Opioid-binding protein/cell adhesion molecule

Overview
NameOpioid-binding protein/cell adhesion molecule
Smed IDSMED30014091
Length (bp)1664
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Opioid-binding protein/cell adhesion molecule (SMED30014091) t-SNE clustered cells

Violin plots show distribution of expression levels for Opioid-binding protein/cell adhesion molecule (SMED30014091) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Opioid-binding protein/cell adhesion molecule (SMED30014091) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Opioid-binding protein/cell adhesion molecule (SMED30014091) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014091

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30014091SMESG000026220.1 Contig47956newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014091SMESG000026220.1 Contig47956uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014091SMESG000026220.1 Contig30306newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014091SMESG000026220.1 Contig30306uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30014091SMESG000026220.1 dd_Smed_v6_5005_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30014091SMESG000026220.1 OX_Smed_1.0.13655ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
glial cellSMED30014091SMESG000026220.1 dd_Smed_v6_5005_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014091SMESG000026220.1 Contig810newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014091SMESG000026220.1 Contig810uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014091SMESG000026745.1 Contig810newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014091SMESG000026745.1 Contig810uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30014091SMESG000026220.1 dd_Smed_v4_5005_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014091SMESG000026220.1 dd_Smed_v4_5005_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30014091SMESG000026220.1 dd_Smed_v4_5005_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30014091SMESG000026220.1 dd_Smed_v4_5005_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014091SMESG000026220.1 dd_Smed_v4_5005_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014091SMESG000026220.1 dd_Smed_v4_5005_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30014091SMESG000026220.1 dd_Smed_v4_5005_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014091SMESG000026220.1 Contig34015newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014091SMESG000026220.1 Contig34015uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014091SMESG000026220.1 Contig33547newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Human
Match: ICAM5 (intercellular adhesion molecule 5 [Source:HGNC Symbol;Acc:HGNC:5348])

HSP 1 Score: 60.8474 bits (146), Expect = 4.498e-9
Identity = 68/290 (23.45%), Postives = 126/290 (43.45%), Query Frame = 3
Query:  114 VKLGSKIDICCTIQSTQGDGLAILAGDIRIKMLIKGDVIEQDINAFKSKNPSYTVERKNDILCMVKEISEKEDDKFSFKCIILEKGFGKSLNEETHKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIWRTESNPNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDL--GFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILK 977
            +++GS+  + CT+     DGL   A + R+ + + GD         ++ +P  T+E    +       S +++      C +     G    E    + IY     +  L+E  V+  G+ +   C AAG+  L  +   E  P    G P A+LQ+N  T   +   + C+A++ +  GE    N+S  L + + P++D            G E+T R + +GNP+P + C               +D  + +    +  +T+   GTY+C   N++G+A K V+L ++
Sbjct:  239 LEVGSERPVSCTL-----DGL-FPASEARVYLAL-GD---------QNLSPDVTLEGDAFVATATATASAEQEGARQLVCNVT---LGGENRETRENVTIYSFPAPLLTLSEPSVSE-GQMVTVTC-AAGAQALVTL---EGVPAAVPGQP-AQLQLN-ATENDDRRSFFCDATLDV-DGETLIKNRSAELRVLYAPRLDDSDCPRSWTWPEGPEQTLRCEARGNPEPSVHC-------------ARSDGGAVLALGLLGPVTRALSGTYRCKAANDQGEAVKDVTLTVE 488          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Human
Match: TTN (titin [Source:HGNC Symbol;Acc:HGNC:12403])

HSP 1 Score: 52.7582 bits (125), Expect = 2.362e-6
Identity = 51/206 (24.76%), Postives = 90/206 (43.69%), Query Frame = 3
Query:  396 THKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIW-RTES------NPNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQF-----SYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILK 977
            + ++ + E  KF+KKL    VA+ GE ++ EC  +GSP++KV W R +S        N++  +  A L IN  +AE +G  Y CEA   +     G  + S  L ++  P    +   +    G +   + ++ G P      P   +  +    + ++ +F      +   + I  +   ++G Y C   NE G  T   S+  K
Sbjct: 7282 SAQLSVKEPPKFVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSG-DYICEAHNGV-----GDASCSTALTVKAPPVFTQKPSPVGALKGSDVILQCEISGTP------PFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFK 7475          

HSP 2 Score: 51.6026 bits (122), Expect = 5.350e-6
Identity = 62/248 (25.00%), Postives = 107/248 (43.15%), Query Frame = 3
Query:  285 KNDILCMVKEISEKEDDKFSFKCIILEKGFGKSLNEETHKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIWRTESNP-------NVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKP----QIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILK-PANLI 992
            K+D    ++  + K  D  ++ C  L    G + ++ T  + + E  +FIKK +   V R G+    EC   G+P ++V W  + N         ++     A  QI+    E +G  Y CEA     + + GT + SI L ++  P    ++    ++ ++D+  E     +V G P  ++     N         T TD+ S ++ + I K    + G YQC V NE G  +    + LK P + I
Sbjct: 5745 KDDTSTSLELFAAKATDSGTYICQ-LSNDVGTATSKAT--LFVKEPPQFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGT-YVCEA-----RNDAGTASCSIELKVKEPPTFIRELKPVEVVKYSDVELE----CEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVS-VFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPSFI 5978          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Human
Match: TTN (titin [Source:HGNC Symbol;Acc:HGNC:12403])

HSP 1 Score: 52.7582 bits (125), Expect = 2.362e-6
Identity = 51/206 (24.76%), Postives = 90/206 (43.69%), Query Frame = 3
Query:  396 THKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIW-RTES------NPNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQF-----SYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILK 977
            + ++ + E  KF+KKL    VA+ GE ++ EC  +GSP++KV W R +S        N++  +  A L IN  +AE +G  Y CEA   +     G  + S  L ++  P    +   +    G +   + ++ G P      P   +  +    + ++ +F      +   + I  +   ++G Y C   NE G  T   S+  K
Sbjct: 7282 SAQLSVKEPPKFVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSG-DYICEAHNGV-----GDASCSTALTVKAPPVFTQKPSPVGALKGSDVILQCEISGTP------PFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFK 7475          

HSP 2 Score: 51.6026 bits (122), Expect = 5.350e-6
Identity = 62/248 (25.00%), Postives = 107/248 (43.15%), Query Frame = 3
Query:  285 KNDILCMVKEISEKEDDKFSFKCIILEKGFGKSLNEETHKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIWRTESNP-------NVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKP----QIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILK-PANLI 992
            K+D    ++  + K  D  ++ C  L    G + ++ T  + + E  +FIKK +   V R G+    EC   G+P ++V W  + N         ++     A  QI+    E +G  Y CEA     + + GT + SI L ++  P    ++    ++ ++D+  E     +V G P  ++     N         T TD+ S ++ + I K    + G YQC V NE G  +    + LK P + I
Sbjct: 5745 KDDTSTSLELFAAKATDSGTYICQ-LSNDVGTATSKAT--LFVKEPPQFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGT-YVCEA-----RNDAGTASCSIELKVKEPPTFIRELKPVEVVKYSDVELE----CEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVS-VFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPSFI 5978          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Human
Match: TTN (titin [Source:HGNC Symbol;Acc:HGNC:12403])

HSP 1 Score: 52.373 bits (124), Expect = 2.465e-6
Identity = 51/206 (24.76%), Postives = 90/206 (43.69%), Query Frame = 3
Query:  396 THKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIW-RTES------NPNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQF-----SYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILK 977
            + ++ + E  KF+KKL    VA+ GE ++ EC  +GSP++KV W R +S        N++  +  A L IN  +AE +G  Y CEA   +     G  + S  L ++  P    +   +    G +   + ++ G P      P   +  +    + ++ +F      +   + I  +   ++G Y C   NE G  T   S+  K
Sbjct: 6355 SAQLSVKEPPKFVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSG-DYICEAHNGV-----GDASCSTALTVKAPPVFTQKPSPVGALKGSDVILQCEISGTP------PFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFK 6548          

HSP 2 Score: 51.2174 bits (121), Expect = 5.488e-6
Identity = 62/248 (25.00%), Postives = 107/248 (43.15%), Query Frame = 3
Query:  285 KNDILCMVKEISEKEDDKFSFKCIILEKGFGKSLNEETHKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIWRTESNP-------NVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKP----QIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILK-PANLI 992
            K+D    ++  + K  D  ++ C  L    G + ++ T  + + E  +FIKK +   V R G+    EC   G+P ++V W  + N         ++     A  QI+    E +G  Y CEA     + + GT + SI L ++  P    ++    ++ ++D+  E     +V G P  ++     N         T TD+ S ++ + I K    + G YQC V NE G  +    + LK P + I
Sbjct: 4818 KDDTSTSLELFAAKATDSGTYICQ-LSNDVGTATSKAT--LFVKEPPQFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGT-YVCEA-----RNDAGTASCSIELKVKEPPTFIRELKPVEVVKYSDVELE----CEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVS-VFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPSFI 5051          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Human
Match: TTN (titin [Source:HGNC Symbol;Acc:HGNC:12403])

HSP 1 Score: 52.373 bits (124), Expect = 2.924e-6
Identity = 51/206 (24.76%), Postives = 90/206 (43.69%), Query Frame = 3
Query:  396 THKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIW-RTES------NPNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQF-----SYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILK 977
            + ++ + E  KF+KKL    VA+ GE ++ EC  +GSP++KV W R +S        N++  +  A L IN  +AE +G  Y CEA   +     G  + S  L ++  P    +   +    G +   + ++ G P      P   +  +    + ++ +F      +   + I  +   ++G Y C   NE G  T   S+  K
Sbjct: 7599 SAQLSVKEPPKFVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSG-DYICEAHNGV-----GDASCSTALTVKAPPVFTQKPSPVGALKGSDVILQCEISGTP------PFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFK 7792          

HSP 2 Score: 50.8322 bits (120), Expect = 7.334e-6
Identity = 62/248 (25.00%), Postives = 107/248 (43.15%), Query Frame = 3
Query:  285 KNDILCMVKEISEKEDDKFSFKCIILEKGFGKSLNEETHKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIWRTESNP-------NVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKP----QIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILK-PANLI 992
            K+D    ++  + K  D  ++ C  L    G + ++ T  + + E  +FIKK +   V R G+    EC   G+P ++V W  + N         ++     A  QI+    E +G  Y CEA     + + GT + SI L ++  P    ++    ++ ++D+  E     +V G P  ++     N         T TD+ S ++ + I K    + G YQC V NE G  +    + LK P + I
Sbjct: 6062 KDDTSTSLELFAAKATDSGTYICQ-LSNDVGTATSKAT--LFVKEPPQFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGT-YVCEA-----RNDAGTASCSIELKVKEPPTFIRELKPVEVVKYSDVELE----CEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVS-VFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPSFI 6295          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Celegans
Match: rig-5 (NeuRonal IGCAM [Source:UniProtKB/TrEMBL;Acc:H2FLI8])

HSP 1 Score: 56.225 bits (134), Expect = 3.852e-8
Identity = 61/296 (20.61%), Postives = 117/296 (39.53%), Query Frame = 3
Query:  120 LGSKIDICCTIQSTQGDGLAILAGDIRIKMLIKGDVIEQDINAFKSKNPSYTVERKNDILCMVKEISEKEDDKFSFKCIILEKGFGKSLNEETHKIRIYEELKFIKKLNEKFV-ARVGEDLEEECSAAGSPDLKVIWRTES------NPNVTSGSPTAKLQINRLT--AEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEK----VMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSL 968
            LG  +D  C +       +A +  D   ++L   + + +  N ++ K      +  N+ +  +K +  +E D+ ++ C I  +    S  E   K+        + +     V  R G ++   C A G+P   VIWR +       N     G+      +  LT  +  +  +Y C AS  IP  E  T+   +T    F P +  ++  +   +G         +  P+P++       P  +     MT T + Q+  ++ + I  +   + G Y+C  +N+ G    QV+L
Sbjct:   98 LGQDVDFTCIVNDLGSHMVAFVKADSPPRLLSFDEKVFRRRNKYELK--PRIGDLHNEWVLTIKNV--QESDRGNYSCQINTEPITLSTGELDVKVP-----PVVSRSTPAAVEVREGNNVSLTCKADGNPTPTVIWRRQDRQIIRYNGATGFGASVFHGPVLHLTKVSRKHMSEYLCVASNGIPPDESWTVKLLVT----FPPLVQAQSETVQASVGSMARMVCTTEAWPRPEMGWEKDGEPVYESNNVAMTHTVSGQYHSVHILEIRNVQSSHFGVYRCVAKNDNGIHHSQVTL 380          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Celegans
Match: rig-5 (NeuRonal IGCAM [Source:UniProtKB/TrEMBL;Acc:H2FLI8])

HSP 1 Score: 56.225 bits (134), Expect = 4.025e-8
Identity = 61/296 (20.61%), Postives = 117/296 (39.53%), Query Frame = 3
Query:  120 LGSKIDICCTIQSTQGDGLAILAGDIRIKMLIKGDVIEQDINAFKSKNPSYTVERKNDILCMVKEISEKEDDKFSFKCIILEKGFGKSLNEETHKIRIYEELKFIKKLNEKFV-ARVGEDLEEECSAAGSPDLKVIWRTES------NPNVTSGSPTAKLQINRLT--AEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEK----VMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSL 968
            LG  +D  C +       +A +  D   ++L   + + +  N ++ K      +  N+ +  +K +  +E D+ ++ C I  +    S  E   K+        + +     V  R G ++   C A G+P   VIWR +       N     G+      +  LT  +  +  +Y C AS  IP  E  T+     L + F P +  ++  +   +G         +  P+P++       P  +     MT T + Q+  ++ + I  +   + G Y+C  +N+ G    QV+L
Sbjct:   98 LGQDVDFTCIVNDLGSHMVAFVKADSPPRLLSFDEKVFRRRNKYELK--PRIGDLHNEWVLTIKNV--QESDRGNYSCQINTEPITLSTGELDVKVP-----PVVSRSTPAAVEVREGNNVSLTCKADGNPTPTVIWRRQDRQIIRYNGATGFGASVFHGPVLHLTKVSRKHMSEYLCVASNGIPPDESWTVK----LLVTFPPLVQAQSETVQASVGSMARMVCTTEAWPRPEMGWEKDGEPVYESNNVAMTHTVSGQYHSVHILEIRNVQSSHFGVYRCVAKNDNGIHHSQVTL 380          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Celegans
Match: rig-5 (NeuRonal IGCAM [Source:UniProtKB/TrEMBL;Acc:H2FLI8])

HSP 1 Score: 56.225 bits (134), Expect = 4.158e-8
Identity = 61/296 (20.61%), Postives = 117/296 (39.53%), Query Frame = 3
Query:  120 LGSKIDICCTIQSTQGDGLAILAGDIRIKMLIKGDVIEQDINAFKSKNPSYTVERKNDILCMVKEISEKEDDKFSFKCIILEKGFGKSLNEETHKIRIYEELKFIKKLNEKFV-ARVGEDLEEECSAAGSPDLKVIWRTES------NPNVTSGSPTAKLQINRLT--AEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEK----VMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSL 968
            LG  +D  C +       +A +  D   ++L   + + +  N ++ K      +  N+ +  +K +  +E D+ ++ C I  +    S  E   K+        + +     V  R G ++   C A G+P   VIWR +       N     G+      +  LT  +  +  +Y C AS  IP  E  T+   +T    F P +  ++  +   +G         +  P+P++       P  +     MT T + Q+  ++ + I  +   + G Y+C  +N+ G    QV+L
Sbjct:   98 LGQDVDFTCIVNDLGSHMVAFVKADSPPRLLSFDEKVFRRRNKYELK--PRIGDLHNEWVLTIKNV--QESDRGNYSCQINTEPITLSTGELDVKVP-----PVVSRSTPAAVEVREGNNVSLTCKADGNPTPTVIWRRQDRQIIRYNGATGFGASVFHGPVLHLTKVSRKHMSEYLCVASNGIPPDESWTVKLLVT----FPPLVQAQSETVQASVGSMARMVCTTEAWPRPEMGWEKDGEPVYESNNVAMTHTVSGQYHSVHILEIRNVQSSHFGVYRCVAKNDNGIHHSQVTL 380          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Celegans
Match: rig-5 (NeuRonal IGCAM [Source:UniProtKB/TrEMBL;Acc:H2FLI8])

HSP 1 Score: 55.4546 bits (132), Expect = 6.918e-8
Identity = 61/296 (20.61%), Postives = 117/296 (39.53%), Query Frame = 3
Query:  120 LGSKIDICCTIQSTQGDGLAILAGDIRIKMLIKGDVIEQDINAFKSKNPSYTVERKNDILCMVKEISEKEDDKFSFKCIILEKGFGKSLNEETHKIRIYEELKFIKKLNEKFV-ARVGEDLEEECSAAGSPDLKVIWRTES------NPNVTSGSPTAKLQINRLT--AEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEK----VMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSL 968
            LG  +D  C +       +A +  D   ++L   + + +  N ++ K      +  N+ +  +K +  +E D+ ++ C I  +    S  E   K+        + +     V  R G ++   C A G+P   VIWR +       N     G+      +  LT  +  +  +Y C AS  IP  E  T+     L + F P +  ++  +   +G         +  P+P++       P  +     MT T + Q+  ++ + I  +   + G Y+C  +N+ G    QV+L
Sbjct:   47 LGQDVDFTCIVNDLGSHMVAFVKADSPPRLLSFDEKVFRRRNKYELK--PRIGDLHNEWVLTIKNV--QESDRGNYSCQINTEPITLSTGELDVKVP-----PVVSRSTPAAVEVREGNNVSLTCKADGNPTPTVIWRRQDRQIIRYNGATGFGASVFHGPVLHLTKVSRKHMSEYLCVASNGIPPDESWTVK----LLVTFPPLVQAQSETVQASVGSMARMVCTTEAWPRPEMGWEKDGEPVYESNNVAMTHTVSGQYHSVHILEIRNVQSSHFGVYRCVAKNDNGIHHSQVTL 329          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Fly
Match: CG34353 (gene:FBgn0085382 transcript:FBtr0305292)

HSP 1 Score: 80.1073 bits (196), Expect = 1.503e-15
Identity = 56/205 (27.32%), Postives = 92/205 (44.88%), Query Frame = 3
Query:  468 GEDLEEECSAAGSPDLKVIWRTESN--PNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKI----DCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILKPANLIITSPNGTEFSSCYMLSWTMNSKSP 1064
            G  +  ECSA G+P   V W  ++N  PN      +  L I  +     G+ Y C A+  + +      +  + L + F P+I +E  ++ +  G E T    V G  QP++    D   L+     +M    +      + + I K+  Q+ G Y C  EN+ GKA K + L  KP   +  SP  +++   Y +SW ++S SP
Sbjct:  198 GSSVRIECSATGNPMPNVTWSRKNNILPNGEEKLHSHVLSIENVDRHKGGV-YICTANNRVGQ----PASSQVVLHVLFSPEISVERPVVFSGEGHEATLVCIVHGETQPEVIWFKDTMQLDTTERHIMETRGSR-----HTLIIRKVHPQDFGNYSCVAENQLGKARKTLQLSGKPNVAVFNSPPISQYKDRYNISWAVDSHSP 392          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Fly
Match: CG34353 (gene:FBgn0085382 transcript:FBtr0112563)

HSP 1 Score: 80.1073 bits (196), Expect = 1.503e-15
Identity = 56/205 (27.32%), Postives = 92/205 (44.88%), Query Frame = 3
Query:  468 GEDLEEECSAAGSPDLKVIWRTESN--PNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKI----DCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILKPANLIITSPNGTEFSSCYMLSWTMNSKSP 1064
            G  +  ECSA G+P   V W  ++N  PN      +  L I  +     G+ Y C A+  + +      +  + L + F P+I +E  ++ +  G E T    V G  QP++    D   L+     +M    +      + + I K+  Q+ G Y C  EN+ GKA K + L  KP   +  SP  +++   Y +SW ++S SP
Sbjct:  198 GSSVRIECSATGNPMPNVTWSRKNNILPNGEEKLHSHVLSIENVDRHKGGV-YICTANNRVGQ----PASSQVVLHVLFSPEISVERPVVFSGEGHEATLVCIVHGETQPEVIWFKDTMQLDTTERHIMETRGSR-----HTLIIRKVHPQDFGNYSCVAENQLGKARKTLQLSGKPNVAVFNSPPISQYKDRYNISWAVDSHSP 392          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Fly
Match: CG34353 (gene:FBgn0085382 transcript:FBtr0339321)

HSP 1 Score: 80.1073 bits (196), Expect = 1.648e-15
Identity = 56/205 (27.32%), Postives = 92/205 (44.88%), Query Frame = 3
Query:  468 GEDLEEECSAAGSPDLKVIWRTESN--PNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKI----DCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILKPANLIITSPNGTEFSSCYMLSWTMNSKSP 1064
            G  +  ECSA G+P   V W  ++N  PN      +  L I  +     G+ Y C A+  + +      +  + L + F P+I +E  ++ +  G E T    V G  QP++    D   L+     +M    +      + + I K+  Q+ G Y C  EN+ GKA K + L  KP   +  SP  +++   Y +SW ++S SP
Sbjct:  198 GSSVRIECSATGNPMPNVTWSRKNNILPNGEEKLHSHVLSIENVDRHKGGV-YICTANNRVGQ----PASSQVVLHVLFSPEISVERPVVFSGEGHEATLVCIVHGETQPEVIWFKDTMQLDTTERHIMETRGSR-----HTLIIRKVHPQDFGNYSCVAENQLGKARKTLQLSGKPNVAVFNSPPISQYKDRYNISWAVDSHSP 392          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Fly
Match: klg (gene:FBgn0017590 transcript:FBtr0084337)

HSP 1 Score: 66.6254 bits (161), Expect = 3.231e-11
Identity = 51/207 (24.64%), Postives = 91/207 (43.96%), Query Frame = 3
Query:  459 ARVGEDLEEECSAAGSPDLKVIWRTESNPNVTSG--SPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIP---AEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILKPANLIITSPNGTEFSSCYMLSWTMNSKSP 1064
            AR G  +  EC  +G+P   + W  +S  N ++        L + +L  +  G+ Y C A   +  G+  T++  + LD+ + P I +E   IH+  GFE      V  +P   +     + P    ++ +  T  ++    + +TI  I Q++ G Y C  +N  G++ K + L  +P      SP        Y L+W ++S  P
Sbjct:  210 ARKGGPITLECKGSGNPVPSIYWTKKSGANKSTARIGDGPILTLEKLERQQAGV-YQCTADNGV--GDPVTVD--MRLDVLYPPDIQVEKSWIHSGEGFEAKLVCIVFADPVATVSWYQNSFPIQSTDRRIMATRANR----HMLTIRHIQQEDFGNYSCVADNSLGRSRKYMELSGRPGAAEFYSPKWGRSPDSYNLTWKIDSYPP 407          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Fly
Match: CG7166 (gene:FBgn0037107 transcript:FBtr0301161)

HSP 1 Score: 59.3066 bits (142), Expect = 5.175e-9
Identity = 56/215 (26.05%), Postives = 89/215 (41.40%), Query Frame = 3
Query:  444 NEKFVARVGEDLEEECSAAGSPDLKVIWRTE---SNPNVTSGSPTAKLQ-INRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKI----DCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILKPANLIITSPNGTEFSSCYMLSWTMNSKSP 1064
            N +  AR G  +  EC A+G+P   + W  +   S P   S S T  L+ ++R  A      Y C A      G    ++  I L I   P+I +E   +H   G++      V G+   ++    +  LL+    + M   D D++S I    I      + G Y C  +N  G+  K + +  +P      SP  + F   Y L+WT+ S  P
Sbjct:  143 NGQVTARKGSTVTLECKASGNPVPTIFWFKKDVFSGPTHLSDSSTLILENVDRHHAG----TYQCSAD----NGVKDRVSMDIQLTILSPPEITVEKSWVHASEGYDVELVCIVHGDVNSEMLWYQNSFLLDATDRRSMYPRD-DRYSLI----IRNFQPTDFGNYSCVADNALGRTKKYIEVSGRPGPADFISPALSGFLDHYNLTWTIESIPP 344          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Zebrafish
Match: hmcn2 (hemicentin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-9765])

HSP 1 Score: 51.2174 bits (121), Expect = 3.809e-6
Identity = 44/171 (25.73%), Postives = 71/171 (41.52%), Query Frame = 3
Query:  489 CSAAGSPDLKVIW-RTESNPNVTSGS----PTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIP---AEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILK 977
            C A G P+  + W +         GS    PT  L+I   T    G KYTC A     +  +G   + +TL ++  P+I      +   L        +V+G P+P I      +P     ++  +++         +   ++T  + GTYQC  +NE G A  Q  LIL+
Sbjct: 2877 CHATGRPEPVISWNKNWMQLGARGGSYRVLPTGALEILAATPSHAG-KYTCSA-----RNPVGVAYKHVTLTVQEPPEIRPMAEEVQVVLHHSVVLPCEVQGFPRPTITWQREGVPVATGHRLAVLSNG-------ALKFSRVTLGDAGTYQCLAQNEAGTALAQTQLILQ 3034          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Xenopus
Match: chmp3 (charged multivesicular body protein 3 [Source:Xenbase;Acc:XB-GENE-1005141])

HSP 1 Score: 59.6918 bits (143), Expect = 9.548e-9
Identity = 55/213 (25.82%), Postives = 100/213 (46.95%), Query Frame = 3
Query:  405 IRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIWRTESNPNVTSGS--------PTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKI----DCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILKPANLIITSPN 1007
            + + E  +F+KKL    + + G+    +C  +GSP+++V+W  +++  +  G           A L+I   T E +G  YTCEA       + G+++ S +L ++  P    +   + T  G + T + ++KG P  ++    D   +   ++K   ITD    +Y+  + I KI   +IG YQC   NE G  T   ++ LK     +  P+
Sbjct:  267 LGVQEPPRFVKKLESSKIVKQGDSDRFDCKISGSPEIRVLW-FKNDAEIQHGGKYAMSFVDSVAVLEITDATIEESG-DYTCEA-----HNDAGSVSCSTSLKVKEPPVFIAKPEPVLTLKGVDVTLQCELKGTPPFEVSWFKDRREIK-SSKKFKIITD----NYLASIHILKIDAGDIGEYQCKAVNEVGSDTCLCTIKLKEPPRFVKKPD 467          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Xenopus
Match: bloc1s1 (biogenesis of lysosomal organelles complex 1 subunit 1 [Source:Xenbase;Acc:XB-GENE-952074])

HSP 1 Score: 52.373 bits (124), Expect = 2.415e-6
Identity = 63/239 (26.36%), Postives = 99/239 (41.42%), Query Frame = 3
Query:  327 EDDKFSFKCIILEKGFGKSLN-EETHKIRIYEELKFIKKLNEKF-VARV-GEDLEEECSAAGSPDLKVIWRTESNPNVTSGSPT------AKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPL---LNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSL-ILKPANLIITSP 1004
            E D   ++C +   G G S+   E  +IR+ ++ + +  L +   + RV G+     C  +G P   V W       +T  S T        LQI+ +T E +G+ YTC A      G   TI     L I+  P   ++    H     +  F+ +V G P P +       + IP++    + D D       + +  + + + G YQC  ENE G       L IL+P   I TSP
Sbjct:  178 ESDAGLYRCAV---GGGSSIKYSEEAEIRVLQDERPMLFLRQPLPLTRVSGQTALLTCVVSGYPTPSVRWTHNQKEILTENSETLTFVAGGSLQISSVTEEDSGI-YTCIAD----NGNQ-TIQAHAELSIQVPPIFHVKPSNTHAHESMDIVFKCEVTGKPTPTVKWVKNGDMVIPSDYFKIVEDHD-------LQVLGLVRSDEGFYQCIAENEVGNVQAAAQLIILEPGVTIPTSP 400          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Xenopus
Match: bloc1s1 (biogenesis of lysosomal organelles complex 1 subunit 1 [Source:Xenbase;Acc:XB-GENE-952074])

HSP 1 Score: 51.9878 bits (123), Expect = 2.660e-6
Identity = 63/239 (26.36%), Postives = 99/239 (41.42%), Query Frame = 3
Query:  327 EDDKFSFKCIILEKGFGKSLN-EETHKIRIYEELKFIKKLNEKF-VARV-GEDLEEECSAAGSPDLKVIWRTESNPNVTSGSPT------AKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPL---LNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSL-ILKPANLIITSP 1004
            E D   ++C +   G G S+   E  +IR+ ++ + +  L +   + RV G+     C  +G P   V W       +T  S T        LQI+ +T E +G+ YTC A      G   TI     L I+  P   ++    H     +  F+ +V G P P +       + IP++    + D D       + +  + + + G YQC  ENE G       L IL+P   I TSP
Sbjct:  182 ESDAGLYRCAV---GGGSSIKYSEEAEIRVLQDERPMLFLRQPLPLTRVSGQTALLTCVVSGYPTPSVRWTHNQKEILTENSETLTFVAGGSLQISSVTEEDSGI-YTCIAD----NGNQ-TIQAHAELSIQVPPIFHVKPSNTHAHESMDIVFKCEVTGKPTPTVKWVKNGDMVIPSDYFKIVEDHD-------LQVLGLVRSDEGFYQCIAENEVGNVQAAAQLIILEPGVTIPTSP 404          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Xenopus
Match: fkbp15 (FKBP prolyl isomerase 15 [Source:Xenbase;Acc:XB-GENE-6035907])

HSP 1 Score: 51.9878 bits (123), Expect = 2.735e-6
Identity = 61/251 (24.30%), Postives = 103/251 (41.04%), Query Frame = 3
Query:  315 ISEKEDDKFSFKCII---LEKGFGKSLNEETHKIR--IYEELKFIKKLN-EKFVARVGEDLEEECSAAGSPDLKVIWRTESNPNVTSGSPTAKLQINRL---TAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKI-----DCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILKPANLIITSPNGTEFSS 1025
            ++  ++D+ ++KC     + +    S++ +  ++R    E  + I   N +  +   G+ L  EC A+G P  ++ W  +    V+  + T  L  N L   T+E +   YTC A   I  GE G+      + +   P++ +E        G    F  ++KGNPQP +       PL  IP+ K               + +  +  ++ G YQC  ENE G A     LI   A +    P     SS
Sbjct:   64 VNATQEDEGTYKCAAYNPVTQEVKTSVSSDRLRVRRSTAEAARIIYPPNAQTIIVTKGQSLILECVASGMPPPRITWAKDGA-EVSGHNKTRFLLSNLLIDATSEEDSGTYTCTAGNGI--GEGGSTFIFYNVQVFEPPEVSMELSQPIVTWGQSAKFTCEIKGNPQPSVIWLRNATPL--IPSAKHKMSRKV--------LRVINVGPEDGGVYQCMAENEVGSAQALALLITTRAGMDNVPPTDAPTSS 301          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Xenopus
Match: eftud2 (elongation factor Tu GTP binding domain containing 2 [Source:Xenbase;Acc:XB-GENE-972643])

HSP 1 Score: 51.9878 bits (123), Expect = 2.996e-6
Identity = 53/234 (22.65%), Postives = 92/234 (39.32%), Query Frame = 3
Query:  318 SEKEDDKFSFKCIILEKGFGKSLNEETHKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIWRTESNPNVTSGSPTAKLQINRLTAEM----------NGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIP----AEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILK 977
            S  ++D  ++ CI  +   G +L +   K+ +      I    +++V  + + +   C A GSP  ++IW  +       G P AKL   R++A            +  +YTC A     +   G++N S+ L +   P+I      +   +  + T      G P P I     N+P    A K   +   +   Y  Q        +++GTY C   N  G+ T  V L + 
Sbjct: 3999 SATQEDAGTYTCI-AQNPAGTALKKVRLKVHV---PPVIVPHQKEYVISMDKSIMIVCEAHGSPTPEIIWHKD-------GVPLAKLAGQRMSATGGLHIAVVQPDDAGEYTCTA-----ENIAGSVNSSMNLSVLVPPRIVKNIKDVSVVINDQTTLPCAAHGIPTPTITWAKNNLPITVKAGKYSVLASGELILYNAQ-------HKDVGTYTCTASNAIGEDTHTVRLTVH 4209          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Mouse
Match: Ttn (titin [Source:MGI Symbol;Acc:MGI:98864])

HSP 1 Score: 56.9954 bits (136), Expect = 6.042e-8
Identity = 64/257 (24.90%), Postives = 109/257 (42.41%), Query Frame = 3
Query:  252 KSKNPSYTVERKNDILCMVKEISEKEDDKFSFKCIILEKGFGKSLNEETHKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIWRTESNPNVTSGSPTAKLQ---------INRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDI---RFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKI----DCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLIL 974
            +S N   T   K+ IL +++   E   D   + C+I E   G+ + E    + + E   FI+ L E   A +GE +  +C   G+P++++ W  E        +P  K+Q         IN++     G +YTC+A  S+     G +  S  L I   +  P    +   +H  LGF   F  ++ G+   ++    D  LL   A   M+        ++  + I +  Q ++G Y C+  N  G A+    LIL
Sbjct:  872 QSPNCGITTTEKSSILEILESTIE---DYAQYACLI-ENEAGQDICEAL--VSVLEPPYFIEPL-EHVEAAIGEPITLQCKVDGTPEIRISWYKEHTK--LRSAPAYKMQFKNNVASLVINKVDHSDVG-EYTCKAENSV-----GAVASSAVLVIKERKLPPSFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGELLKDDANLQMSF-----VHHVATLQILQTDQSHVGQYNCSASNPLGTASSSAKLIL 1108          

HSP 2 Score: 56.9954 bits (136), Expect = 6.868e-8
Identity = 51/198 (25.76%), Postives = 88/198 (44.44%), Query Frame = 3
Query:  396 THKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIW-RTES------NPNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQF-----SYIYQMTIDKITQQNIGTYQCNVENEEGKAT 953
            + ++ + E  KFIKKL+   VA+ GE ++ EC  +GSP++KV+W R +S        N++  +  A L IN  +AE  G  Y CEA   +     G  + S  L ++  P    +   +    G +   + ++ G P      P   +  +    +  + +F     ++   + I  +   +IG Y C   NE G  T
Sbjct:  258 SAQLSVKEPPKFIKKLDASKVAKQGESIQLECKISGSPEIKVVWFRNDSELHESWKYNMSFVNSVALLTINEASAEDTG-DYICEAHNGV-----GDASCSTALKVKAPPVFTQKPPPVGALKGSDVILQCEISGTP------PFEVVWVKDRKQVRSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVGSDT 443          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Mouse
Match: Ttn (titin [Source:MGI Symbol;Acc:MGI:98864])

HSP 1 Score: 56.225 bits (134), Expect = 1.287e-7
Identity = 51/198 (25.76%), Postives = 88/198 (44.44%), Query Frame = 3
Query:  396 THKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIW-RTES------NPNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQF-----SYIYQMTIDKITQQNIGTYQCNVENEEGKAT 953
            + ++ + E  KFIKKL+   VA+ GE ++ EC  +GSP++KV+W R +S        N++  +  A L IN  +AE  G  Y CEA   +     G  + S  L ++  P    +   +    G +   + ++ G P      P   +  +    +  + +F     ++   + I  +   +IG Y C   NE G  T
Sbjct: 3020 SAQLSVKEPPKFIKKLDASKVAKQGESIQLECKISGSPEIKVVWFRNDSELHESWKYNMSFVNSVALLTINEASAEDTG-DYICEAHNGV-----GDASCSTALKVKAPPVFTQKPPPVGALKGSDVILQCEISGTP------PFEVVWVKDRKQVRSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVGSDT 3205          

HSP 2 Score: 55.4546 bits (132), Expect = 2.022e-7
Identity = 64/257 (24.90%), Postives = 109/257 (42.41%), Query Frame = 3
Query:  252 KSKNPSYTVERKNDILCMVKEISEKEDDKFSFKCIILEKGFGKSLNEETHKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIWRTESNPNVTSGSPTAKLQ---------INRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDI---RFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKI----DCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLIL 974
            +S N   T   K+ IL +++   E   D   + C+I E   G+ + E    + + E   FI+ L E   A +GE +  +C   G+P++++ W  E        +P  K+Q         IN++     G +YTC+A  S+     G +  S  L I   +  P    +   +H  LGF   F  ++ G+   ++    D  LL   A   M+        ++  + I +  Q ++G Y C+  N  G A+    LIL
Sbjct: 3634 QSPNCGITTTEKSSILEILESTIE---DYAQYACLI-ENEAGQDICEAL--VSVLEPPYFIEPL-EHVEAAIGEPITLQCKVDGTPEIRISWYKEH--TKLRSAPAYKMQFKNNVASLVINKVDHSDVG-EYTCKAENSV-----GAVASSAVLVIKERKLPPSFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGELLKDDANLQMSF-----VHHVATLQILQTDQSHVGQYNCSASNPLGTASSSAKLIL 3870          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Mouse
Match: Ttn (titin [Source:MGI Symbol;Acc:MGI:98864])

HSP 1 Score: 55.8398 bits (133), Expect = 1.543e-7
Identity = 64/257 (24.90%), Postives = 109/257 (42.41%), Query Frame = 3
Query:  252 KSKNPSYTVERKNDILCMVKEISEKEDDKFSFKCIILEKGFGKSLNEETHKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIWRTESNPNVTSGSPTAKLQ---------INRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDI---RFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKI----DCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLIL 974
            +S N   T   K+ IL +++   E   D   + C+I E   G+ + E    + + E   FI+ L E   A +GE +  +C   G+P++++ W  E        +P  K+Q         IN++     G +YTC+A  S+     G +  S  L I   +  P    +   +H  LGF   F  ++ G+   ++    D  LL   A   M+        ++  + I +  Q ++G Y C+  N  G A+    LIL
Sbjct: 6963 QSPNCGITTTEKSSILEILESTIE---DYAQYACLI-ENEAGQDICEAL--VSVLEPPYFIEPL-EHVEAAIGEPITLQCKVDGTPEIRISWYKEH--TKLRSAPAYKMQFKNNVASLVINKVDHSDVG-EYTCKAENSV-----GAVASSAVLVIKERKLPPSFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGELLKDDANLQMSF-----VHHVATLQILQTDQSHVGQYNCSASNPLGTASSSAKLIL 7199          

HSP 2 Score: 55.4546 bits (132), Expect = 1.976e-7
Identity = 51/198 (25.76%), Postives = 88/198 (44.44%), Query Frame = 3
Query:  396 THKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIW-RTES------NPNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQF-----SYIYQMTIDKITQQNIGTYQCNVENEEGKAT 953
            + ++ + E  KFIKKL+   VA+ GE ++ EC  +GSP++KV+W R +S        N++  +  A L IN  +AE  G  Y CEA   +     G  + S  L ++  P    +   +    G +   + ++ G P      P   +  +    +  + +F     ++   + I  +   +IG Y C   NE G  T
Sbjct: 6349 SAQLSVKEPPKFIKKLDASKVAKQGESIQLECKISGSPEIKVVWFRNDSELHESWKYNMSFVNSVALLTINEASAEDTG-DYICEAHNGV-----GDASCSTALKVKAPPVFTQKPPPVGALKGSDVILQCEISGTP------PFEVVWVKDRKQVRSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVGSDT 6534          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Mouse
Match: Ttn (titin [Source:MGI Symbol;Acc:MGI:98864])

HSP 1 Score: 55.8398 bits (133), Expect = 1.543e-7
Identity = 64/257 (24.90%), Postives = 109/257 (42.41%), Query Frame = 3
Query:  252 KSKNPSYTVERKNDILCMVKEISEKEDDKFSFKCIILEKGFGKSLNEETHKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIWRTESNPNVTSGSPTAKLQ---------INRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDI---RFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKI----DCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLIL 974
            +S N   T   K+ IL +++   E   D   + C+I E   G+ + E    + + E   FI+ L E   A +GE +  +C   G+P++++ W  E        +P  K+Q         IN++     G +YTC+A  S+     G +  S  L I   +  P    +   +H  LGF   F  ++ G+   ++    D  LL   A   M+        ++  + I +  Q ++G Y C+  N  G A+    LIL
Sbjct: 6963 QSPNCGITTTEKSSILEILESTIE---DYAQYACLI-ENEAGQDICEAL--VSVLEPPYFIEPL-EHVEAAIGEPITLQCKVDGTPEIRISWYKEH--TKLRSAPAYKMQFKNNVASLVINKVDHSDVG-EYTCKAENSV-----GAVASSAVLVIKERKLPPSFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGELLKDDANLQMSF-----VHHVATLQILQTDQSHVGQYNCSASNPLGTASSSAKLIL 7199          

HSP 2 Score: 55.4546 bits (132), Expect = 1.976e-7
Identity = 51/198 (25.76%), Postives = 88/198 (44.44%), Query Frame = 3
Query:  396 THKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIW-RTES------NPNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQF-----SYIYQMTIDKITQQNIGTYQCNVENEEGKAT 953
            + ++ + E  KFIKKL+   VA+ GE ++ EC  +GSP++KV+W R +S        N++  +  A L IN  +AE  G  Y CEA   +     G  + S  L ++  P    +   +    G +   + ++ G P      P   +  +    +  + +F     ++   + I  +   +IG Y C   NE G  T
Sbjct: 6349 SAQLSVKEPPKFIKKLDASKVAKQGESIQLECKISGSPEIKVVWFRNDSELHESWKYNMSFVNSVALLTINEASAEDTG-DYICEAHNGV-----GDASCSTALKVKAPPVFTQKPPPVGALKGSDVILQCEISGTP------PFEVVWVKDRKQVRSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVGSDT 6534          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Mouse
Match: Ttn (titin [Source:MGI Symbol;Acc:MGI:98864])

HSP 1 Score: 55.8398 bits (133), Expect = 1.800e-7
Identity = 64/257 (24.90%), Postives = 109/257 (42.41%), Query Frame = 3
Query:  252 KSKNPSYTVERKNDILCMVKEISEKEDDKFSFKCIILEKGFGKSLNEETHKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIWRTESNPNVTSGSPTAKLQ---------INRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDI---RFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKI----DCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLIL 974
            +S N   T   K+ IL +++   E   D   + C+I E   G+ + E    + + E   FI+ L E   A +GE +  +C   G+P++++ W  E        +P  K+Q         IN++     G +YTC+A  S+     G +  S  L I   +  P    +   +H  LGF   F  ++ G+   ++    D  LL   A   M+        ++  + I +  Q ++G Y C+  N  G A+    LIL
Sbjct: 7982 QSPNCGITTTEKSSILEILESTIE---DYAQYACLI-ENEAGQDICEAL--VSVLEPPYFIEPL-EHVEAAIGEPITLQCKVDGTPEIRISWYKEH--TKLRSAPAYKMQFKNNVASLVINKVDHSDVG-EYTCKAENSV-----GAVASSAVLVIKERKLPPSFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGELLKDDANLQMSF-----VHHVATLQILQTDQSHVGQYNCSASNPLGTASSSAKLIL 8218          

HSP 2 Score: 55.4546 bits (132), Expect = 2.246e-7
Identity = 51/198 (25.76%), Postives = 88/198 (44.44%), Query Frame = 3
Query:  396 THKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIW-RTES------NPNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQF-----SYIYQMTIDKITQQNIGTYQCNVENEEGKAT 953
            + ++ + E  KFIKKL+   VA+ GE ++ EC  +GSP++KV+W R +S        N++  +  A L IN  +AE  G  Y CEA   +     G  + S  L ++  P    +   +    G +   + ++ G P      P   +  +    +  + +F     ++   + I  +   +IG Y C   NE G  T
Sbjct: 7368 SAQLSVKEPPKFIKKLDASKVAKQGESIQLECKISGSPEIKVVWFRNDSELHESWKYNMSFVNSVALLTINEASAEDTG-DYICEAHNGV-----GDASCSTALKVKAPPVFTQKPPPVGALKGSDVILQCEISGTP------PFEVVWVKDRKQVRSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVGSDT 7553          
BLAST of Opioid-binding protein/cell adhesion molecule vs. UniProt/SwissProt
Match: sp|Q9UMF0|ICAM5_HUMAN (Intercellular adhesion molecule 5 OS=Homo sapiens OX=9606 GN=ICAM5 PE=1 SV=3)

HSP 1 Score: 60.8474 bits (146), Expect = 2.160e-8
Identity = 68/290 (23.45%), Postives = 126/290 (43.45%), Query Frame = 3
Query:  114 VKLGSKIDICCTIQSTQGDGLAILAGDIRIKMLIKGDVIEQDINAFKSKNPSYTVERKNDILCMVKEISEKEDDKFSFKCIILEKGFGKSLNEETHKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIWRTESNPNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDL--GFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILK 977
            +++GS+  + CT+     DGL   A + R+ + + GD         ++ +P  T+E    +       S +++      C +     G    E    + IY     +  L+E  V+  G+ +   C AAG+  L  +   E  P    G P A+LQ+N  T   +   + C+A++ +  GE    N+S  L + + P++D            G E+T R + +GNP+P + C               +D  + +    +  +T+   GTY+C   N++G+A K V+L ++
Sbjct:  239 LEVGSERPVSCTL-----DGL-FPASEARVYLAL-GD---------QNLSPDVTLEGDAFVATATATASAEQEGARQLVCNVT---LGGENRETRENVTIYSFPAPLLTLSEPSVSE-GQMVTVTC-AAGAQALVTL---EGVPAAVPGQP-AQLQLN-ATENDDRRSFFCDATLDV-DGETLIKNRSAELRVLYAPRLDDSDCPRSWTWPEGPEQTLRCEARGNPEPSVHC-------------ARSDGGAVLALGLLGPVTRALSGTYRCKAANDQGEAVKDVTLTVE 488          
BLAST of Opioid-binding protein/cell adhesion molecule vs. UniProt/SwissProt
Match: sp|Q26474|LACH_SCHAM (Lachesin OS=Schistocerca americana OX=7009 GN=LAC PE=1 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 1.642e-7
Identity = 48/181 (26.52%), Postives = 81/181 (44.75%), Query Frame = 3
Query:  453 FVARVGEDLEEECSAAGSPDLKVIWRTESNPNVTSGSPTAK---LQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKI-----DCPLLNIPAEKVMTITDTDQFSYIYQ-MTIDKITQQNIGTYQCNVENEEGKATKQVSL 968
             V   G+ +  EC A G P  +V WR E+N  + +G    +   L+I+R+  E  G  Y C A   + KG      ++I +++ F P I +    +   L ++      V+  P P I     +  L N     +      D+F+   + +TI+K   +  G YQC   N+ G+A ++V L
Sbjct:  142 LVVSEGQAVRLECYAGGYPAPRVSWRRENNAILPTGGSIYRGNVLKISRIGKEDRGTYY-CVAENGVGKGA----RRNIAVEVEFPPVITVPRPRLGQALQYDMDLECHVEAYPPPAITWLKDETVLSNNQHYSISHFATADEFTDTTRVITIEK---RQYGKYQCKAANKLGEAREEVEL 314          
BLAST of Opioid-binding protein/cell adhesion molecule vs. UniProt/SwissProt
Match: sp|Q28730|ICAM5_RABIT (Intercellular adhesion molecule 5 OS=Oryctolagus cuniculus OX=9986 GN=ICAM5 PE=2 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 2.218e-7
Identity = 39/150 (26.00%), Postives = 69/150 (46.00%), Query Frame = 3
Query:  534 ESNPNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDL--GFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILK 977
            E  P    G P A+LQ N   ++ +G  + C+A++ +  GE  + N S  L + + P++D            G E+T R + +GNP P + C               +D  + +    +  +T+   GTY+C   N +G+A K V+L ++
Sbjct:  350 EGVPAAAPGQP-AQLQFNASESD-DGRSFFCDATLEL-DGETLSKNGSAELRVLYAPRLDDADCPRSWTWPEGPEQTLRCEARGNPTPAVHC-------------ARSDGGAVLALGLLGPVTRALAGTYRCTAANVQGEAVKDVTLTVE 483          
BLAST of Opioid-binding protein/cell adhesion molecule vs. UniProt/SwissProt
Match: sp|Q24372|LACH_DROME (Lachesin OS=Drosophila melanogaster OX=7227 GN=Lac PE=1 SV=2)

HSP 1 Score: 55.4546 bits (132), Expect = 6.548e-7
Identity = 47/184 (25.54%), Postives = 80/184 (43.48%), Query Frame = 3
Query:  447 EKFVARVGEDLEEECSAAGSPDLKVIWRTESNPNVTSGSPTA---KLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKI-----DCPLLNIPAEKVMTITDTDQF--SYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSL 968
            +  VA  G +++ EC A+G P   + WR E+N  + + S T     L+I  +  E  G  Y C A   + KG+   IN    +++ F P I +    +   L ++      ++  P P I     D  L N     +      D++  S +  +T++K   +  G Y C   N  G+A  +V+L
Sbjct:  143 QSVVASEGSEVQMECYASGYPTPTITWRRENNAILPTDSATYVGNTLRIKSVKKEDRGTYY-CVADNGVSKGDRRNIN----VEVEFAPVITVPRPRLGQALQYDMDLECHIEAYPPPAIVWTKDDIQLANNQHYSISHFATADEYTDSTLRVITVEK---RQYGDYVCKATNRFGEAEARVNL 318          
BLAST of Opioid-binding protein/cell adhesion molecule vs. UniProt/SwissProt
Match: sp|A2ASS6|TITIN_MOUSE (Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 1.314e-6
Identity = 64/257 (24.90%), Postives = 109/257 (42.41%), Query Frame = 3
Query:  252 KSKNPSYTVERKNDILCMVKEISEKEDDKFSFKCIILEKGFGKSLNEETHKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIWRTESNPNVTSGSPTAKLQ---------INRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDI---RFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKI----DCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLIL 974
            +S N   T   K+ IL +++   E   D   + C+I E   G+ + E    + + E   FI+ L E   A +GE +  +C   G+P++++ W  E        +P  K+Q         IN++     G +YTC+A  S+     G +  S  L I   +  P    +   +H  LGF   F  ++ G+   ++    D  LL   A   M+        ++  + I +  Q ++G Y C+  N  G A+    LIL
Sbjct: 7857 QSPNCGITTTEKSSILEILESTIE---DYAQYACLI-ENEAGQDICEAL--VSVLEPPYFIEPL-EHVEAAIGEPITLQCKVDGTPEIRISWYKEH--TKLRSAPAYKMQFKNNVASLVINKVDHSDVG-EYTCKAENSV-----GAVASSAVLVIKERKLPPSFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGELLKDDANLQMSF-----VHHVATLQILQTDQSHVGQYNCSASNPLGTASSSAKLIL 8093          

HSP 2 Score: 55.4546 bits (132), Expect = 1.598e-6
Identity = 51/198 (25.76%), Postives = 88/198 (44.44%), Query Frame = 3
Query:  396 THKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIW-RTES------NPNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQF-----SYIYQMTIDKITQQNIGTYQCNVENEEGKAT 953
            + ++ + E  KFIKKL+   VA+ GE ++ EC  +GSP++KV+W R +S        N++  +  A L IN  +AE  G  Y CEA   +     G  + S  L ++  P    +   +    G +   + ++ G P      P   +  +    +  + +F     ++   + I  +   +IG Y C   NE G  T
Sbjct: 7243 SAQLSVKEPPKFIKKLDASKVAKQGESIQLECKISGSPEIKVVWFRNDSELHESWKYNMSFVNSVALLTINEASAEDTG-DYICEAHNGV-----GDASCSTALKVKAPPVFTQKPPPVGALKGSDVILQCEISGTP------PFEVVWVKDRKQVRSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVGSDT 7428          
BLAST of Opioid-binding protein/cell adhesion molecule vs. TrEMBL
Match: A0A0X3NQS8 (Peroxidasin homolog OS=Schistocephalus solidus OX=70667 GN=PXDN PE=4 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 1.159e-40
Identity = 122/459 (26.58%), Postives = 207/459 (45.10%), Query Frame = 3
Query:   54 LLEFFTFILIIKESISIEH------GVKLGSKIDICCTIQSTQGDGLAILAGDIRIKMLIKGD----VIEQDINAFKSKNPSYT---VERKNDILCMVKE--ISEKEDDKFSFKC-IILEKGFGKSLNEETHKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIWRTESNPNV--------------------------TSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILKPANLIITSPNGTEFSSCYMLSWTMNSKSPXXXXXXXXXXXXXXXXXXRKTVKSSELSTFRKVEGIKKNKWLN----------EFSYIFFNLTSNETYTVTLQICNKHEC 1274
            ++   T IL I   I  E+       V++G   + CC++    G+ L I     RI+ L++ +     I+ D + F ++NP Y    V +  D LC+ K+   +E  DDK  F+C ++ + G GK L +E   I IYE L  I  + EK     G  +  +CSA G P+L+++W+   +  V                           SG+ +  L++  +  E +G    CEAS S P  +     ++ TL + +  +++I    ++TDLG  E   I V G P+P ++C L+NI   + + + +      IY + + ++   +IG Y+C+  N  G   K V + L P+  ++TSPN T  +  Y+LSW  +SK+P             +       V  ++     ++E  K    LN          E+ +   NLT +  + V + +CNKH C
Sbjct:   10 IIAICTLILSISYIIHAEYPKETAINVQVGENFNFCCSLPQNPGEALTISFSGRRIRSLLRQNNEYNYIDADTDIFVAENPGYRMSDVSKSADQLCISKKNPGAEFSDDKKKFRCDLVAQSGLGKILKKEEISIHIYE-LPQIATMPEKVEVTEGGSVNLDCSATGRPNLQLLWKKAKSGEVLVSTADIKKKQMADNTSGVDRRVDGDESGALSVGLELTAVRREQDGEVLICEASTSYPPKQT-PARRNTTLSVNYPARLEIRNATVYTDLGAAEDIEIVVYGKPEPLLECDLMNIQESRDVLLAEDGPNKRIYYIRLYQVKPDDIGQYRCSATNILGTDYKTVQVTLNPSAPVVTSPNFTSHADYYLLSWRAHSKAP----LHNVTLRIESRKRGENNVIDAQEGAAPEIEHKKVTFTLNATEPSPFGAQEYWHHLPNLTMDAEHRVYVWVCNKHAC 462          
BLAST of Opioid-binding protein/cell adhesion molecule vs. TrEMBL
Match: A0A5K3FGA0 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 3.377e-38
Identity = 124/449 (27.62%), Postives = 212/449 (47.22%), Query Frame = 3
Query:  114 VKLGSKIDICCTIQSTQGDGLAILAGDIRIKML---IKGDVIEQDINAFKSKNPSYT---VERKNDILCMVKEI--SEKEDDKFSFKCIILEK-GFGKSLNEETHKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIWR---------TESNPNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTD-QFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILKPANLIITSPNGTEFSSCYMLSWTMNSKSPXXXXXXXXXXXXXXXXXXRKTVKSSELSTFRKVEGIK------------KNKWLNEFSYIFFNLTSNETYTVTLQICNKHECIIFENGA------FFRTGPSD-GNKCDPDRL 1346
            VK   K + CC +   +   + +  G  R++ L   ++   I+ +  AF +++P Y+   V  + + LC+ K+   +  ED+  +F C ++E  G G  L  ET  IR+YE    ++ L  +  + VG     +C+A G P+L++ WR         TE    +  G     L +  +  E +G K  CEA+ S P  +    +Q  TL +++ P+++I+   ++T+LG  E   I V GNP P+++C LLNI   + + +   + Q    Y + + ++ +Q++G Y+C+  NE G +T  V L L P+   + SP     +  Y+L W   SKSP+ N T    S   ++      V + EL +  KV+ +              + W  EF +   NL+ N  + + L  CN++ C    NG+       FRT   D  N+ DP  L
Sbjct:   28 VKKEEKFNFCCELTPGENQAIILHQGSRRLRSLAHVLRYKQIDAESRAFFAEHPGYSMKDVSVEVESLCIEKQSPGAAIEDNNMNFTCELVEDLGLGSVLETETITIRVYE-TPIVESLPLELTSVVGGPASVKCTARGRPNLQIRWRNKDTQEIYATEKFEMLDDGKAELSLTLTGMKEEQDGQKLVCEATTSYPPNQ-PPAHQVTTLSVKYPPRLEIKNNAVYTELGATEDIAITVYGNPPPELNCDLLNINEPRELELVPGEKQGVRTYHLRLHEVKKQDVGDYKCSAVNELGSSTVTVRLTLSPSPPEVISPKFANHADYYLLGWRSRSKSPLRNVTFRIHSTEKSA----GGVDTVELESKGKVKTVSLEDQLVAKANTNASDW-QEFWHHISNLSHNSEHRIYLSACNQYGC---SNGSSEIPHVTFRTPKDDSSNRIDPALL 466          
BLAST of Opioid-binding protein/cell adhesion molecule vs. TrEMBL
Match: A0A5K3FC69 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 4.431e-35
Identity = 119/424 (28.07%), Postives = 202/424 (47.64%), Query Frame = 3
Query:  189 GDIRIKML---IKGDVIEQDINAFKSKNPSYT---VERKNDILCMVKEI--SEKEDDKFSFKCIILEK-GFGKSLNEETHKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIWR---------TESNPNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTD-QFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILKPANLIITSPNGTEFSSCYMLSWTMNSKSPXXXXXXXXXXXXXXXXXXRKTVKSSELSTFRKVEGIK------------KNKWLNEFSYIFFNLTSNETYTVTLQICNKHECIIFENGA------FFRTGPSD-GNKCDPDRL 1346
            G  R++ L   ++   I+ +  AF +++P Y+   V  + + LC+ K+   +  ED+  +F C ++E  G G  L  ET  IR+YE    ++ L  +  + VG     +C+A G P+L++ WR         TE    +  G     L +  +  E +G K  CEA+ S P  +    +Q  TL +++ P+++I+   ++T+LG  E   I V GNP P+++C LLNI   + + +   + Q    Y + + ++ +Q++G Y+C+  NE G +T  V L L P+   + SP     +  Y+L W   SKSP+ N T    S   ++      V + EL +  KV+ +              + W  EF +   NL+ N  + + L  CN++ C    NG+       FRT   D  N+ DP  L
Sbjct:   11 GSRRLRSLAHVLRYKQIDAESRAFFAEHPGYSMKDVSVEVESLCIEKQSPGAAIEDNNMNFTCELVEDLGLGSVLETETITIRVYE-TPIVESLPLELTSVVGGPASVKCTARGRPNLQIRWRNKDTQEIYATEKFEMLDDGKAELSLTLTGMKEEQDGQKLVCEATTSYPPNQ-PPAHQVTTLSVKYPPRLEIKNNAVYTELGATEDIAITVYGNPPPELNCDLLNINEPRELELVPGEKQGVRTYHLRLHEVKKQDVGDYKCSAVNELGSSTVTVRLTLSPSPPEVISPKFANHADYYLLGWRSRSKSPLRNVTFRIHSTEKSA----GGVDTVELESKGKVKTVSLEDQLVAKANTNASDW-QEFWHHISNLSHNSEHRIYLSACNQYGC---SNGSSEIPHVTFRTPKDDSSNRIDPALL 424          
BLAST of Opioid-binding protein/cell adhesion molecule vs. TrEMBL
Match: A0A4V3SF06 (Ig-like domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005231 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 1.964e-31
Identity = 117/484 (24.17%), Postives = 223/484 (46.07%), Query Frame = 3
Query:   48 FYLLEFFTFIL--IIKESISIEHGVKLGSKIDICCTIQSTQGDGLAILA-GDIRIKMLIKGDVIEQDINAFKSK----NPSYTVE---RKNDILCM--VKEISEKEDDKFSFKCIILEK-GFGKSLNEETHKIRIYEELKFIKKLNEKFVARVGEDLEE--ECSAAGSPDLKVIWRTESNPNVTSGSPTAK------LQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQF-SYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILKPANLIITSPNGTEFSSCYMLSWTMNSKSPXXXXX------XXXXXXXXXXXXXRK--------TVKSSELSTF------RKVEGIKKNKWLNEFSYIFFNLTSNETYTVTLQICNKHECI------IFENGAF--FRTGPSDG-NKCDPDRL 1346
             YLL F  FIL  I + +I +   V       +CCT++  +GD   IL   + R++ + + +   +   A++       P + V+   +    +C+  +++   + +   +  C  + + G G  +  E  ++++Y  +  +   N     RV E+      C+A G PDL + W+++ N  +   +   K      L +N +T+  +   Y CEA  S P  +   +     L++   P I +++  IHT+LG +E+F+I V G P P ++C  L +  E    I D  +  ++ + +T+D +TQQ++ T+ C   NE G   K+++  + PA  +I SPN T  +  Y++ W  +S+ P+ N T       +  +    +   RK        T+  +E+S        ++VE +    W     +   NL++N  + +++ +CNK++C       + +N +   FRT   +G NK  P  L
Sbjct:    2 LYLLLFAPFILPHIARANIEVVQWVNETENFSVCCTLEP-KGDQAVILKLNNKRLQAIAESESGYERFAAYEEHFFKDYPQWAVDPLSKPGSQMCVHKIRDTPMELNANVTVACEKMARMGLGSVIERELIRVKVYRRVAIV---NVPDTCRVKENEAAILTCNATGYPDLHLSWKSKDNGELLKENRYDKPNGLLELVLNNVTSNQHDTSYVCEARTSYP-ADTPPVTAETKLEVYLPPTIKLDSYTIHTELGAQESFQIYVTGFPVPSLECDSLEV--EGPRKIWDEPRGGTHAFLVTVDGVTQQHLTTFICEASNEAGSEIKEITFTVAPAKPVILSPNWTSHADYYLVHWRTHSRVPLENVTLEVEEYNSNSTAGPVTQSNRKLFYSLDPNTMDKNEVSLLAPGDNKQQVEILSTGPWEQLVWHHLSNLSANTDHILSVTVCNKYDCASSVIDSVTDNPSMFTFRTAEYNGSNKIKPGLL 478          
BLAST of Opioid-binding protein/cell adhesion molecule vs. TrEMBL
Match: A0A5J4NKU3 (Ig-like domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0013257 PE=4 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 2.776e-30
Identity = 104/418 (24.88%), Postives = 194/418 (46.41%), Query Frame = 3
Query:  147 TIQSTQGDGLAILAGDIRIKMLIK----GDVIEQDINA--FKSKNPS---YTVERKNDILCM--VKEISEKEDDKFSFKC-IILEKGFGKSLNEETHKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIWRT--------ESNPNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILKPANLIITSPNGTEFSSCYMLSWTMNSKSPXX---------XXXXXXXXXXXXXXXXRKT-----------VKSSELSTFRKVEGIKKN--KWLNEFSYIFFNLTSNETYTVTLQICNKHEC 1274
            T++ +  + L +  G  RI+ LI+      V+  + N   F S++     Y +++  + LC+  V+  S K DDK +F C  I   G G    EE  +IR++  ++ I + +   VA         C A+G PDL++ WR+        ++ PN TS     +L +  +  + +G  + C+A  S P  +   +     L++   P+I++ + +IHTDLG  E+  I V G P P++ C   ++   + ++       +++Y   ID ITQ ++ T+ C   N+ G   + + L   P+  +I SP+  E +  YML+W + S++P+            +  +      S  +RK            V++S  +   + EG   N  +W +   +   NL+ +  + ++L++CN H C
Sbjct:   14 TLRFSGNEALVLSIGRHRIQTLIRNPATSSVVRYEGNQKDFLSEHAGWNVYPLDKPGEQLCVYKVRGASIKHDDKMTFICDTIKNMGLGAITMEERIQIRVFRPVRIIDQTDTIGVAE-NSTASLFCHASGFPDLQLHWRSKTTGDILNQTEPNPTSSETELQLILPSVEKQQHGQLFECDARTSYP-ADTYPVRGISKLEVYLPPKINVTSRVIHTDLGARESVEILVSGYPTPELVCDGFHLTEPRQVSKQQIGG-TFVYSAVIDNITQAHLTTFHCEASNDLGITNETIELTTAPSEPVILSPSQAEMADYYMLNWKVRSRAPLKNVTVEIEEFTSSNISNPMVPRSPRVRKIVYPLTPNNQNDVRTSVWAPSGQAEGSVSNQGRWEHVVWHHVANLSEDTEHGISLKVCNAHAC 428          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Cavefish
Match: neo1a (neogenin-like [Source:NCBI gene;Acc:103031419])

HSP 1 Score: 54.6842 bits (130), Expect = 2.417e-7
Identity = 57/220 (25.91%), Postives = 95/220 (43.18%), Query Frame = 3
Query:  327 EDDKFSFKCIILEKGFGKSLNEETHKIRIYEELKFIKKLNEKFVARV-GEDLEEECSAAGSPDLKVIWRTESNPNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQFSYIYQ--MTIDKITQQNIGTYQCNVENEEG--KATKQVSLI 971
            E+D   ++C++   G  K+  E   ++ I  E KF+K+     V+RV G+ +   C   G P   V W  +  P +  GS    LQI  LT E  GM Y C A     +    +I     L ++  PQ     +        +  F  +V G+P P I         +   ++  +D F  + +  + +  + + + G YQC  ENE G  +AT Q+ ++
Sbjct:  200 EEDAGLYRCVLENAGPTKTSEEA--ELTILPEFKFLKQPGP--VSRVAGDSVLLPCVVTGYPAAYVRWMLDDQPVLGGGS----LQIFNLTEEDAGM-YRCLA-----ENMNDSIEAQAELTVQVPPQFLKRPVSTFAHEATDIVFECEVTGSPAPTIKW------VKNGDSVIPSDYFRIMKEQNLQVQGLVKSDEGFYQCLAENEAGNIQATAQLVIL 399          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Cavefish
Match: ENSAMXT00000033537.1 (pep primary_assembly:Astyanax_mexicanus-2.0:6:27646037:27658799:-1 gene:ENSAMXG00000043229.1 transcript:ENSAMXT00000033537.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 1.065e-6
Identity = 55/220 (25.00%), Postives = 91/220 (41.36%), Query Frame = 3
Query:  333 DKFSFKCIILEK-GFGKSLNEETHKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIWR------TESNPNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQFSYIYQ-MTIDKITQQNIGTYQCNVENEEGKATKQVSL 968
            D+  ++C+     G G++L      +R+      +  L + F    G+++   CSA+GSP  KV W        E++  VT    T  L I     E  G  Y C A+      E GT +QS+TL     P I     ++  ++G +        G P P +    L +          T Q   I+  + I K+ + + G Y C   N+ G ++ +V+L
Sbjct:  448 DEGVYECVARSAAGVGRALT----NLRVTTPGVAVFPLTQSFSR--GDEVHLSCSASGSPTPKVHWSHNGIQLIENHMTVTQ---TGTLTIKDTQPEDAG-DYRCTAT-----NEAGTDSQSVTLSYA-PPSIYAAQTVVIAEVGRQAVLECTATGVPNPVVKWRKLEL---------GTVQLDSIHGVLHIRKVQESDAGEYVCEASNQAGSSSARVTL 642          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Cavefish
Match: mag (myelin-associated glycoprotein-like [Source:NCBI gene;Acc:103031217])

HSP 1 Score: 52.373 bits (124), Expect = 1.118e-6
Identity = 43/176 (24.43%), Postives = 79/176 (44.89%), Query Frame = 3
Query:  468 GEDLEEECSAAGSPDLKVIWRTESNPNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILKPANLII 995
            G  +   C    +P  ++ W       ++  +  A L +  LT E  G+ YTC     +     G +N S+ L +R+ P+  +    +    G         +GNP P +   L +   E V TIT  +    +  + + +IT Q  GTY+C  ENE G+A+  +++ ++ A +++
Sbjct:  254 GSSVTLHCDVDSNPAPRISWHFGDEELMSETASNASLFLESLTPEQEGV-YTC-----VGDNGYGAMNTSMYLAVRYPPREPLVNESLTVQEGSTIALHCSTQGNPAPTLTW-LKD--GELVGTITAEE----VNVLELLEITPQVDGTYRCLAENEHGRASSSLNITVEFAPILL 416          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Cavefish
Match: mag (myelin-associated glycoprotein-like [Source:NCBI gene;Acc:103031217])

HSP 1 Score: 52.373 bits (124), Expect = 1.124e-6
Identity = 43/176 (24.43%), Postives = 79/176 (44.89%), Query Frame = 3
Query:  468 GEDLEEECSAAGSPDLKVIWRTESNPNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILKPANLII 995
            G  +   C    +P  ++ W       ++  +  A L +  LT E  G+ YTC     +     G +N S+ L +R+ P+  +    +    G         +GNP P +   L +   E V TIT  +    +  + + +IT Q  GTY+C  ENE G+A+  +++ ++ A +++
Sbjct:  254 GSSVTLHCDVDSNPAPRISWHFGDEELMSETASNASLFLESLTPEQEGV-YTC-----VGDNGYGAMNTSMYLAVRYPPREPLVNESLTVQEGSTIALHCSTQGNPAPTLTW-LKD--GELVGTITAEE----VNVLELLEITPQVDGTYRCLAENEHGRASSSLNITVEFAPILL 416          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Cavefish
Match: ntrk2a (neurotrophic receptor tyrosine kinase 2 [Source:NCBI gene;Acc:103036414])

HSP 1 Score: 50.8322 bits (120), Expect = 2.450e-6
Identity = 45/174 (25.86%), Postives = 69/174 (39.66%), Query Frame = 3
Query:  468 GEDLEEECSAAGSPDLKVIWRTE---SNPNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQID--IETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEK----VMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQV 962
            G +L   C A+G+P   + W      S   + +   ++ L I  L++  N  K  C A     +   G    ++ LD+RF P I   ++ +  H            V GNPQPK+       P E+       I D  +  Y   + +D  T  N G Y    EN  GK +K +
Sbjct:  208 GSNLTVTCKASGTPTPDLKWNISQLVSKYKIVTSGQSSVLSIFHLSSLDNEFKVICSA-----ENIAGESEATLQLDVRFPPTISKLMDAIPDH-----HWCIPFSVSGNPQPKLSWLCSGKPVEEGEYISTRIHDYSEHEYHGCLQLDSPTHVNNGRYTLQAENVYGKDSKSI 371          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Nematostella
Match: EDO29229 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T484])

HSP 1 Score: 54.299 bits (129), Expect = 9.024e-8
Identity = 45/168 (26.79%), Postives = 81/168 (48.21%), Query Frame = 3
Query:  270 YTVERKNDILCMVKEISEKEDDKFSFKCIILEKGFGKSLNEETHKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIW--RTESNPNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRF---KPQIDIETLIIHTDLGFEET 758
            Y     N+I   +K +  K  D+ S+K  I E     ++ E +  + + E   F   LN  +     +D+   CSA+G P   V W  +T  +P VT G+ TA L + ++     G+ Y C+A   + +   G I Q IT+++++   + ++++  L +H   GF +T
Sbjct:   90 YYGNSTNNITFEIKNV--KVGDEGSYKVTIRENIAPTTIIERSGMLTVLEAPAFTSSLNSTYDIAENDDVTVTCSASGRPAPNVTWVNKTSGSP-VTHGTGTATLSLLKIQRHQAGV-YQCQAINDVGR---GAITQDITINVQYDLSEHKLNVLDLTLHLVDGFIKT 250          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Nematostella
Match: EDO29616 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T347])

HSP 1 Score: 49.6766 bits (117), Expect = 2.482e-6
Identity = 36/128 (28.12%), Postives = 61/128 (47.66%), Query Frame = 3
Query:  426 KFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIW--RTESNPNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRI--KVKGNPQPKI 797
             F   L+        +D+   CSA+G P   V W  +T  +P V  G+ +A L + ++     G+ Y C+A   + +G    I Q +T+ +++ P+I   T I +T +   ET  +   V GNP P +
Sbjct:  119 AFTSSLSSSLDVAENDDVTNTCSASGRPAPNVTWVNKTSGSP-VAHGTGSATLSLLKIQRHQAGL-YQCQAINDVGRGA---ITQDVTIIVQYPPEI---TPIQNTTVRAGETITLTCAVAGNPTPSV 238          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Nematostella
Match: EDO29925 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T292])

HSP 1 Score: 48.1358 bits (113), Expect = 6.604e-6
Identity = 49/195 (25.13%), Postives = 80/195 (41.03%), Query Frame = 3
Query:  468 GEDLEEECSAAGSPDLKVIWRTE------SNPNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVK----GNPQPKIDCPLLNIPAEKVMTITDTDQFSYIYQ-MTIDKITQQNIGTYQCNVENEEGKATKQVSLILKPANLIITSPNGTEF 1019
            G ++   C+ +G P   + W  +      +N  V +G     L I+ +T  + G  Y CEA     K  +G   +  T+ +   P++   T +  T L   E     V     G P P+I          K+    D  + SY  Q + I  +   + GTY C+  NEEG+    V++I++ A  +   P   EF
Sbjct:   89 GNEVSLNCNTSGIPAPSITWYRQDGGYMPANHRVVNG----DLIISNITKSLEG-TYVCEA-----KNVLGARTKEATVSVNIAPRL---TSLHKTPLTIIENSTAVVPCTSTGFPTPEISW-------SKIGNSMDVSRMSYDSQALIIKDVRYSDRGTYVCSATNEEGRVNGTVTVIVQVAPRVHQQPKAIEF 263          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Nematostella
Match: EDO34079 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQH0])

HSP 1 Score: 46.595 bits (109), Expect = 7.211e-6
Identity = 47/182 (25.82%), Postives = 71/182 (39.01%), Query Frame = 3
Query:  462 RVGEDLEEECSAAGSPDLKVIWRTESNPNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGK--ATKQVSLILKPANLIITS 1001
            R GE +   C+ AG+P   V W    + + TSG+   K    +     +  +Y C A ++   G   T   S  + +++KP I    L    D    ET           K+ C     PA  V    D    S       + +T+   GTY C   NE G    T QV++  KP  + +T+
Sbjct:    5 RAGETITLTCAVAGNPTPSVFWSKAGSGHSTSGNVFTKASATK----ADTGQYVCTA-VNTVTGNTQTRTASTYVMVKYKPSI----LSKSPDQTVNETTG-------SLKLTCNSDGYPAPTVTWSRDGQVVSRTSVYNSNSVTRSEAGTYMCTATNEMGSDTTTVQVTVNYKPEMVSLTT 170          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Nematostella
Match: EDO45383 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT26])

HSP 1 Score: 48.1358 bits (113), Expect = 7.347e-6
Identity = 41/159 (25.79%), Postives = 66/159 (41.51%), Query Frame = 3
Query:  468 GEDLEEECSAAGSPDLKVIWRTESNPNVTSGSPT-----AKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNV 929
            G+ ++ EC   G+P   V W    +   TS  P        L I  + + ++   Y+C AS      E+G I+    LD+R+ P+          + G+  TF    KGNP P +   L N     + T  D   +S    + I  + + + G Y+CN 
Sbjct:   11 GQVVKFECQTTGNPSPNVTWLKSGSAVNTSVDPRFYSNDTILMITNV-SRIDSGTYSCNAS-----NELGIISAEAALDVRYGPEFVNVPQDKTPNEGWSVTFECHTKGNPPPTVTW-LKN--GSALNTSVDPRFYSNGTHLMITNVNRTDSGAYRCNA 160          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Medaka
Match: ENSORLT00000007507.2 (pep primary_assembly:ASM223467v1:13:13107916:13110068:1 gene:ENSORLG00000028696.1 transcript:ENSORLT00000007507.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 6.315e-7
Identity = 56/242 (23.14%), Postives = 93/242 (38.43%), Query Frame = 3
Query:  324 KEDDKFSFKCIILEKGFGKSLNEETHKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIWRTESNPNVTSGS-PTAKLQINR-------LTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETF-RIKVKGNPQPKIDCPLLNIPAEKVMT---ITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKA--TKQVSLILKPANLIITSPN 1007
            +  D   F C+    G    +  +     I     F    NE+ V+R G+ +   CSA GSP  +++W   +   +T G+   +   +N         + + +  KY C A     K  +G + + I L+I  KP I      I   +  E  F      G+P P+I      +P    +T   +    Q      + +   T  + G Y C   N+ G+A  T  V +I  P  +   SP+
Sbjct:  313 RATDTAEFICMARNSGGETVMIVQLEVANILRRPIFDNPFNERIVSRTGKTIILNCSAHGSPKPEIVWTLPNGTRLTVGAYHGSHHHLNNDGTLVIYNSQKGDSGKYRCGA-----KNNLGYVEKLIILNIGHKPYILTRPRGIIRGMSGEPIFLHCLSDGSPSPRI---FWTLPGGHTLTRPQVLGRYQLVENGTLVVKDTTLNDRGNYVCKAHNDAGEAVLTIPVVIIAYPPRITSGSPS 546          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Medaka
Match: ENSORLT00000026801.1 (neurofascin [Source:NCBI gene;Acc:101164207])

HSP 1 Score: 51.6026 bits (122), Expect = 2.333e-6
Identity = 47/167 (28.14%), Postives = 78/167 (46.71%), Query Frame = 3
Query:  468 GEDLEEECSAAGSPDLKVIWRTESNPNVTSGSPTAK-----LQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKP-QIDIETLIIHTDLGFEETFRI--KVKGNPQPKIDCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEG 944
            GE+L  EC AAG P   + W  + +    + S   K     +QI +   E  G +YTC A+      ++G I  +I++ ++  P  ++  T +I   L  EET R+  +  G P+P I   +   P E  M    +++      +T+  +T +N   YQCN  N+ G
Sbjct:  264 GEELLLECIAAGVPTPHIAWTKDGDELAVTPSMKIKNFNKMIQIPKAAFEDAG-EYTCSAT-----NKIGYIEHTISVIVKAAPFWVEKPTNLI---LAPEETGRLVCRSDGVPRPTISWFMNGDPIEDAMQ--QSNRLVAGDTITLRSVTAENTAVYQCNASNQYG 419          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Medaka
Match: chl1b (cell adhesion molecule L1 like [Source:NCBI gene;Acc:101166545])

HSP 1 Score: 50.447 bits (119), Expect = 5.245e-6
Identity = 43/188 (22.87%), Postives = 79/188 (42.02%), Query Frame = 3
Query:  468 GEDLEEECSAAGSPDLKVIWRT--ESNPNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILKPANLIITSPNGTEFSS 1025
            GEDL+ EC A G P  KV W       P         K+ +     +  G KY C+A     K  +G +    T+ +   P+  +E     + +G +   +  V G+PQP     +  +P ++ ++    ++  +   + I      +   YQC   N+ GK     ++++     II + +G E+S+
Sbjct:  265 GEDLKLECIAEGIPTPKVEWEKMGHGRPEKFRLENHGKVLVVPGDEQDVGGKYMCKA-----KNPLGEVVHYFTVTVEEPPEFLVEPQSQLSMIGADVVIKCSVSGSPQPVTTWSVNGVPLQETLS---ANRKIFDDTIIIQNGQPSDSAVYQCEASNKHGKILTNANIMIMNLYPIILTSDGQEYSA 444          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Medaka
Match: chl1b (cell adhesion molecule L1 like [Source:NCBI gene;Acc:101166545])

HSP 1 Score: 50.0618 bits (118), Expect = 6.907e-6
Identity = 43/188 (22.87%), Postives = 79/188 (42.02%), Query Frame = 3
Query:  468 GEDLEEECSAAGSPDLKVIWR--TESNPNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILKPANLIITSPNGTEFSS 1025
            GEDL+ EC A G P  KV W       P         K+ +     +  G KY C+A     K  +G +    T+ +   P+  +E     + +G +   +  V G+PQP     +  +P ++ ++    ++  +   + I      +   YQC   N+ GK     ++++     II + +G E+S+
Sbjct:  271 GEDLKLECIAEGIPTPKVEWEKMGHGRPEKFRLENHGKVLVVPGDEQDVGGKYMCKA-----KNPLGEVVHYFTVTVEEPPEFLVEPQSQLSMIGADVVIKCSVSGSPQPVTTWSVNGVPLQETLS---ANRKIFDDTIIIQNGQPSDSAVYQCEASNKHGKILTNANIMIMNLYPIILTSDGQEYSA 450          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Medaka
Match: chl1b (cell adhesion molecule L1 like [Source:NCBI gene;Acc:101166545])

HSP 1 Score: 50.0618 bits (118), Expect = 7.301e-6
Identity = 43/188 (22.87%), Postives = 79/188 (42.02%), Query Frame = 3
Query:  468 GEDLEEECSAAGSPDLKVIWR--TESNPNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILKPANLIITSPNGTEFSS 1025
            GEDL+ EC A G P  KV W       P         K+ +     +  G KY C+A     K  +G +    T+ +   P+  +E     + +G +   +  V G+PQP     +  +P ++ ++    ++  +   + I      +   YQC   N+ GK     ++++     II + +G E+S+
Sbjct:  263 GEDLKLECIAEGIPTPKVEWEKMGHGRPEKFRLENHGKVLVVPGDEQDVGGKYMCKA-----KNPLGEVVHYFTVTVEEPPEFLVEPQSQLSMIGADVVIKCSVSGSPQPVTTWSVNGVPLQETLS---ANRKIFDDTIIIQNGQPSDSAVYQCEASNKHGKILTNANIMIMNLYPIILTSDGQEYSA 442          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Planmine SMEST
Match: SMESG000026220.1 (SMESG000026220.1)

HSP 1 Score: 923.694 bits (2386), Expect = 0.000e+0
Identity = 473/475 (99.58%), Postives = 474/475 (99.79%), Query Frame = 3
Query:   42 MKFYLLEFFTFILIIKESISIEHGVKLGSKIDICCTIQSTQGDGLAILAGDIRIKMLIKGDVIEQDINAFKSKNPSYTVERKNDILCMVKEISEKEDDKFSFKCIILEKGFGKSLNEETHKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIWRTESNPNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILKPANLIITSPNGTEFSSCYMLSWTMNSKSPXXXXXXXXXXXXXXXXXXRKTVKSSELSTFRKVEGIKKNKWLNEFSYIFFNLTSNETYTVTLQICNKHECIIFENGAFFRTGPSDGNKCDPDRLYSNLDLKNPKSDCRNIKPSLLFVCTQSIILFLVPLLLQQA 1466
            MKFYLLEFFTFILIIKESISIEHGVKLGSKIDICCTIQSTQGDGLAILAGDIRIKMLIKGDVIEQDINAFKSKNPSYTVERKNDILCMVKEISEKEDDKFSFKCIILEKGFGKSLNEETHKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIWRTESNPNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILKPANLIITSPNGTEFSSCYMLSWTMNSKSPITNFTITTKSNNNNSTFIRKTVKSSELSTFRKVEG K+NKWLNEFSYIFFNLTSNETYTVTLQICNKHECIIFENGAFFRTGPSDGNKCDPDRLYSNLDLKNPKSDCRNIKPSLLFVCTQSIILFLVPLLLQQA
Sbjct:    1 MKFYLLEFFTFILIIKESISIEHGVKLGSKIDICCTIQSTQGDGLAILAGDIRIKMLIKGDVIEQDINAFKSKNPSYTVERKNDILCMVKEISEKEDDKFSFKCIILEKGFGKSLNEETHKIRIYEELKFIKKLNEKFVARVGEDLEEECSAAGSPDLKVIWRTESNPNVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILKPANLIITSPNGTEFSSCYMLSWTMNSKSPITNFTITTKSNNNNSTFIRKTVKSSELSTFRKVEGNKENKWLNEFSYIFFNLTSNETYTVTLQICNKHECIIFENGAFFRTGPSDGNKCDPDRLYSNLDLKNPKSDCRNIKPSLLFVCTQSIILFLVPLLLQQA 475          
BLAST of Opioid-binding protein/cell adhesion molecule vs. Planmine SMEST
Match: SMESG000021248.1 (SMESG000021248.1)

HSP 1 Score: 60.077 bits (144), Expect = 4.981e-9
Identity = 47/175 (26.86%), Postives = 77/175 (44.00%), Query Frame = 3
Query:  468 GEDLEEECSAAGSPDLKVIWRTESNP-----NVTSGSPTAKLQINRLTAEMNGMKYTCEASISIPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQPKIDCPLLNIPAEKVMTITDTDQFSYIYQ---MTIDKITQQNIGTYQCNVENEEGKATKQVSL 968
            G+     CSA G P  K+ W    +P     N+        L INR+   M G ++ C A+        G+  +S  LDI F P+I      I    G   T R +V+G+P P++   L  I     + I   D++ +I Q   + I  ++ ++   Y C+ +N+ GK  + V +
Sbjct:  741 GDQQTVRCSANGVPQPKITWEFNGSPVTIDGNIIINETIGTLDINRIEKNMKG-QWVCVAT-----NNAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGHPPPRVKW-LRGIAGGYNIPIALGDRY-FINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQI 907          

HSP 2 Score: 49.2914 bits (116), Expect = 9.105e-6
Identity = 38/127 (29.92%), Postives = 61/127 (48.03%), Query Frame = 3
Query:  618 YTCEASISIPKGEMGTINQSITLDIRFKPQI--DIETLIIHTDLGFEETFRIKVKGNPQPKIDC-----PLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEEGKATKQVSLILK 977
            YTC     I K ++GT    I LD++ KP I  D +T I   D G     + + KG+P+PKI+      PL   P  +++   D  Q      +T+  IT+++ GT+ C   N+     K+  + +K
Sbjct:  983 YTC-----IAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKD-GDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQ------LTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVK 1097          
The following BLAST results are available for this feature:
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ICAM54.498e-923.45intercellular adhesion molecule 5 [Source:HGNC Sym... [more]
TTN2.362e-624.76titin [Source:HGNC Symbol;Acc:HGNC:12403][more]
TTN2.362e-624.76titin [Source:HGNC Symbol;Acc:HGNC:12403][more]
TTN2.465e-624.76titin [Source:HGNC Symbol;Acc:HGNC:12403][more]
TTN2.924e-624.76titin [Source:HGNC Symbol;Acc:HGNC:12403][more]
back to top
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rig-53.852e-820.61NeuRonal IGCAM [Source:UniProtKB/TrEMBL;Acc:H2FLI... [more]
rig-54.025e-820.61NeuRonal IGCAM [Source:UniProtKB/TrEMBL;Acc:H2FLI... [more]
rig-54.158e-820.61NeuRonal IGCAM [Source:UniProtKB/TrEMBL;Acc:H2FLI... [more]
rig-56.918e-820.61NeuRonal IGCAM [Source:UniProtKB/TrEMBL;Acc:H2FLI... [more]
back to top
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG343531.503e-1527.32gene:FBgn0085382 transcript:FBtr0305292[more]
CG343531.503e-1527.32gene:FBgn0085382 transcript:FBtr0112563[more]
CG343531.648e-1527.32gene:FBgn0085382 transcript:FBtr0339321[more]
klg3.231e-1124.64gene:FBgn0017590 transcript:FBtr0084337[more]
CG71665.175e-926.05gene:FBgn0037107 transcript:FBtr0301161[more]
back to top
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hmcn23.809e-625.73hemicentin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-9765... [more]
back to top
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chmp39.548e-925.82charged multivesicular body protein 3 [Source:Xenb... [more]
bloc1s12.415e-626.36biogenesis of lysosomal organelles complex 1 subun... [more]
bloc1s12.660e-626.36biogenesis of lysosomal organelles complex 1 subun... [more]
fkbp152.735e-624.30FKBP prolyl isomerase 15 [Source:Xenbase;Acc:XB-GE... [more]
eftud22.996e-622.65elongation factor Tu GTP binding domain containing... [more]
back to top
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ttn6.042e-824.90titin [Source:MGI Symbol;Acc:MGI:98864][more]
Ttn1.287e-725.76titin [Source:MGI Symbol;Acc:MGI:98864][more]
Ttn1.543e-724.90titin [Source:MGI Symbol;Acc:MGI:98864][more]
Ttn1.543e-724.90titin [Source:MGI Symbol;Acc:MGI:98864][more]
Ttn1.800e-724.90titin [Source:MGI Symbol;Acc:MGI:98864][more]
back to top
BLAST of Opioid-binding protein/cell adhesion molecule vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UMF0|ICAM5_HUMAN2.160e-823.45Intercellular adhesion molecule 5 OS=Homo sapiens ... [more]
sp|Q26474|LACH_SCHAM1.642e-726.52Lachesin OS=Schistocerca americana OX=7009 GN=LAC ... [more]
sp|Q28730|ICAM5_RABIT2.218e-726.00Intercellular adhesion molecule 5 OS=Oryctolagus c... [more]
sp|Q24372|LACH_DROME6.548e-725.54Lachesin OS=Drosophila melanogaster OX=7227 GN=Lac... [more]
sp|A2ASS6|TITIN_MOUSE1.314e-624.90Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1[more]
back to top
BLAST of Opioid-binding protein/cell adhesion molecule vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3NQS81.159e-4026.58Peroxidasin homolog OS=Schistocephalus solidus OX=... [more]
A0A5K3FGA03.377e-3827.62Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3FC694.431e-3528.07Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A4V3SF061.964e-3124.17Ig-like domain-containing protein OS=Opisthorchis ... [more]
A0A5J4NKU32.776e-3024.88Ig-like domain-containing protein OS=Paragonimus w... [more]
back to top
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
neo1a2.417e-725.91neogenin-like [Source:NCBI gene;Acc:103031419][more]
ENSAMXT00000033537.11.065e-625.00pep primary_assembly:Astyanax_mexicanus-2.0:6:2764... [more]
mag1.118e-624.43myelin-associated glycoprotein-like [Source:NCBI g... [more]
mag1.124e-624.43myelin-associated glycoprotein-like [Source:NCBI g... [more]
ntrk2a2.450e-625.86neurotrophic receptor tyrosine kinase 2 [Source:NC... [more]
back to top
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO292299.024e-826.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO296162.482e-628.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO299256.604e-625.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340797.211e-625.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453837.347e-625.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Opioid-binding protein/cell adhesion molecule vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000007507.26.315e-723.14pep primary_assembly:ASM223467v1:13:13107916:13110... [more]
ENSORLT00000026801.12.333e-628.14neurofascin [Source:NCBI gene;Acc:101164207][more]
chl1b5.245e-622.87cell adhesion molecule L1 like [Source:NCBI gene;A... [more]
chl1b6.907e-622.87cell adhesion molecule L1 like [Source:NCBI gene;A... [more]
chl1b7.301e-622.87cell adhesion molecule L1 like [Source:NCBI gene;A... [more]
back to top
BLAST of Opioid-binding protein/cell adhesion molecule vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000026220.10.000e+099.58SMESG000026220.1[more]
SMESG000021248.14.981e-926.86SMESG000021248.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014091 ID=SMED30014091|Name=Opioid-binding protein/cell adhesion molecule|organism=Schmidtea mediterranea sexual|type=transcript|length=1664bp
TTTAGATTGAATTAATAAATTTTGTATTATACATTTCTAAAATGAAATTT
TATCTATTAGAATTTTTTACTTTTATTTTAATTATTAAAGAATCTATCTC
TATTGAACATGGTGTAAAACTCGGTAGTAAAATAGACATATGCTGTACAA
TACAATCCACTCAAGGCGACGGGTTGGCAATCTTAGCGGGAGATATTAGA
ATAAAAATGTTAATAAAAGGTGATGTTATAGAACAAGATATTAATGCTTT
CAAATCAAAAAATCCCAGTTACACCGTGGAAAGAAAGAATGACATTTTGT
GTATGGTGAAGGAGATTTCCGAGAAAGAAGATGATAAATTTTCATTTAAA
TGCATCATCTTGGAAAAAGGATTTGGCAAGTCATTGAATGAGGAAACTCA
CAAAATTCGAATATACGAAGAATTGAAGTTTATTAAAAAGCTAAATGAGA
AATTTGTGGCGAGAGTCGGTGAGGATTTAGAAGAAGAATGTTCGGCTGCA
GGTAGTCCGGATTTGAAAGTGATTTGGCGAACAGAGTCAAATCCAAATGT
GACTTCTGGAAGTCCGACAGCAAAGCTTCAAATAAACCGGTTGACAGCAG
AGATGAACGGGATGAAATATACATGTGAGGCATCAATAAGTATTCCAAAG
GGAGAAATGGGCACAATTAATCAATCTATCACTCTTGATATCCGATTCAA
ACCACAGATCGACATTGAAACTCTCATTATTCATACTGATCTCGGTTTTG
AGGAAACATTTAGGATAAAAGTTAAGGGAAATCCTCAGCCGAAAATTGAT
TGTCCATTGTTGAATATTCCGGCGGAAAAGGTCATGACGATCACTGACAC
GGATCAGTTTTCATACATTTATCAGATGACCATTGATAAAATCACTCAGC
AGAACATTGGCACTTATCAGTGCAATGTTGAAAACGAAGAGGGAAAAGCT
ACCAAACAAGTATCATTAATTTTGAAACCTGCCAACCTCATAATCACCTC
TCCCAATGGCACCGAATTTAGCAGTTGCTACATGTTGTCGTGGACCATGA
ATTCCAAATCGCCAATTACCAATTTTACAATTACTACGAAATCAAATAAT
AATAATTCAACTTTCATACGTAAAACGGTAAAATCAAGTGAATTGAGTAC
ATTTAGGAAAGTTGAAGGAATCAAAAAAAATAAATGGCTGAATGAGTTTT
CATATATATTTTTTAATCTTACCAGTAATGAAACTTATACAGTTACTCTA
CAAATATGTAATAAGCACGAATGTATTATTTTTGAAAATGGAGCATTCTT
TAGAACAGGACCATCAGACGGTAATAAATGTGATCCAGATAGGTTGTACT
CGAATTTGGATTTAAAAAACCCCAAAAGTGACTGCAGGAATATAAAACCA
TCTTTGTTGTTTGTTTGCACTCAATCAATCATTCTGTTTTTAGTACCTCT
TTTATTGCAGCAAGCTTTTTAGAGATCAAGTTGTTGTTACCAGAGATCTA
GCTGATTTTCAATTATACCAGAGGTTCAAGATGGCTGACTGTCTTGGTGT
ATCTGTCGGTTTTTGCTGATTTATTTCATCCCTTAATGACTTTTAACTCC
ATGACCCATCGAAATTCGGTATCAGTTTTGTGTCTCTTTTGGTCAACATT
GCTACATTAATAAT
back to top

protein sequence of SMED30014091-orf-1

>SMED30014091-orf-1 ID=SMED30014091-orf-1|Name=SMED30014091-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=477bp
MKFYLLEFFTFILIIKESISIEHGVKLGSKIDICCTIQSTQGDGLAILAG
DIRIKMLIKGDVIEQDINAFKSKNPSYTVERKNDILCMVKEISEKEDDKF
SFKCIILEKGFGKSLNEETHKIRIYEELKFIKKLNEKFVARVGEDLEEEC
SAAGSPDLKVIWRTESNPNVTSGSPTAKLQINRLTAEMNGMKYTCEASIS
IPKGEMGTINQSITLDIRFKPQIDIETLIIHTDLGFEETFRIKVKGNPQP
KIDCPLLNIPAEKVMTITDTDQFSYIYQMTIDKITQQNIGTYQCNVENEE
GKATKQVSLILKPANLIITSPNGTEFSSCYMLSWTMNSKSPITNFTITTK
SNNNNSTFIRKTVKSSELSTFRKVEGIKKNKWLNEFSYIFFNLTSNETYT
VTLQICNKHECIIFENGAFFRTGPSDGNKCDPDRLYSNLDLKNPKSDCRN
IKPSLLFVCTQSIILFLVPLLLQQAF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR036116FN3_sf
IPR003599Ig_sub
IPR013783Ig-like_fold
IPR013098Ig_I-set
IPR007110Ig-like_dom
IPR003961FN3_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005216ion channel activity
GO:0005249voltage-gated potassium channel activity
GO:0005267potassium channel activity
GO:0015222serotonin transmembrane transporter activity
Vocabulary: cellular component
TermDefinition
GO:0005887integral component of plasma membrane
GO:0008076voltage-gated potassium channel complex
GO:0016020membrane
GO:0016021integral component of membrane
GO:0098793presynapse
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0006813potassium ion transport
GO:0006837serotonin transport
GO:0015842aminergic neurotransmitter loading into synaptic vesicle
GO:0055085transmembrane transport
GO:0071805potassium ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 227..312
e-value: 63.0
score: 4.5
coord: 135..218
e-value: 0.09
score: 21.9
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 218..316
e-value: 1.2E-8
score: 37.0
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 124..217
e-value: 8.7E-8
score: 34.0
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 317..412
e-value: 1.7E-5
score: 26.8
IPR013098Immunoglobulin I-setPFAMPF07679I-setcoord: 230..310
e-value: 3.6E-9
score: 36.6
NoneNo IPR availablePANTHERPTHR45080FAMILY NOT NAMEDcoord: 24..409
NoneNo IPR availablePANTHERPTHR45080:SF14KLINGONcoord: 24..409
NoneNo IPR availableCDDcd00096Igcoord: 149..214
e-value: 1.28753E-4
score: 38.3773
NoneNo IPR availableCDDcd00096Igcoord: 239..308
e-value: 4.35732E-4
score: 36.8365
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.509
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 143..214
score: 8.03
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 130..310
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 312..409