HGNC:2407... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tba-44.507e-13647.60Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:... [more]
tba-28.185e-13547.37Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Pro... [more]
tba-28.185e-13547.37Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Pro... [more]
tba-28.185e-13547.37Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Pro... [more]
tba-16.150e-13447.13Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alphaTub84B7.486e-13146.22gene:FBgn0003884 transcript:FBtr0081639[more]
alphaTub85E1.519e-12946.22gene:FBgn0003886 transcript:FBtr0082087[more]
alphaTub84D1.992e-12946.00gene:FBgn0003885 transcript:FBtr0081538[more]
alphaTub67C2.353e-12043.08gene:FBgn0087040 transcript:FBtr0076393[more]
CG77944.256e-9439.08gene:FBgn0038565 transcript:FBtr0083540[more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif60.000e+046.96kinesin family member 6 [Source:ZFIN;Acc:ZDB-GENE-... [more]
tuba4l2.505e-13247.71tubulin, alpha 4 like [Source:ZFIN;Acc:ZDB-GENE-03... [more]
tuba4l5.474e-13247.71tubulin, alpha 4 like [Source:ZFIN;Acc:ZDB-GENE-03... [more]
tuba8l4.156e-13146.68tubulin, alpha 8 like [Source:ZFIN;Acc:ZDB-GENE-03... [more]
tuba1b4.243e-13147.14tubulin, alpha 1b [Source:ZFIN;Acc:ZDB-GENE-030822... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif60.000e+048.97kinesin family member 6 [Source:NCBI gene;Acc:1001... [more]
kif60.000e+046.69kinesin family member 6 [Source:NCBI gene;Acc:1001... [more]
kif60.000e+047.67kinesin family member 6 [Source:NCBI gene;Acc:1001... [more]
kif62.996e-17257.74kinesin family member 6 [Source:NCBI gene;Acc:1001... [more]
tuba1c7.075e-13247.14tubulin alpha 1c [Source:NCBI gene;Acc:394675][more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kif60.000e+048.62kinesin family member 6 [Source:MGI Symbol;Acc:MGI... [more]
Tuba1c2.644e-13146.91tubulin, alpha 1C [Source:MGI Symbol;Acc:MGI:10954... [more]
Tuba3a3.653e-13146.45tubulin, alpha 3A [Source:MGI Symbol;Acc:MGI:10954... [more]
Tuba3b3.653e-13146.45tubulin, alpha 3B [Source:MGI Symbol;Acc:MGI:10954... [more]
Tuba1b7.879e-13146.68tubulin, alpha 1B [Source:MGI Symbol;Acc:MGI:10780... [more]
back to top
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6ZMV9|KIF6_HUMAN0.000e+049.10Kinesin-like protein KIF6 OS=Homo sapiens OX=9606 ... [more]
sp|P34690|TBA2_CAEEL1.041e-13347.37Tubulin alpha-2 chain OS=Caenorhabditis elegans OX... [more]
sp|P91910|TBA3_CAEEL8.431e-13347.37Tubulin alpha-3 chain OS=Caenorhabditis elegans OX... [more]
sp|P50719|TBA_HAECO2.331e-13247.14Tubulin alpha chain OS=Haemonchus contortus OX=628... [more]
sp|Q6AYZ1|TBA1C_RAT6.101e-13147.14Tubulin alpha-1C chain OS=Rattus norvegicus OX=101... [more]
back to top
BLAST of Kinesin-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S1HFL70.000e+051.72Kinesin-like protein OS=Elysia chlorotica OX=18847... [more]
A0A210Q4830.000e+053.24Kinesin-like protein OS=Mizuhopecten yessoensis OX... [more]
A0A267EM160.000e+048.70Kinesin-like protein (Fragment) OS=Macrostomum lig... [more]
A0A3M7QED80.000e+051.41Kinesin-like protein OS=Brachionus plicatilis OX=1... [more]
A0A267G5D00.000e+048.02Kinesin-like protein (Fragment) OS=Macrostomum lig... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000025205.21.019e-13247.25tubulin alpha-8 chain-like [Source:NCBI gene;Acc:1... [more]
tuba1a1.406e-13147.14tubulin alpha chain [Source:NCBI gene;Acc:10303797... [more]
tuba8l21.570e-13146.45tubulin alpha chain-like [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000019222.24.957e-13146.68tubulin alpha-1 chain [Source:NCBI gene;Acc:103031... [more]
ENSAMXT00000030346.16.187e-13146.68tubulin alpha-1B chain [Source:NCBI gene;Acc:11119... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif60.000e+047.81kinesin family member 6 [Source:ZFIN;Acc:ZDB-GENE-... [more]
TUBA3C1.834e-9846.13tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:1240... [more]
ENSPMAT00000001139.12.172e-8344.51pep scaffold:Pmarinus_7.0:GL478075:30403:34872:1 g... [more]
KIF92.425e-7729.49kinesin family member 9 [Source:HGNC Symbol;Acc:HG... [more]
kif3a1.666e-6844.31kinesin family member 3A [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TUB32.804e-12845.68Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB14.590e-12546.36Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB29.118e-7733.87Beta-tubulin; associates with alpha-tubulin (Tub1p... [more]
KIP34.610e-4835.16Kinesin-related antiparallel sliding motor protein... [more]
KIP19.855e-4835.62Kinesin-related motor protein; required for mitoti... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO328802.894e-18055.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380916.169e-13146.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448046.927e-13146.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380678.159e-13146.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417661.104e-13046.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif63.177e-17551.67kinesin family member 6 [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000020148.21.556e-13146.91protein O-fucosyltransferase 2 [Source:NCBI gene;A... [more]
ENSORLT00000033163.11.988e-13146.91tubulin alpha-1A chain [Source:NCBI gene;Acc:10535... [more]
ENSORLT00000020578.21.988e-13146.91tubulin alpha-1A chain [Source:NCBI gene;Acc:10535... [more]
ENSORLT00000034557.12.887e-13146.68tubulin alpha chain [Source:NCBI gene;Acc:10116881... [more]
back to top
BLAST of Kinesin-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016386.12.621e-10100.00SMESG000016386.1[more]
SMESG000016385.10.000e+0100.00SMESG000016385.1[more]
SMESG000079660.13.762e-13247.37SMESG000079660.1[more]
SMESG000009951.16.892e-13247.14SMESG000009951.1[more]
SMESG000017700.13.366e-13046.58SMESG000017700.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014094 ID=SMED30014094|Name=Kinesin-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4131bp
ATTTATCCTAGAGAATTATTATTCGTACTTATGAATTTAATTATTTTTTA
TTTTATATTATTCTCAAGATAATTAACTTGATTTTAAGTTATACCTTTAA
ACATGGTTAAACAATCTATTCAAATCTATTTACGAATTCGTCCTGCTGAA
CCAAAATTTCCAAAAGGAGAATATGAAATAACTGACAGTAATTCCGGAGA
GAAATTACGATTGAAAGTTCCGCTTGAAATCGATAACAATTATGGGGCAA
ATAATAAAAAGGACAATTATTCCTTTAAATATTCGAAAATTTTTGACAAA
GACAGCTTACAGGATTCGGTTTTTGAGGCTGTTGCTAGGCCAGTCATTGA
TAATTTTCTGAAAGGTTACAACGGTACAGTATTCGCTTATGGTCAAACTG
GGAGCGGTAAAACGTTTACGATAACCGGTGGCGCCGAACGTTACTCCGAT
CGAGGCATTATTCCTCGAGCATTATCATACATTTTTGAGCACTGCAATAA
AGACAAAACATGCAGCACATCTGTGCAAATTTCTTATTTGGAAATATACA
ATGAAAATGGATACGATCTTCTCGATGCAAAGCACGACACAGCACAGAAA
CTCGAAGATCTGAACAAAGTCACACTTTATGAAGACCAGGATTCCAATGT
GAATTTAAAGAATTTATCAATACACTCGGCCGTCAATGAGGAAGATGCAC
TAAATTTATTATTTGTCGGAGATACGAACCGTATGGTTGCTGAAACTCCA
ATGAACCAGGCTTCCACAAGATCTCATTGCATTTTTACTATTCATCTAAC
TACACGACAGACCGATTCCGCAGTTATCACAAGATCGAAATTGCATCTTG
TTGACTTGGCCGGATCTGAACGAGTTTATAAAACTGGAGTTGATGGCACA
TTACTTACTGAGGCCAAATACATCAATTTGTCATTGCATTATCTTGAGCA
AGTCATTGTCGCCCTATCAGAGAAAAATCGCACTCATATCCCGTACCGAA
ACAGTATGATGACAGCCGTTTTGAGAGACAGCCTAGGTGGCAACTGTATG
ACTTCCATGGTCGCTACAATTAGCATTGAAAAGAGAAATTTGATGGAGTC
AATTTCAACATGCAGATTTTCACAGAGAGTTGCACTTATAAAAAATGAAG
CTATTTTGAATGAAGCTGTTGATCCACAATTGATTATCAAACAACTACGA
GATCAGGTAGAACAACTTCGACTCCAAATGCAATTAACAGATCAGTCTGA
AGAATGGCAGAATGTTGAGTTGACCGAAGACGTGATCAGAAGATGCAGGA
ATGAAGTTGTAAATTTTATGGAAGAAAACGAATCGCAGATTTCCAGGGAT
ATCCTCAAGGATTACAGAAAAATTAATCTTGCTTTTGATATCATGAAGGA
ATTGTATCAAAAGACTAAAATGAAAATATCTGAAAATGACTTTCCTAAAT
ATGAATCCAAGCTGCCTCCTATTATTGTTCCTGATAATCCTATCGCTACG
AAAGAAGTTATACAATTGAGAGAAATAATTTCTCAGAGAGATAATGAAAT
TAATATACTCGTTTCTTTATTGAAAAAAGCAAAAAAAGATATTTCTGAAC
GAAATGTTTCAGATAAATCTCAACTAAATACGAATGTGACTTTTGTGAAA
GAAGATAGATCTGATACGGTACCAAACTCTGAAATCCCAGTTTCAGAGGC
TCTTTCTAGAGAATCATATATTCCGGTTCCGGAAGAGGAAATTATTAAAC
ACAGAATATTGGGCAACCTATCGGTGGGTCGAGAAGAAGCCTTTGAGGTT
TATAAAAACAACTATCCATTGAACTCCCAAATCATATCTCAAAGAGAAGA
ACTGAAAATCAAATACAACCAAGCGAAAGAACTCGGAAATGCAATAAACA
ATGCCAGAGAAACGACAAATAGAATAAAATCCGAAATCAGTAAAGTTCGA
ATTCAGCAAGCGATTTCGGCGGATCCAAATCAAAATAATGAAAATGTCTC
ATTGATAATGACCGATCAAGAGGTCCGATTGAGACATCAAATGGAGGTTG
AAAAAGCCCGCTATAAAGAGGCATACATCAACCTGAAAAATTTAAAAACT
GTAATTGAGCATATGCAGCATCTGTTGGAGACTTCTAAAGTCAAAATGAT
GAAAGACTTCGAACAGTGGTGGCAAGATCAGGTAAATCAGATGGAGAAAT
CAACAAATATTCAGAACGTTTCCCATCAAAAGTCTCCTCCGGCCACAAGT
AAGGATTTGTAATTTCATTTATATTTTGATTTACAAAATTAGAATATCCC
TTAATCCAATCGTCGAGATTTAGTTCGTCGAATTCATCAGTATGGAGTCA
GTCTCTATCGAGGCCAGACATTCCATTGACTGGAGATCCAAAGGTGGATT
CGGATATCCAGCGATTCATAGCAGCAAGGAATAAATTACGCCAATAAAGT
CAAATAAAATCATATCAACTCATTTCATTTTTTTATTGAATAAAAAATGA
AATTTTATATTTTTTCTGTGTTTCAAATTTTAATCCGCTGATGCTTCCTC
ATAATCTTTCATCATGTAAGCTAGCTCTTCTCGGCACAATTGGAATTCGT
TTTCTTCTACTCCTTCACCGACAAACCAATGAATAAACGCTTTTTTACGG
TAGAGTAACTCAAATTTCCTAATCACTGTGCCCCACGCATCTTGTATCGA
TGTATGATTGGCCACCATGCAACAGGACTTTGGCAAACGCGCCAAATCTG
ATCCAGATACCTGGGCTTGCTTGGAATCATTTAGATCGAGTTTAATTCCT
GTTGGGCACCAGCTGGCGAATCTAATTCGGCTTTTAATTAGAGTCACTGC
TCTTCGTACATCAAGTAAATCTACGTCCCCGCGAAATAGTAAAGCAGCAC
TCATGTATCGACCATTCGATAAATCACACTTAACGAAACTGTGATCCCAG
CGAAATAAATCCTGCGTCATGTCATCTGTTTTCAACAAGTCAAATCTTGC
GTTTTCTGCGGTCAAAATCGGACTGAATGTAATCAAAGGAAAGTGTAATC
GAGGATAGGCTACCAAATTCGTTTGAAACTCAATCATATCTCCTTGCATT
TGCCCTTTAAACCTAATTGGAGTAGTAAGGCCACTAACTACTTGTGCTAC
AAGGCGATTTATGTTTCCAAATGAAGGTCTATCAACCCCGAGTTTTACCT
TACATATATCCCACACTGCTTCATTGTCCATTATAAAGGCTAATTCTATT
TCTGATAAACTCGCAGATGTAGCTAAAAGAGCATTGTAAGGTTCTACTAG
AATATTAGACATTCTAGGAGCAGGAAAAAGAGACAATTCAAATTTAAAGG
TTTTCGGATAAAGTTGATTGAGTTGTTCAATAAGAAGAGTAAAATATCCG
GATCCAGTTCCGCCACCAATGCTATGTGTACATAGCATTCCTTGAAGTCC
GCTACATAGTTCAAATTGTTTCCTAACCTGGTCAAGAACTTTATCCAATA
ATTTGTCACTTAATTTATTATGAGCTCTACCGTAATTGTTGGAGGAGTCT
AATATTCCGCAAAGTAAATTGTCAGGGTGAAAGAGAGTCCTATATGAGCT
CCTTTTAATTTCATCAATAATTGACGGCTCCAAATCAACGAATATGCATC
TTGGTACAAAACGATAAGCACCGGTTTCATCATAGATAGATCTTGTCGAG
AGTCCTCCACAAGCGAATTGGTCTTTAGCTAATCCATCATTTCTTATTCC
ATGTTCCTCATTAAATAACTCCCAATAACTGGAACCCACTTGGCATCCAG
CTTGTCCGATATTAATAAACATTATTTCCTGTGGCCTGGGTAATTCTACT
GTCATGGTTTAATTTCAATTTTAAAATAATTAAAATCAATAAAAACCGCT
AAAAATGTCGAAAAATGTCGAAAAATCGCCTATTGGTCACACACAAGCAC
AAAATACCTATATAAGTCCAGGTCGCGTGCTTTTTCAAAGTTTTCTTCTG
AATCGTATGGCACTTTTAAGTCCAGAATATGGATATCTTTGTTCCTTTTG
GATTTAATTACCATATCGGGTTTCAGTTTTGTCGGATTTGATATATATAT
TTTAGTGATTGTTCCACATCCACCTCAAATC
back to top

protein sequence of SMED30014094-orf-1

>SMED30014094-orf-1 ID=SMED30014094-orf-1|Name=SMED30014094-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=442bp
MTVELPRPQEIMFINIGQAGCQVGSSYWELFNEEHGIRNDGLAKDQFACG
GLSTRSIYDETGAYRFVPRCIFVDLEPSIIDEIKRSSYRTLFHPDNLLCG
ILDSSNNYGRAHNKLSDKLLDKVLDQVRKQFELCSGLQGMLCTHSIGGGT
GSGYFTLLIEQLNQLYPKTFKFELSLFPAPRMSNILVEPYNALLATSASL
SEIELAFIMDNEAVWDICKVKLGVDRPSFGNINRLVAQVVSGLTTPIRFK
GQMQGDMIEFQTNLVAYPRLHFPLITFSPILTAENARFDLLKTDDMTQDL
FRWDHSFVKCDLSNGRYMSAALLFRGDVDLLDVRRAVTLIKSRIRFASWC
PTGIKLDLNDSKQAQVSGSDLARLPKSCCMVANHTSIQDAWGTVIRKFEL
LYRKKAFIHWFVGEGVEENEFQLCREELAYMMKDYEEASAD*
back to top

protein sequence of SMED30014094-orf-2

>SMED30014094-orf-2 ID=SMED30014094-orf-2|Name=SMED30014094-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=720bp
MVKQSIQIYLRIRPAEPKFPKGEYEITDSNSGEKLRLKVPLEIDNNYGAN
NKKDNYSFKYSKIFDKDSLQDSVFEAVARPVIDNFLKGYNGTVFAYGQTG
SGKTFTITGGAERYSDRGIIPRALSYIFEHCNKDKTCSTSVQISYLEIYN
ENGYDLLDAKHDTAQKLEDLNKVTLYEDQDSNVNLKNLSIHSAVNEEDAL
NLLFVGDTNRMVAETPMNQASTRSHCIFTIHLTTRQTDSAVITRSKLHLV
DLAGSERVYKTGVDGTLLTEAKYINLSLHYLEQVIVALSEKNRTHIPYRN
SMMTAVLRDSLGGNCMTSMVATISIEKRNLMESISTCRFSQRVALIKNEA
ILNEAVDPQLIIKQLRDQVEQLRLQMQLTDQSEEWQNVELTEDVIRRCRN
EVVNFMEENESQISRDILKDYRKINLAFDIMKELYQKTKMKISENDFPKY
ESKLPPIIVPDNPIATKEVIQLREIISQRDNEINILVSLLKKAKKDISER
NVSDKSQLNTNVTFVKEDRSDTVPNSEIPVSEALSRESYIPVPEEEIIKH
RILGNLSVGREEAFEVYKNNYPLNSQIISQREELKIKYNQAKELGNAINN
ARETTNRIKSEISKVRIQQAISADPNQNNENVSLIMTDQEVRLRHQMEVE
KARYKEAYINLKNLKTVIEHMQHLLETSKVKMMKDFEQWWQDQVNQMEKS
TNIQNVSHQKSPPATSKDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR036961Kinesin_motor_dom_sf
IPR027640Kinesin-like_fam
IPR002452Alpha_tubulin
IPR000217Tubulin
IPR003008Tubulin_FtsZ_GTPase
IPR018316Tubulin/FtsZ_2-layer-sand-dom
IPR023123Tubulin_C
IPR017975Tubulin_CS
IPR008280Tub_FtsZ_C
IPR001752Kinesin_motor_dom
IPR019821Kinesin_motor_CS
IPR027417P-loop_NTPase
Vocabulary: cellular component
TermDefinition
GO:0005874microtubule
Vocabulary: biological process
TermDefinition
GO:0007017microtubule-based process
GO:0007018microtubule-based movement
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0005200structural constituent of cytoskeleton
GO:0003924GTPase activity
GO:0003777microtubule motor activity
GO:0008017microtubule binding
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0003774motor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 574..594
NoneNo IPR availableCOILSCoilCoilcoord: 362..382
NoneNo IPR availablePANTHERPTHR24115:SF194KINESIN-LIKE PROTEIN KIF6coord: 8..699
IPR001752Kinesin motor domainPRINTSPR00380KINESINHEAVYcoord: 88..109
score: 71.44
coord: 296..317
score: 54.66
coord: 215..232
score: 50.69
coord: 246..264
score: 61.89
IPR001752Kinesin motor domainSMARTSM00129kinesin_4coord: 3..354
e-value: 1.6E-118
score: 409.7
IPR001752Kinesin motor domainPFAMPF00225Kinesincoord: 44..344
e-value: 4.7E-97
score: 324.9
IPR001752Kinesin motor domainPROSITEPS50067KINESIN_MOTOR_2coord: 5..346
score: 110.561
IPR036961Kinesin motor domain superfamilyGENE3DG3DSA:3.40.850.10coord: 1..377
e-value: 5.1E-115
score: 385.9
IPR027640Kinesin-like proteinPANTHERPTHR24115FAMILY NOT NAMEDcoord: 8..699
IPR019821Kinesin motor domain, conserved sitePROSITEPS00411KINESIN_MOTOR_1coord: 245..256
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 5..383