Glutamate receptor ionotropic, NMDA 3A

Overview
NameGlutamate receptor ionotropic, NMDA 3A
Smed IDSMED30014085
Length (bp)2751
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glutamate receptor ionotropic, NMDA 3A (SMED30014085) t-SNE clustered cells

Violin plots show distribution of expression levels for Glutamate receptor ionotropic, NMDA 3A (SMED30014085) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glutamate receptor ionotropic, NMDA 3A (SMED30014085) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glutamate receptor ionotropic, NMDA 3A (SMED30014085) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014085

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30014085h1SMcG0007905 SmedASXL_014900SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30014085h1SMcG0007905 dd_Smed_v4_18414_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014085h1SMcG0007905 dd_Smed_v4_18414_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30014085h1SMcG0007905 dd_Smed_v4_18414_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30014085h1SMcG0007905 dd_Smed_v6_18414_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Human
Match: GRIN3A (glutamate ionotropic receptor NMDA type subunit 3A [Source:HGNC Symbol;Acc:HGNC:16767])

HSP 1 Score: 166.777 bits (421), Expect = 1.721e-41
Identity = 107/411 (26.03%), Postives = 196/411 (47.69%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQEPDFILASTS---GTSHIS--------IFLEKHPYLRNKIFYVKTETEGKVALRN--KQVTAFLSEELVLR---NTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQK------YTQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKFTSDLKGFKK-SHWIFSDHVMY 2351
            KCCYG+ + LL ++  DM+FD  LY + D KYG+  NG W GL+ +++   A +   + ++   R++ IDFT PF +   G+L++ +  +    A   P    +W+ I +  ++    L+ +EW SPFGL PKGR+R + ++  S +   Y L F +T   K PK +  +F  N+W  FC+   S Y  N+ A ++   + +  S +  +P     S     GT   S         F E H Y+R   + V    +G   L+N  +++ AF+ ++ +L    + D     L +     +  + IG+P ++     +S+ +  Y  +G++  +L +       C ++        QM  K+F+ LF +L   F +  +  + EH+ +      +K   K  +W+ +   ++
Sbjct:  574 KCCYGYCIDLLEKIAEDMNFDFDLYIVGDGKYGAWKNGHWTGLVGDLLRGTAHMAVTSFSINTARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWTMWLGIFVALHITAVFLTLYEWKSPFGLTPKGRNRSKVFSFSSALNICYALLFGRTVAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGI-HDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRR--YNVPATPDGVEYLKNDPEKLDAFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTANISELISQYKSHGFMD-MLHDKWYRVVPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYRLLLPRIKNKSKLQYWLHTSQRLH 980          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Human
Match: GRIN3B (glutamate ionotropic receptor NMDA type subunit 3B [Source:HGNC Symbol;Acc:HGNC:16768])

HSP 1 Score: 157.918 bits (398), Expect = 1.101e-38
Identity = 104/420 (24.76%), Postives = 196/420 (46.67%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDL--MQEPDF----------ILASTSGTSHI-SIFLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLR---NTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQKY------TQMKYKNFTSLFHVLLCAFPICFIILMVEHVFF-YKFTSDLKGFKKSHWIFSDHVMYFSQINQEPK 2378
            KCCYG+ + LL RL  D  FD  LY + D KYG+L +G W GL+ +++  RA +   + ++   R++ +DFT PF +   G++++ +  +    A   P     W+ +    ++    L+ +EW SP+GL P+GR+R   ++  S +   Y + FR+T   K+PK    +   N+W  FC+++ S Y  N+ A ++     KTF +L  + +P             +  +S  ++I   F + H ++R             +     ++ AF+ ++ +L    + D     L +     +  + IG+P+++   + LS+++  Y  +G+I  LL +       C ++        QM   +F  LF +L        +  + EH FF        KG +  +W+ +   ++ + +N EP 
Sbjct:  474 KCCYGYCIDLLERLAEDTPFDFELYLVGDGKYGALRDGRWTGLVGDLLAGRAHMAVTSFSINSARSQVVDFTSPFFSTSLGIMVRARDTASPIGAFMWPLHWSTWLGVFAALHLTALFLTVYEWRSPYGLTPRGRNRSTVFSYSSALNLCYAILFRRTVSSKTPKCPTGRLLMNLWAIFCLLVLSSYTANLAAVMVG---DKTFEELSGIHDPKLHHPAQGFRFGTVWESSAEAYIKKSFPDMHAHMRRHSAPTTPRGVAMLTSDPPKLNAFIMDKSLLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLTSNLSEFISRYKSSGFID-LLHDKWYKMVPCGKRVFAVTETLQMSIYHFAGLFVLLCLGLGSALLSSLGEHAFFRLALPRIRKGSRLQYWLHTSQKIHRA-LNTEPP 888          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Human
Match: GRIN2B (glutamate ionotropic receptor NMDA type subunit 2B [Source:HGNC Symbol;Acc:HGNC:4586])

HSP 1 Score: 138.272 bits (347), Expect = 1.915e-32
Identity = 94/405 (23.21%), Postives = 190/405 (46.91%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILI-ALWCYVAGFALSSFEWLSPFGLN---PKGRH-RKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQE---------PDFILAST-SGTSHISI---FLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLRNTDYCPNRLEILNYLGVAP--------FAIGVPKDAWYRNELSKYLLIYDFNGY-----------ISHLLKNMMLASRECPQKYTQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKF 2291
            KCC GF + +L ++   + F   LY + + K+G  +NG+WNG++ E++++RA +   +LT+  +R++ +DF++PF      V++     + +  A   PFS  +W+++  +   V+  A+  FE+ SP G N     GR     ++ +G  +  ++ L F  + P ++PK   +K   +VW  F ++  + Y  N+ A +I+       S L  +         P F   +  +G++  +I   + E H Y+    F  +   +  ++L+  ++ AF+ +  VL   +Y   R E    + +          + I + KD+ ++ ++   +L    +G            I H  KN +++S        Q+   N   +F++L  A  +  I  + EH+F+++F
Sbjct:  455 KCCKGFCIDILKKISKSVKFTYDLYLVTNGKHGKKINGTWNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSRSNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYVDQVSGLSDKKFQRPNDFSPPFRFGTVPNGSTERNIRNNYAEMHAYMGK--FNQRGVDDALLSLKTGKLDAFIYDAAVL---NYMAGRDEGCKLVTIGSGKVFASTGYGIAIQKDSGWKRQVDLAILQLFGDGEMEELEALWLTGICHNEKNEVMSS--------QLDIDNMAGVFYMLGAAMALSLITFICEHLFYWQF 846          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Human
Match: GRIN2A (glutamate ionotropic receptor NMDA type subunit 2A [Source:HGNC Symbol;Acc:HGNC:4585])

HSP 1 Score: 134.806 bits (338), Expect = 1.839e-31
Identity = 97/411 (23.60%), Postives = 188/411 (45.74%), Query Frame = 3
Query: 1164 NQRMDVELKCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILI-ALWCYVAGFALSSFEWLSPFGLN---PKGRH-RKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQE---------PDFILASTSGTSHISIFLEKHPYLRNKI--FYVKTETEGKVALRNKQVTAFLSEELVLRNTDYCPNRLEILNYLGVAP--------FAIGVPKDAWYRNELSKYLLIYDFNGY-----------ISHLLKNMMLASRECPQKYTQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKF 2291
            N+ M+V+ KCC GF + +L +L   + F   LY + + K+G  VN  WNG++ E++ +RA +   +LT+  +R++ +DF++PF      V++     + +  A   PFS  +W+++  +   V+  A+  FE+ SP G N    KG+     ++ +G  +  ++ L F  + P ++PK   +K   +VW  F ++  + Y  N+ A +I+       + L  +         P F   +    S        +PY+   +  F  K   +  V+L+  ++ AF+ +  VL   +Y   R E    + +          + I + K + ++ ++   LL +  +G            I H  KN +++S        Q+   N   +F++L  A  +  I  + EH+F++K 
Sbjct:  310 NEGMNVK-KCCKGFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPYMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVL---NYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLTGICHNEKNEVMSS--------QLDIDNMAGVFYMLAAAMALSLITFIWEHLFYWKL 708          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Human
Match: GRIN2A (glutamate ionotropic receptor NMDA type subunit 2A [Source:HGNC Symbol;Acc:HGNC:4585])

HSP 1 Score: 134.806 bits (338), Expect = 1.883e-31
Identity = 97/411 (23.60%), Postives = 188/411 (45.74%), Query Frame = 3
Query: 1164 NQRMDVELKCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILI-ALWCYVAGFALSSFEWLSPFGLN---PKGRH-RKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQE---------PDFILASTSGTSHISIFLEKHPYLRNKI--FYVKTETEGKVALRNKQVTAFLSEELVLRNTDYCPNRLEILNYLGVAP--------FAIGVPKDAWYRNELSKYLLIYDFNGY-----------ISHLLKNMMLASRECPQKYTQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKF 2291
            N+ M+V+ KCC GF + +L +L   + F   LY + + K+G  VN  WNG++ E++ +RA +   +LT+  +R++ +DF++PF      V++     + +  A   PFS  +W+++  +   V+  A+  FE+ SP G N    KG+     ++ +G  +  ++ L F  + P ++PK   +K   +VW  F ++  + Y  N+ A +I+       + L  +         P F   +    S        +PY+   +  F  K   +  V+L+  ++ AF+ +  VL   +Y   R E    + +          + I + K + ++ ++   LL +  +G            I H  KN +++S        Q+   N   +F++L  A  +  I  + EH+F++K 
Sbjct:  447 NEGMNVK-KCCKGFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPYMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVL---NYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLTGICHNEKNEVMSS--------QLDIDNMAGVFYMLAAAMALSLITFIWEHLFYWKL 845          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Celegans
Match: nmr-2 (NMDA class glutamate Receptor [Source:UniProtKB/TrEMBL;Acc:E0AHC1])

HSP 1 Score: 142.895 bits (359), Expect = 1.709e-34
Identity = 101/411 (24.57%), Postives = 192/411 (46.72%), Query Frame = 3
Query: 1185 LKCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWC-YVAGFALSSFEWLSPFGLN----PKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVK----KTFSDLM------QEPDFILAST-SGTSHISI---FLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLRNTDYCPNR------LEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQKYTQ-----MKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKFTSDLKGFKKSHW 2327
            LKCC G+ V LL +L  D+ F   LY ++D K+G      WNGL+ +++  +A +   +L +  +R + IDF++PF      ++++ +    +  A   PF    W++I   C +VA  ++  FEW+SP+  N    P   H+   ++L      V+   F  +     PKS  ++    VW  F +   ++Y  N+ A +I T V+        D M      Q+P F   +   G +H ++   + + H Y+++  ++    + G  A++N+++ AF+ + +VL   DY   +      + +  +  +  + IG PK++ + + ++ Y+L Y   G +   L+N  L     P  ++Q     +  +NF S F +L     +  I+L  EH++       L+    + W
Sbjct:  514 LKCCSGYCVDLLNKLANDIGFTYTLYKVRDEKWGLKTENGWNGLIADLMHNKADMCVTSLKLNSERARDIDFSLPFLDTGISIIVKIRSGVLSPTAFLEPFEYSTWVIILFVCIHVAAISIFLFEWVSPYSFNMQKYPPPEHK---FSLFRSYWLVWATLFSASVSTDVPKSTVSRLMALVWAAFGLTFLAVYTANLAAFMI-TRVQYYDLSGIHDPMLNFPHDQKPPFRFGTVDGGNTHETMKRNWHKMHEYVKHNKYFRMNISAGIEAVKNEELDAFIYDAVVL---DYWAGKDANCALMTVGKWASMTGYGIGFPKNSPHTSLVNHYMLQYQQKGDLER-LQNFWLTGACTPDSHSQTQSAPLGIENFLSAFVLLAGGIIVSVIVLGFEHIYCMHLRKPLQKIDPNGW 916          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Celegans
Match: nmr-2 (NMDA class glutamate Receptor [Source:UniProtKB/TrEMBL;Acc:E0AHC1])

HSP 1 Score: 99.3673 bits (246), Expect = 9.348e-22
Identity = 81/360 (22.50%), Postives = 162/360 (45.00%), Query Frame = 3
Query: 1338 RAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWC-YVAGFALSSFEWLSPFGLN----PKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVK----KTFSDLM------QEPDFILAST-SGTSHISI---FLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLRNTDYCPNR------LEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQKYTQ-----MKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKFTSDLKGFKKSHW 2327
            +A +   +L +  +R + IDF++PF      ++++ +    +  A   PF    W++I   C +VA  ++  FEW+SP+  N    P   H+   ++L      V+   F  +     PKS  ++    VW  F +   ++Y  N+ A +I T V+        D M      Q+P F   +   G +H ++   + + H Y+++  ++    + G  A++N+++ AF+ + +VL   DY   +      + +  +  +  + IG PK++ + + ++ Y+L Y   G +   L+N  L     P  ++Q     +  +NF S F +L     +  I+L  EH++       L+    + W
Sbjct:    4 KADMCVTSLKLNSERARDIDFSLPFLDTGISIIVKIRSGVLSPTAFLEPFEYSTWVIILFVCIHVAAISIFLFEWVSPYSFNMQKYPPPEHK---FSLFRSYWLVWATLFSASVSTDVPKSTVSRLMALVWAAFGLTFLAVYTANLAAFMI-TRVQYYDLSGIHDPMLNFPHDQKPPFRFGTVDGGNTHETMKRNWHKMHEYVKHNKYFRMNISAGIEAVKNEELDAFIYDAVVL---DYWAGKDANCALMTVGKWASMTGYGIGFPKNSPHTSLVNHYMLQYQQKGDLER-LQNFWLTGACTPDSHSQTQSAPLGIENFLSAFVLLAGGIIVSVIVLGFEHIYCMHLRKPLQKIDPNGW 355          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Celegans
Match: glr-5 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:O01623])

HSP 1 Score: 94.3597 bits (233), Expect = 2.028e-19
Identity = 96/404 (23.76%), Postives = 160/404 (39.60%), Query Frame = 3
Query: 1200 GFSVRLLIRLMIDMDFDVVLYSIKDYKYGS--LVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFR---PFSTHIWILIALWCYVAGFAL------SSFEW--------------LSPFGLNPKGR-HRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVK---KTFSDLMQEPDFILASTSGTSHISIFLEKH--------PYLRNKIFYVKTETEG-KVALRNKQVTAFLSEELVLRNTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASR--ECPQKYTQMKYKNF-------TSLFHVLLCAFPICFIILMVE 2270
            GF + LL  L  D+ F   ++++KD KYG+    NGSW+G+M EI+   A++    LTV Y R++ +DFT PF +   G+ I  K+       +F    P S  IW  IA         +      + +EW               + F  N +       NY+  + V  V +   +    F  P++   +     W  F +VI S Y  N+ A +  +      K   DL  +      +  G S +  F E           Y+++K  +V +  +G + AL         S  L       C N  +I   LG   + I + K + + + +S+ +L+Y   G I  + K     S+   C    + +K+  F         LF  L     +  I+++ E
Sbjct:  467 GFCIDLLAELSKDLGFTYTIHAVKDGKYGNDKYGNGSWDGMMGEILRGEAEMAVAPLTVNYRRSEAVDFTKPFLS--LGISILYKVPDDQQPDLFSFLNPLSWQIWTAIATSIITVTLGMYFVANVTPYEWNLNFSCCTAHEPHPAAAFATNQEAPIVMSNNYSFWNTVWYVLSTMLKGGCDF-GPRAVSTRLLGGTWWVFYLVIISAYTANLAAVLTVSRPYIPIKNLDDLANQTTISYGTIRGGSTMQFFQESRIAAHVKMWQYMKDKDVFVTSNGKGVERALSMNYAYLMESTSLEYETQQNC-NLTQIGGVLGSKGYGIALAKKSEWTDRISRQILLYAKRGIIE-MKKTKWWRSKGAACASTASAVKHDRFALSMYNVAGLFITLGVGIVLAAIVVIFE 865          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Celegans
Match: glr-6 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q8MXV8])

HSP 1 Score: 83.9593 bits (206), Expect = 2.759e-16
Identity = 107/421 (25.42%), Postives = 178/421 (42.28%), Query Frame = 3
Query: 1200 GFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGS--WNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPF-HAGKFGVLIQDKIKSYTDDAVFR-PFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIA--TVIETNVK-KTFSDLMQEPDFILASTSGTSHISIF----LEKHPYLRNKI------FYVKTETEG-KVALRNKQVTAFLSEELVLRNTDYCPNRLEILN-YLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLAS-REC----PQK-YTQMKYKNFTSLFHVLLCAFPICFIILMVEH---VFFYKFTSDLKGFKKSHWIFSDHVMYFSQINQEPK 2378
            GF V LL +L   + F+  L  +KD KYG   NG+  W+G++ EI+   A +    +TVT  R + IDFT PF   G   ++ Q   KS +    F  P S  +W   A+   +    ++    LSP       +     + + + V  +  +  R    +   ++   +    VW  F +V+ + Y  N  A  TV   ++   +F +L  + ++   S  G S +  F    +E    L  ++       +V T  EG    L  K V    S  L  + T  C N   + N  LG   ++I +PK + +R +L++ +L  +  G I  L  N    S +EC    P+   T +  +N   LF +L     I  +  ++EH   +FF K   + +  K    I + H    ++I   PK
Sbjct:  436 GFCVDLLDKLAEMLHFNYTLKIVKDNKYGERKNGTDEWDGMIGEILRGDADMAVAPITVTATRLEVIDFTDPFLQLGISMLMRQPNPKSSSSLTRFLWPLSASVWTFSAIATVITALLVTVAAVLSP-------KESTAEFKIQNSVWYLVCILLRAGSGYNC-QAGATRLISAVWWSFTLVLIAQYTANFAALLTVDRKSMPFNSFEELGNQTEYNFGSILGGSTMQFFKYSRIETFRRLWERMQSAEPSAFVGTNHEGVNRVLNEKYVFLMESATLDYQVTQNC-NLTRVGNVVLGSNGYSIALPKGSKWREKLTRQILDLNEKGIILMLKNNWWKKSQQECQSSEPEDLQTALGAENVYGLFLLLALGSGIGVLCAVLEHTHFIFFEKNKRNGQTPKLQQMIETIH----AEIRNSPK 843          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Celegans
Match: glr-3 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q21415])

HSP 1 Score: 77.0258 bits (188), Expect = 4.696e-14
Identity = 77/384 (20.05%), Postives = 164/384 (42.71%), Query Frame = 3
Query: 1200 GFSVRLLIRLMIDMDFDVVLYSIKDYKYGSL-VNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPF-HAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKS-----PKSYPAKFFQNVWTCFCIVIFSMYINNIIATV----IETNVKKTFSDLMQEPDFILASTSGTSHISIFLEKHPYLRNKIF---------YVKTETEGKVALRNKQVTAFLSEELVLRNTDYCPNR----LEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASR---ECPQKYTQMKYKNFTSLFHVLLCAFPICFIILMVE 2270
            G+ + LL ++   + F   +  ++D  YGS   NG W+G++ E+    A L   +LT++Y R++ IDFT+P+ H G   +  + +I+         P ST +WI+     +V   A+     +SP+    +     +   + +  +   + +F      +      P++   +    +W  F +++ S Y  N+ A +    +ET ++    DL  +      +    S +S F E       +++         +V++  EG   +++    A+L E  +L   +Y   R    ++I   +    + IG+PK + YR  +S  +L       ++ L +          E P++  Q   ++   +F +L+    +  ++++ E
Sbjct:  424 GYCIDLLHKIANILKFTYTIQKVRDNAYGSKESNGKWSGMVGELQRGDADLAVASLTISYGRSEVIDFTVPYMHLGISILFKKPRIRDSDWFKFMDPLSTQVWIMTFASYFVVSVAIWIIAKISPYEQFERDEDNGQYKPVDNQFSLRNSFWFTVCSLMQQGSELCPRAASTRLLTGIWWFFALILISSYTANLAAVLTTRRMETPIENA-DDLAAQTKIKYGTLGRGSTMSFFNESKIETYERMWQLMSSSPGLFVQSSKEGIARVKSSDY-AYLMESSML---EYAVERDCELMQIGGLIDQKGYGIGLPKGSPYRELISTAILRLQEKTELTELKEKWWKDKSVVCEQPKRKDQDDGESIGGIFIILVVGLVLTAVLVIFE 802          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Fly
Match: Nmdar2 (gene:FBgn0053513 transcript:FBtr0091453)

HSP 1 Score: 125.176 bits (313), Expect = 6.729e-29
Identity = 101/396 (25.51%), Postives = 182/396 (45.96%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWC-YVAGFALSSFEWLSPFGLNPKGRHRKRN-----YNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDL---------MQEPDFILAS-----TSGTSHISIFLEKHPYLRNKIFYVKTE-TEGKVALRNKQVTAFLSEELVLRNTDYCPNRLE------ILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLAS-RECPQKYTQ---MKYKNFTSLFHVLLCAFPICFIILMVEHVFF 2282
            +CC GF + LL +   ++ F   L  ++D K+G+L NG WNGL+ +++ R+  +V  +L +  +R   +DF+ PF      +++  +    +  A   PF T  W+L+ +     A F +  FEWLSP G + K   +  N     ++L      V+ + F+      SP+ + ++F  NVW  F +V  ++Y  N+ A +I       FS L           +P F   +     T  T H   F   H Y+R    Y KT   +G  A+ N  + +F+ +  VL   DY   + E      + ++  +  + +   +++ Y    +K LL +  NG +  L +  M  + R   Q++     +  + F S F +L+    +  ++L++EHV+F
Sbjct:  380 QCCSGFCIDLLEKFAEELGFTYELVRVEDGKWGTLENGKWNGLIADLVNRKTDMVLTSLMINTEREAVVDFSEPFMETGIAIVVAKRTGIISPTAFLEPFDTASWMLVGIVAIQAATFMIFLFEWLSPSGYDMKLYLQNTNVTPYRFSLFRTYWLVWAVLFQAAVHVDSPRGFTSRFMTNVWALFAVVFLAIYTANLAAFMITREEFHEFSGLNDSRLVHPFSHKPSFKFGTIPYSHTDSTIH-KYFNVMHNYMRQ---YNKTSVADGVAAVLNGNLDSFIYDGTVL---DYLVAQDEDCRLMTVGSWYAMTGYGLAFSRNSKYVQMFNKRLLEFRANGDLERLRRYWMTGTCRPGKQEHKSSDPLALEQFLSAFLLLMAGILLAALLLLLEHVYF 768          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Fly
Match: Nmdar2 (gene:FBgn0053513 transcript:FBtr0301842)

HSP 1 Score: 125.176 bits (313), Expect = 6.729e-29
Identity = 101/396 (25.51%), Postives = 182/396 (45.96%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWC-YVAGFALSSFEWLSPFGLNPKGRHRKRN-----YNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDL---------MQEPDFILAS-----TSGTSHISIFLEKHPYLRNKIFYVKTE-TEGKVALRNKQVTAFLSEELVLRNTDYCPNRLE------ILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLAS-RECPQKYTQ---MKYKNFTSLFHVLLCAFPICFIILMVEHVFF 2282
            +CC GF + LL +   ++ F   L  ++D K+G+L NG WNGL+ +++ R+  +V  +L +  +R   +DF+ PF      +++  +    +  A   PF T  W+L+ +     A F +  FEWLSP G + K   +  N     ++L      V+ + F+      SP+ + ++F  NVW  F +V  ++Y  N+ A +I       FS L           +P F   +     T  T H   F   H Y+R    Y KT   +G  A+ N  + +F+ +  VL   DY   + E      + ++  +  + +   +++ Y    +K LL +  NG +  L +  M  + R   Q++     +  + F S F +L+    +  ++L++EHV+F
Sbjct:  380 QCCSGFCIDLLEKFAEELGFTYELVRVEDGKWGTLENGKWNGLIADLVNRKTDMVLTSLMINTEREAVVDFSEPFMETGIAIVVAKRTGIISPTAFLEPFDTASWMLVGIVAIQAATFMIFLFEWLSPSGYDMKLYLQNTNVTPYRFSLFRTYWLVWAVLFQAAVHVDSPRGFTSRFMTNVWALFAVVFLAIYTANLAAFMITREEFHEFSGLNDSRLVHPFSHKPSFKFGTIPYSHTDSTIH-KYFNVMHNYMRQ---YNKTSVADGVAAVLNGNLDSFIYDGTVL---DYLVAQDEDCRLMTVGSWYAMTGYGLAFSRNSKYVQMFNKRLLEFRANGDLERLRRYWMTGTCRPGKQEHKSSDPLALEQFLSAFLLLMAGILLAALLLLLEHVYF 768          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Fly
Match: Nmdar2 (gene:FBgn0053513 transcript:FBtr0091454)

HSP 1 Score: 125.176 bits (313), Expect = 6.729e-29
Identity = 101/396 (25.51%), Postives = 182/396 (45.96%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWC-YVAGFALSSFEWLSPFGLNPKGRHRKRN-----YNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDL---------MQEPDFILAS-----TSGTSHISIFLEKHPYLRNKIFYVKTE-TEGKVALRNKQVTAFLSEELVLRNTDYCPNRLE------ILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLAS-RECPQKYTQ---MKYKNFTSLFHVLLCAFPICFIILMVEHVFF 2282
            +CC GF + LL +   ++ F   L  ++D K+G+L NG WNGL+ +++ R+  +V  +L +  +R   +DF+ PF      +++  +    +  A   PF T  W+L+ +     A F +  FEWLSP G + K   +  N     ++L      V+ + F+      SP+ + ++F  NVW  F +V  ++Y  N+ A +I       FS L           +P F   +     T  T H   F   H Y+R    Y KT   +G  A+ N  + +F+ +  VL   DY   + E      + ++  +  + +   +++ Y    +K LL +  NG +  L +  M  + R   Q++     +  + F S F +L+    +  ++L++EHV+F
Sbjct:  380 QCCSGFCIDLLEKFAEELGFTYELVRVEDGKWGTLENGKWNGLIADLVNRKTDMVLTSLMINTEREAVVDFSEPFMETGIAIVVAKRTGIISPTAFLEPFDTASWMLVGIVAIQAATFMIFLFEWLSPSGYDMKLYLQNTNVTPYRFSLFRTYWLVWAVLFQAAVHVDSPRGFTSRFMTNVWALFAVVFLAIYTANLAAFMITREEFHEFSGLNDSRLVHPFSHKPSFKFGTIPYSHTDSTIH-KYFNVMHNYMRQ---YNKTSVADGVAAVLNGNLDSFIYDGTVL---DYLVAQDEDCRLMTVGSWYAMTGYGLAFSRNSKYVQMFNKRLLEFRANGDLERLRRYWMTGTCRPGKQEHKSSDPLALEQFLSAFLLLMAGILLAALLLLLEHVYF 768          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Fly
Match: Nmdar2 (gene:FBgn0053513 transcript:FBtr0301843)

HSP 1 Score: 124.79 bits (312), Expect = 8.695e-29
Identity = 101/396 (25.51%), Postives = 182/396 (45.96%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWC-YVAGFALSSFEWLSPFGLNPKGRHRKRN-----YNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDL---------MQEPDFILAS-----TSGTSHISIFLEKHPYLRNKIFYVKTE-TEGKVALRNKQVTAFLSEELVLRNTDYCPNRLE------ILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLAS-RECPQKYTQ---MKYKNFTSLFHVLLCAFPICFIILMVEHVFF 2282
            +CC GF + LL +   ++ F   L  ++D K+G+L NG WNGL+ +++ R+  +V  +L +  +R   +DF+ PF      +++  +    +  A   PF T  W+L+ +     A F +  FEWLSP G + K   +  N     ++L      V+ + F+      SP+ + ++F  NVW  F +V  ++Y  N+ A +I       FS L           +P F   +     T  T H   F   H Y+R    Y KT   +G  A+ N  + +F+ +  VL   DY   + E      + ++  +  + +   +++ Y    +K LL +  NG +  L +  M  + R   Q++     +  + F S F +L+    +  ++L++EHV+F
Sbjct:  419 QCCSGFCIDLLEKFAEELGFTYELVRVEDGKWGTLENGKWNGLIADLVNRKTDMVLTSLMINTEREAVVDFSEPFMETGIAIVVAKRTGIISPTAFLEPFDTASWMLVGIVAIQAATFMIFLFEWLSPSGYDMKLYLQNTNVTPYRFSLFRTYWLVWAVLFQAAVHVDSPRGFTSRFMTNVWALFAVVFLAIYTANLAAFMITREEFHEFSGLNDSRLVHPFSHKPSFKFGTIPYSHTDSTIH-KYFNVMHNYMRQ---YNKTSVADGVAAVLNGNLDSFIYDGTVL---DYLVAQDEDCRLMTVGSWYAMTGYGLAFSRNSKYVQMFNKRLLEFRANGDLERLRRYWMTGTCRPGKQEHKSSDPLALEQFLSAFLLLMAGILLAALLLLLEHVYF 807          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Fly
Match: Nmdar2 (gene:FBgn0053513 transcript:FBtr0070288)

HSP 1 Score: 124.79 bits (312), Expect = 1.089e-28
Identity = 101/396 (25.51%), Postives = 182/396 (45.96%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWC-YVAGFALSSFEWLSPFGLNPKGRHRKRN-----YNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDL---------MQEPDFILASTSGTSHISIFLEK-----HPYLRNKIFYVKTE-TEGKVALRNKQVTAFLSEELVLRNTDYCPNRLE------ILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLAS-RECPQKYTQ---MKYKNFTSLFHVLLCAFPICFIILMVEHVFF 2282
            +CC GF + LL +   ++ F   L  ++D K+G+L NG WNGL+ +++ R+  +V  +L +  +R   +DF+ PF      +++  +    +  A   PF T  W+L+ +     A F +  FEWLSP G + K   +  N     ++L      V+ + F+      SP+ + ++F  NVW  F +V  ++Y  N+ A +I       FS L           +P F    T   SH    + K     H Y+R    Y KT   +G  A+ N  + +F+ +  VL   DY   + E      + ++  +  + +   +++ Y    +K LL +  NG +  L +  M  + R   Q++     +  + F S F +L+    +  ++L++EHV+F
Sbjct:  561 QCCSGFCIDLLEKFAEELGFTYELVRVEDGKWGTLENGKWNGLIADLVNRKTDMVLTSLMINTEREAVVDFSEPFMETGIAIVVAKRTGIISPTAFLEPFDTASWMLVGIVAIQAATFMIFLFEWLSPSGYDMKLYLQNTNVTPYRFSLFRTYWLVWAVLFQAAVHVDSPRGFTSRFMTNVWALFAVVFLAIYTANLAAFMITREEFHEFSGLNDSRLVHPFSHKPSFKFG-TIPYSHTDSTIHKYFNVMHNYMRQ---YNKTSVADGVAAVLNGNLDSFIYDGTVL---DYLVAQDEDCRLMTVGSWYAMTGYGLAFSRNSKYVQMFNKRLLEFRANGDLERLRRYWMTGTCRPGKQEHKSSDPLALEQFLSAFLLLMAGILLAALLLLLEHVYF 949          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Zebrafish
Match: grin3bb (glutamate receptor, ionotropic, N-methyl-D-aspartate 3Bb [Source:ZFIN;Acc:ZDB-GENE-131122-77])

HSP 1 Score: 170.629 bits (431), Expect = 4.264e-43
Identity = 101/380 (26.58%), Postives = 185/380 (48.68%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQEPDFILASTSGTSHISI----FLEKHPYLRNKIFYVKTETEGKVALRN--KQVTAFLSEELVLR---NTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQKY------TQMKYKNFTSLFHVLLCAFPICFIILMVEHVFF 2282
            KCCYG+ + LL +L  DM+F+  LY + D KYG++  G W GL+ +++   A +   + ++   R+K IDFT PF +   G+L++ K  +    A   P    +W+ I +  ++    L+ +EW SPFG+ P GR+R + ++  S +   Y + F +T   K+PK +  +F  N+W  FC+++ S Y  N+ A ++     +  S +     F   +   +S        F E H Y+R   F   T  +G   L+    Q+ AF+ ++ +L    + D     L +     +  + IG+P+++   + +S+++  Y  +GY+  +L +       C ++        QM  ++F+ LF +L        + L  EH F+
Sbjct:  364 KCCYGYCIDLLEKLSEDMNFEFDLYIVGDGKYGAVKGGQWTGLVGDLLSGVADMAVTSFSINSARSKVIDFTSPFFSTSLGILVRSKDTAAPIGAFMWPLHWSMWMGIFVALHITALFLTLYEWKSPFGMTPHGRNRVKVFSYSSALNLCYAILFGRTVSSKTPKCWTGRFLMNLWAIFCLLVLSSYTANLAAVMVGEKTFEEVSGIHDAKGFRFGTVRESSAEDYMKKSFPEMHEYMRK--FNEPTTPDGVATLKTDPPQLDAFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLTSNISEFVSRYKSDGYMD-MLHDKWYKVVPCGKRVFAVTETLQMGIRHFSGLFVLLCVGVTGALLTLAGEHAFY 740          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Zebrafish
Match: grin3bb (glutamate receptor, ionotropic, N-methyl-D-aspartate 3Bb [Source:ZFIN;Acc:ZDB-GENE-131122-77])

HSP 1 Score: 168.703 bits (426), Expect = 1.158e-42
Identity = 107/389 (27.51%), Postives = 190/389 (48.84%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQEPDFILASTS-----GTSHIS--------IFLEKHPYLRNKIFYVKTETEGKVALRN--KQVTAFLSEELVLR---NTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQKY------TQMKYKNFTSLFHVLLCAFPICFIILMVEHVFF 2282
            KCCYG+ + LL +L  DM+F+  LY + D KYG++  G W GL+ +++   A +   + ++   R+K IDFT PF +   G+L++ K  +    A   P    +W+ I +  ++    L+ +EW SPFG+ P GR+R + ++  S +   Y + F +T   K+PK +  +F  N+W  FC+++ S Y  N+ A ++    +KTF ++    D  L   S     GT   S         F E H Y+R   F   T  +G   L+    Q+ AF+ ++ +L    + D     L +     +  + IG+P+++   + +S+++  Y  +GY+  +L +       C ++        QM  ++F+ LF +L        + L  EH F+
Sbjct:  362 KCCYGYCIDLLEKLSEDMNFEFDLYIVGDGKYGAVKGGQWTGLVGDLLSGVADMAVTSFSINSARSKVIDFTSPFFSTSLGILVRSKDTAAPIGAFMWPLHWSMWMGIFVALHITALFLTLYEWKSPFGMTPHGRNRVKVFSYSSALNLCYAILFGRTVSSKTPKCWTGRFLMNLWAIFCLLVLSSYTANLAAVMVG---EKTFEEVSGIHDAKLHHPSQGFRFGTVRESSAEDYMKKSFPEMHEYMRK--FNEPTTPDGVATLKTDPPQLDAFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLTSNISEFVSRYKSDGYMD-MLHDKWYKVVPCGKRVFAVTETLQMGIRHFSGLFVLLCVGVTGALLTLAGEHAFY 744          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Zebrafish
Match: grin3ba (glutamate receptor, ionotropic, N-methyl-D-aspartate 3Ba [Source:ZFIN;Acc:ZDB-GENE-070912-354])

HSP 1 Score: 168.703 bits (426), Expect = 2.544e-42
Identity = 108/389 (27.76%), Postives = 189/389 (48.59%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQEPDFILASTS-----GTSHIS--------IFLEKHPYLRNKIFYVKTETEGKVALRN--KQVTAFLSEELVLR---NTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQKY------TQMKYKNFTSLFHVLLCAFPICFIILMVEHVFF 2282
            KCCYG+ + LL +L  DM F+  LY + D KYG+   G W+GL+ +++   A +   + ++   R++ IDFT PF +   G+L++ K  +    A   P    +W+ I +  ++    ++ +EW SPFG+ P GR+R R ++  S +   Y + F +T   K+PK +  +F  N+W  FC+++ S Y  N+ A ++    +KTF ++    D  L   S     GT   S         F E H Y+R   F   T  +G   L+    Q+ AF+ ++ +L    + D     L +     +  + IG+P+++     +S+Y+  Y  +GY+  +L +       C ++        QM  ++F+ LF +L        + L+ EH FF
Sbjct:  556 KCCYGYCIDLLEKLAEDMHFEFDLYIVGDGKYGAWKGGRWSGLVGDLLSGVADMAVTSFSINSARSRVIDFTSPFFSTSLGILVRSKDTAAPIGAFMWPLHWSMWVGIFVALHITALFITLYEWNSPFGMTPHGRNRIRVFSYSSALNLCYAILFGRTVASKTPKCWTGRFLMNLWAIFCLLVLSSYTANLAAVMVG---EKTFEEVSGIHDVKLHHPSLGFRFGTVRESSAEDYVKKSFPEMHEYMRR--FNKPTTPDGVSTLKTDPPQLDAFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLTRNVSEYVSRYKSDGYMD-MLHDKWYKVVPCGKRVFAVTETLQMGIQHFSGLFVLLCVGVAGALLTLLGEHAFF 938          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Zebrafish
Match: grin3a (glutamate receptor, ionotropic, N-methyl-D-aspartate 3A [Source:ZFIN;Acc:ZDB-GENE-130530-780])

HSP 1 Score: 152.525 bits (384), Expect = 3.510e-37
Identity = 108/401 (26.93%), Postives = 183/401 (45.64%), Query Frame = 3
Query: 1128 VTLLNEAFKSQRNQRMDVEL---KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDL--MQEPDFILASTS---GTSHIS--------IFLEKHPYLRNKIFYVKTETEGKVALRN--KQVTAFLSEELVLRNTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQKYTQMKYKNFTSLFHVLLCAFPICFIILMVEHV 2276
              LL   F+  +     V L   KCCYG+ + LL +L  DM FD  LY + D KYG+  NG W GL+ +++   A L   + ++   R++ IDFT PF +   G+L++ +  +    A   P    +W+ I +  +V    L+ +EW SPFG+ P+GR+R R ++  S +   Y + F +T   K PK +  +F  N+W  FC+   S Y  N+ A ++    +KT+  L  + +P     S     GT   S         F E H Y+R   +   T  +G   L++  +++ AF+ +    +N+    N  E+++      F + +  D WY     K +     +  ++  L               QM  K+F+ LF +L     +  +  + EH+
Sbjct:  563 TALLESLFQGLQGANDTVPLEFKKCCYGYCIDLLEKLAEDMGFDFDLYIVGDGKYGAYKNGRWTGLVGDLMSGAAHLAVTSFSINSARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWSMWLGIFVSLHVTAVFLTLYEWKSPFGMTPRGRNRDRVFSFSSALNVCYAILFGRTAAIKPPKCWTGRFLMNLWAIFCLFCLSTYTANLAAVMVG---EKTYEQLSGIHDPKLHHPSQGFRFGTVRESSAEDYVKKSFPEMHEYMRR--YNAPTTPDGIDHLKDDPQKLDAFIMD----KNSPLTSNISELVSQYKSDGF-MDMLHDKWY-----KVVPCGKRSFAVTETL---------------QMGIKHFSGLFVMLCVGVALSLLTTLGEHI 933          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Zebrafish
Match: grin3a (glutamate receptor, ionotropic, N-methyl-D-aspartate 3A [Source:ZFIN;Acc:ZDB-GENE-130530-780])

HSP 1 Score: 152.14 bits (383), Expect = 4.268e-37
Identity = 108/401 (26.93%), Postives = 183/401 (45.64%), Query Frame = 3
Query: 1128 VTLLNEAFKSQRNQRMDVEL---KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDL--MQEPDFILASTS---GTSHIS--------IFLEKHPYLRNKIFYVKTETEGKVALRN--KQVTAFLSEELVLRNTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQKYTQMKYKNFTSLFHVLLCAFPICFIILMVEHV 2276
              LL   F+  +     V L   KCCYG+ + LL +L  DM FD  LY + D KYG+  NG W GL+ +++   A L   + ++   R++ IDFT PF +   G+L++ +  +    A   P    +W+ I +  +V    L+ +EW SPFG+ P+GR+R R ++  S +   Y + F +T   K PK +  +F  N+W  FC+   S Y  N+ A ++    +KT+  L  + +P     S     GT   S         F E H Y+R   +   T  +G   L++  +++ AF+ +    +N+    N  E+++      F + +  D WY     K +     +  ++  L               QM  K+F+ LF +L     +  +  + EH+
Sbjct:  553 TALLESLFQGLQGANDTVPLEFKKCCYGYCIDLLEKLAEDMGFDFDLYIVGDGKYGAYKNGRWTGLVGDLMSGAAHLAVTSFSINSARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWSMWLGIFVSLHVTAVFLTLYEWKSPFGMTPRGRNRDRVFSFSSALNVCYAILFGRTAAIKPPKCWTGRFLMNLWAIFCLFCLSTYTANLAAVMVG---EKTYEQLSGIHDPKLHHPSQGFRFGTVRESSAEDYVKKSFPEMHEYMRR--YNAPTTPDGIDHLKDDPQKLDAFIMD----KNSPLTSNISELVSQYKSDGF-MDMLHDKWY-----KVVPCGKRSFAVTETL---------------QMGIKHFSGLFVMLCVGVALSLLTTLGEHI 923          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Xenopus
Match: nup155 (nucleoporin 155kDa [Source:Xenbase;Acc:XB-GENE-973827])

HSP 1 Score: 172.17 bits (435), Expect = 2.836e-43
Identity = 115/431 (26.68%), Postives = 206/431 (47.80%), Query Frame = 3
Query: 1134 LLNEAFKSQR--NQRMDVELK-CCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQEPDFILASTS---GTSHIS--------IFLEKHPYLRNKIFYVKTETEGKVALRN--KQVTAFLSEELVLR---NTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHL----LKNMMLASRECPQKYT-QMKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKFTSDLKGFKK-SHWIFSDHVMY 2351
            +L+  F+S +  N  + +E K CCYG+ + LL +L  DM+FD  LY + D KYG+  NG W GL+ +++   A L   + ++   R++ IDFT PF +   G+L++ K  +    A   P    +W+ I +  ++    L+ +EW SPFGL P GR+R + ++  S +   Y + F +T   K+PK +  +F  N+W  FC+   S Y  N+ A ++   + +  S +  +P     S     GT   S         F E H Y+R   +   + +EG   L+N  + + AF+ ++ +L    + D     L +     +  + IG+P ++   + +S+ +  Y  +G++  L     K +    R      T QM   +F+ LF +L   F +  +  + EH+ F      +K   K  +W+ +   ++
Sbjct:  565 VLDSLFESLQGGNDSVPIEFKKCCYGYCIDLLEKLAEDMNFDFDLYIVGDGKYGAWKNGHWTGLVGDLLSGAAHLAVTSFSINTARSQVIDFTSPFFSTSLGILVRTKDTAAPIGAFMWPLHWTMWLGIFVSLHITAIFLTLYEWKSPFGLTPNGRNRSKVFSFSSALNVCYAILFGRTAAIKTPKCWTGRFLMNLWAIFCLFCLSTYTANLAAVMVGEKIYEELSGI-HDPKLHHPSQGFRFGTVRESSAEDYVKKSFPEMHEYMRR--YNAPSTSEGVTFLKNDPEALDAFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTSNISELVSQYKSSGFMDSLHDKWYKVVPCGKRSFAVTETLQMGITHFSGLFVMLCIGFGLSILTTIGEHIVFRLVLPRIKKKSKLKYWLHTSQRLH 992          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Xenopus
Match: GRIN3B (glutamate receptor, ionotropic, N-methyl-D-aspartate 3B [Source:NCBI gene;Acc:100497172])

HSP 1 Score: 146.747 bits (369), Expect = 3.108e-35
Identity = 102/396 (25.76%), Postives = 187/396 (47.22%), Query Frame = 3
Query: 1164 NQRMDVELK-CCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDL--MQEPDF----------ILASTSGTSHI-SIFLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLR---NTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHL----LKNMMLASRECPQKYT-QMKYKNFTSLFHVLLCAFPICFIILMVEHVFFY 2285
            N  + +E K CCYG+ + LL +L  D+ FD  LY + D KYG+     W GL+ +++   A +   + ++   R+  IDFT PF++   G+L++ +  +    A   P    +W+ I +  ++    L+ +EW SPFG+ P GR+R + ++  S +   Y + F +T   K+PK    +   N+W  FC+++ S Y  N+ A ++     KTF  L  + +P             +  +S   +I   F E H Y+R   F V   ++G        + AF+ ++ +L    + D     L I     +  + IG+P+++   + +S+++  Y  +G++  L     K +    R      T QM   +F+ LF +L   F    +  ++E V ++
Sbjct:  471 NGSVPLEYKTCCYGYCIDLLEKLSEDLRFDFELYIVGDGKYGARKGDRWTGLVGDLLSGAAHMAVTSFSINSARSTVIDFTSPFYSTSLGILVRMRDTASPIGAFMWPLHWSMWVGIFVALHITALFLTFYEWKSPFGMTPHGRNRTKIFSYSSALNLCYAILFGRTVSSKTPKCCTGRVLMNLWAIFCLLVLSSYTANLAAVMVG---DKTFEALSGIHDPKLHHPSQGFRFGTVWESSAEQYIKKSFPEMHNYMRK--FSVPATSDGVHLTDPPTLNAFIMDKALLDYEVSIDSDCKLLTIGKPFAIEGYGIGLPQNSPLTSNISEFISRYKSSGFMDTLHDKWYKMVPCGKRVYAVTETLQMGIYHFSGLFVLLCIGFCGSLLTSLMERVVYH 861          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Xenopus
Match: GRIN2B (glutamate receptor, ionotropic, N-methyl D-aspartate 2B [Source:NCBI gene;Acc:100490580])

HSP 1 Score: 140.198 bits (352), Expect = 3.456e-33
Identity = 97/405 (23.95%), Postives = 192/405 (47.41%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILI-ALWCYVAGFALSSFEWLSPFGLN---PKGRH-RKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDL----MQEP-DFILA-----STSGTSHISI---FLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLRNTDYCPNRLEILNYLGVAP--------FAIGVPKDAWYRNELSKYLLIYDFNGY-----------ISHLLKNMMLASRECPQKYTQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKF 2291
            +CC GF + +L ++   + F   LY + + K+G  +NG+WNG++ E++ +RA +   +LT+  +R++ +DF++PF      V++     + +  A   PFS  +W+++  +   V+  A+  FE+ SP G N     GR     ++ +G  +  ++ L F  + P ++PK   +K   +VW  F ++  + Y  N+ A +I+       S L     Q P DF  A       +G++  +I   +LE H Y+    F  ++  +  ++L+  ++ AF+ +  VL   +Y   R E    + +          + I + KD+ ++ ++   +L    +G            I H  KN +++S        Q+   N   +F++L  A  +  I  ++EH+FF++ 
Sbjct:  447 RCCKGFCIDILKKIAKTVKFTYDLYLVTNGKHGKKINGTWNGMIGEVVTKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSRSNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYVDQVSGLSDKKFQRPNDFSPAFRFGTVPNGSTERNIRNNYLEMHSYMVK--FNQRSVQDALLSLKTGKLDAFIYDAAVL---NYMAGRDEGCKLVTIGSGKVFATTGYGIAIQKDSGWKRQVDLAILQLFGDGEMEELEALWLTGICHNEKNEVMSS--------QLDIDNMAGVFYMLAAAMALSLITFIMEHLFFWQL 838          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Xenopus
Match: GRIN2B (glutamate receptor, ionotropic, N-methyl D-aspartate 2B [Source:NCBI gene;Acc:100490580])

HSP 1 Score: 139.813 bits (351), Expect = 5.523e-33
Identity = 97/405 (23.95%), Postives = 192/405 (47.41%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILI-ALWCYVAGFALSSFEWLSPFGLN---PKGRH-RKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDL----MQEP-DFILA-----STSGTSHISI---FLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLRNTDYCPNRLEILNYLGVAP--------FAIGVPKDAWYRNELSKYLLIYDFNGY-----------ISHLLKNMMLASRECPQKYTQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKF 2291
            +CC GF + +L ++   + F   LY + + K+G  +NG+WNG++ E++ +RA +   +LT+  +R++ +DF++PF      V++     + +  A   PFS  +W+++  +   V+  A+  FE+ SP G N     GR     ++ +G  +  ++ L F  + P ++PK   +K   +VW  F ++  + Y  N+ A +I+       S L     Q P DF  A       +G++  +I   +LE H Y+    F  ++  +  ++L+  ++ AF+ +  VL   +Y   R E    + +          + I + KD+ ++ ++   +L    +G            I H  KN +++S        Q+   N   +F++L  A  +  I  ++EH+FF++ 
Sbjct:  447 RCCKGFCIDILKKIAKTVKFTYDLYLVTNGKHGKKINGTWNGMIGEVVTKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSRSNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYVDQVSGLSDKKFQRPNDFSPAFRFGTVPNGSTERNIRNNYLEMHSYMVK--FNQRSVQDALLSLKTGKLDAFIYDAAVL---NYMAGRDEGCKLVTIGSGKVFATTGYGIAIQKDSGWKRQVDLAILQLFGDGEMEELEALWLTGICHNEKNEVMSS--------QLDIDNMAGVFYMLAAAMALSLITFIMEHLFFWQL 838          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Xenopus
Match: GRIN2B (glutamate receptor, ionotropic, N-methyl D-aspartate 2B [Source:NCBI gene;Acc:100490580])

HSP 1 Score: 139.428 bits (350), Expect = 6.985e-33
Identity = 97/405 (23.95%), Postives = 192/405 (47.41%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILI-ALWCYVAGFALSSFEWLSPFGLN---PKGRH-RKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDL----MQEP-DFILA-----STSGTSHISI---FLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLRNTDYCPNRLEILNYLGVAP--------FAIGVPKDAWYRNELSKYLLIYDFNGY-----------ISHLLKNMMLASRECPQKYTQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKF 2291
            +CC GF + +L ++   + F   LY + + K+G  +NG+WNG++ E++ +RA +   +LT+  +R++ +DF++PF      V++     + +  A   PFS  +W+++  +   V+  A+  FE+ SP G N     GR     ++ +G  +  ++ L F  + P ++PK   +K   +VW  F ++  + Y  N+ A +I+       S L     Q P DF  A       +G++  +I   +LE H Y+    F  ++  +  ++L+  ++ AF+ +  VL   +Y   R E    + +          + I + KD+ ++ ++   +L    +G            I H  KN +++S        Q+   N   +F++L  A  +  I  ++EH+FF++ 
Sbjct:  452 RCCKGFCIDILKKIAKTVKFTYDLYLVTNGKHGKKINGTWNGMIGEVVTKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSRSNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYVDQVSGLSDKKFQRPNDFSPAFRFGTVPNGSTERNIRNNYLEMHSYMVK--FNQRSVQDALLSLKTGKLDAFIYDAAVL---NYMAGRDEGCKLVTIGSGKVFATTGYGIAIQKDSGWKRQVDLAILQLFGDGEMEELEALWLTGICHNEKNEVMSS--------QLDIDNMAGVFYMLAAAMALSLITFIMEHLFFWQL 843          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Mouse
Match: Grin3a (glutamate receptor ionotropic, NMDA3A [Source:MGI Symbol;Acc:MGI:1933206])

HSP 1 Score: 168.318 bits (425), Expect = 4.063e-42
Identity = 107/408 (26.23%), Postives = 195/408 (47.79%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQEPDFILASTS---GTSHIS--------IFLEKHPYLRNKIFYVKTETEGKVALRN--KQVTAFLSEELVLR---NTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQK------YTQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKFTSDLKGFKK-SHWIFSDH 2342
            KCCYG+ + LL +L  DM+FD  LY + D KYG+  NG W GL+ +++   A +   + ++   R++ IDFT PF +   G+L++ +  +    A   P    +W+ I +  ++    L+ +EW SPFG+ PKGR+R + ++  S +   Y L F +T   K PK +  +F  N+W  FC+   S Y  N+ A ++   + +  S +  +P     S     GT   S         F E H Y+R   + V    +G   L+N  +++ AF+ ++ +L    + D     L +     +  + IG+P ++   + +S+ +  Y  +G++  +L +       C ++        QM  K+F+ LF +L   F +  +  + EH+ +      +K   K  +W+ +  
Sbjct:  574 KCCYGYCIDLLEQLAEDMNFDFDLYIVGDGKYGAWKNGHWTGLVGDLLSGTANMAVTSFSINTARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWTMWLGIFVALHITAIFLTLYEWKSPFGMTPKGRNRNKVFSFSSALNVCYALLFGRTAAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGI-HDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRR--YNVPATPDGVQYLKNDPEKLDAFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTSNISELISQYKSHGFMD-VLHDKWYKVVPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYRLLLPRIKNKSKLQYWLHTSQ 977          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Mouse
Match: Grin3a (glutamate receptor ionotropic, NMDA3A [Source:MGI Symbol;Acc:MGI:1933206])

HSP 1 Score: 168.318 bits (425), Expect = 4.638e-42
Identity = 107/408 (26.23%), Postives = 195/408 (47.79%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQEPDFILASTS---GTSHIS--------IFLEKHPYLRNKIFYVKTETEGKVALRN--KQVTAFLSEELVLR---NTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQK------YTQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKFTSDLKGFKK-SHWIFSDH 2342
            KCCYG+ + LL +L  DM+FD  LY + D KYG+  NG W GL+ +++   A +   + ++   R++ IDFT PF +   G+L++ +  +    A   P    +W+ I +  ++    L+ +EW SPFG+ PKGR+R + ++  S +   Y L F +T   K PK +  +F  N+W  FC+   S Y  N+ A ++   + +  S +  +P     S     GT   S         F E H Y+R   + V    +G   L+N  +++ AF+ ++ +L    + D     L +     +  + IG+P ++   + +S+ +  Y  +G++  +L +       C ++        QM  K+F+ LF +L   F +  +  + EH+ +      +K   K  +W+ +  
Sbjct:  574 KCCYGYCIDLLEQLAEDMNFDFDLYIVGDGKYGAWKNGHWTGLVGDLLSGTANMAVTSFSINTARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWTMWLGIFVALHITAIFLTLYEWKSPFGMTPKGRNRNKVFSFSSALNVCYALLFGRTAAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGI-HDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRR--YNVPATPDGVQYLKNDPEKLDAFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTSNISELISQYKSHGFMD-VLHDKWYKVVPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYRLLLPRIKNKSKLQYWLHTSQ 977          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Mouse
Match: Grin3b (glutamate receptor, ionotropic, NMDA3B [Source:MGI Symbol;Acc:MGI:2150393])

HSP 1 Score: 161.384 bits (407), Expect = 1.954e-41
Identity = 105/439 (23.92%), Postives = 206/439 (46.92%), Query Frame = 3
Query: 1137 LNEAFKSQRNQRMDVELK-CCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDL--MQEPDF----------ILASTSGTSHI-SIFLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLR---NTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQKY------TQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKFTSDL-KGFKKSHWIFSDHVMYFSQINQEPKS 2381
            L+  F +  N  +   L+ CCYG+ + LL RL  D+ FD  LY + D KYG+L +G W GL+ +++  RA +   + ++   R++ +DFT PF +   G++++ +  +    A   P    +W+ +    ++    L+ +EW SP+GL P+GR+R   ++  S +   Y + F +T   K+PK    +F  N+W  FC+++ S Y  N+ A ++     KTF +L  + +P             +  +S  ++I + F E H ++R             +     ++ AF+ ++ +L    + D     L +     +  + IG+P+++   + LS+++  Y  +G+I  LL +       C ++        QM   + + LF +L        +  + EHVF+      + +G K  +W+ +   ++ +     P+ 
Sbjct:   98 LDALFTALENGSVPRTLRRCCYGYCIDLLERLAEDLAFDFELYIVGDGKYGALRDGRWTGLVGDLLAGRAHMAVTSFSINSARSQVVDFTSPFFSTSLGIMVRTRDTASPIGAFMWPLHWSMWVGVFAALHLTALFLTLYEWRSPYGLTPRGRNRGTVFSYSSALNLCYAILFGRTVSSKTPKCPTGRFLMNLWAIFCLLVLSSYTANLAAVMVG---DKTFEELSGIHDPKLHHPSQGFRFGTVWESSAEAYIKASFPEMHAHMRRHSAPTTPHGVAMLTSDPPKLNAFIMDKSLLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLTSNLSEFISRYKSSGFID-LLHDKWYKMVPCGKRVFAVTETLQMGVYHLSGLFVLLCLGLGSALLTSLGEHVFYRLVLPRIRRGNKLQYWLHTSQKIHRALNTGPPEG 532          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Mouse
Match: Grin3b (glutamate receptor, ionotropic, NMDA3B [Source:MGI Symbol;Acc:MGI:2150393])

HSP 1 Score: 158.688 bits (400), Expect = 3.998e-39
Identity = 102/421 (24.23%), Postives = 199/421 (47.27%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDL--MQEPDFILAS----------TSGTSHI-SIFLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLR---NTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQKY------TQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKFTSDL-KGFKKSHWIFSDHVMYFSQINQEPKS 2381
            +CCYG+ + LL RL  D+ FD  LY + D KYG+L +G W GL+ +++  RA +   + ++   R++ +DFT PF +   G++++ +  +    A   P    +W+ +    ++    L+ +EW SP+GL P+GR+R   ++  S +   Y + F +T   K+PK    +F  N+W  FC+++ S Y  N+ A ++     KTF +L  + +P     S          +S  ++I + F E H ++R             +     ++ AF+ ++ +L    + D     L +     +  + IG+P+++   + LS+++  Y  +G+I  LL +       C ++        QM   + + LF +L        +  + EHVF+      + +G K  +W+ +   ++ +     P+ 
Sbjct:  474 RCCYGYCIDLLERLAEDLAFDFELYIVGDGKYGALRDGRWTGLVGDLLAGRAHMAVTSFSINSARSQVVDFTSPFFSTSLGIMVRTRDTASPIGAFMWPLHWSMWVGVFAALHLTALFLTLYEWRSPYGLTPRGRNRGTVFSYSSALNLCYAILFGRTVSSKTPKCPTGRFLMNLWAIFCLLVLSSYTANLAAVMVG---DKTFEELSGIHDPKLHHPSQGFRFGTVWESSAEAYIKASFPEMHAHMRRHSAPTTPHGVAMLTSDPPKLNAFIMDKSLLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLTSNLSEFISRYKSSGFID-LLHDKWYKMVPCGKRVFAVTETLQMGVYHLSGLFVLLCLGLGSALLTSLGEHVFYRLVLPRIRRGNKLQYWLHTSQKIHRALNTGPPEG 890          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Mouse
Match: Grin2b (glutamate receptor, ionotropic, NMDA2B (epsilon 2) [Source:MGI Symbol;Acc:MGI:95821])

HSP 1 Score: 138.272 bits (347), Expect = 1.457e-32
Identity = 94/405 (23.21%), Postives = 190/405 (46.91%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILI-ALWCYVAGFALSSFEWLSPFGLN---PKGRH-RKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQE---------PDFILAST-SGTSHISI---FLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLRNTDYCPNRLEILNYLGVAP--------FAIGVPKDAWYRNELSKYLLIYDFNGY-----------ISHLLKNMMLASRECPQKYTQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKF 2291
            KCC GF + +L ++   + F   LY + + K+G  +NG+WNG++ E++++RA +   +LT+  +R++ +DF++PF      V++     + +  A   PFS  +W+++  +   V+  A+  FE+ SP G N     GR     ++ +G  +  ++ L F  + P ++PK   +K   +VW  F ++  + Y  N+ A +I+       S L  +         P F   +  +G++  +I   + E H Y+    F  +   +  ++L+  ++ AF+ +  VL   +Y   R E    + +          + I + KD+ ++ ++   +L    +G            I H  KN +++S        Q+   N   +F++L  A  +  I  + EH+F+++F
Sbjct:  455 KCCKGFCIDILKKISKSVKFTYDLYLVTNGKHGKKINGTWNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSRSNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYVDQVSGLSDKKFQRPNDFSPPFRFGTVPNGSTERNIRNNYAEMHAYMGK--FNQRGVDDALLSLKTGKLDAFIYDAAVL---NYMAGRDEGCKLVTIGSGKVFASTGYGIAIQKDSGWKRQVDLAILQLFGDGEMEELEALWLTGICHNEKNEVMSS--------QLDIDNMAGVFYMLGAAMALSLITFICEHLFYWQF 846          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. UniProt/SwissProt
Match: sp|Q8TCU5|NMD3A_HUMAN (Glutamate receptor ionotropic, NMDA 3A OS=Homo sapiens OX=9606 GN=GRIN3A PE=1 SV=2)

HSP 1 Score: 166.777 bits (421), Expect = 8.266e-41
Identity = 107/411 (26.03%), Postives = 196/411 (47.69%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQEPDFILASTS---GTSHIS--------IFLEKHPYLRNKIFYVKTETEGKVALRN--KQVTAFLSEELVLR---NTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQK------YTQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKFTSDLKGFKK-SHWIFSDHVMY 2351
            KCCYG+ + LL ++  DM+FD  LY + D KYG+  NG W GL+ +++   A +   + ++   R++ IDFT PF +   G+L++ +  +    A   P    +W+ I +  ++    L+ +EW SPFGL PKGR+R + ++  S +   Y L F +T   K PK +  +F  N+W  FC+   S Y  N+ A ++   + +  S +  +P     S     GT   S         F E H Y+R   + V    +G   L+N  +++ AF+ ++ +L    + D     L +     +  + IG+P ++     +S+ +  Y  +G++  +L +       C ++        QM  K+F+ LF +L   F +  +  + EH+ +      +K   K  +W+ +   ++
Sbjct:  574 KCCYGYCIDLLEKIAEDMNFDFDLYIVGDGKYGAWKNGHWTGLVGDLLRGTAHMAVTSFSINTARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWTMWLGIFVALHITAVFLTLYEWKSPFGLTPKGRNRSKVFSFSSALNICYALLFGRTVAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGI-HDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRR--YNVPATPDGVEYLKNDPEKLDAFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTANISELISQYKSHGFMD-MLHDKWYRVVPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYRLLLPRIKNKSKLQYWLHTSQRLH 980          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. UniProt/SwissProt
Match: sp|Q9R1M7|NMD3A_RAT (Glutamate receptor ionotropic, NMDA 3A OS=Rattus norvegicus OX=10116 GN=Grin3a PE=1 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 8.271e-41
Identity = 107/408 (26.23%), Postives = 194/408 (47.55%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQEPDFILASTS---GTSHIS--------IFLEKHPYLRNKIFYVKTETEGKVALRN--KQVTAFLSEELVLR---NTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQK------YTQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKFTSDLKGFKK-SHWIFSDH 2342
            KCCYG+ + LL +L  DM+FD  LY + D KYG+  NG W GL+ +++   A +   + ++   R++ IDFT PF +   G+L++ +  +    A   P    +W+ I +  ++    L+ +EW SPFG+ PKGR+R + ++  S +   Y L F +T   K PK +  +F  N+W  FC+   S Y  N+ A ++   + +  S +  +P     S     GT   S         F E H Y+R   + V    +G   L+N  +++ AF+ ++ +L    + D     L +     +  + IG+P ++   + +S+ +  Y  +G++  +L +       C ++        QM  K+F+ LF +L   F +  +  + EH+        +K   K  +W+ +  
Sbjct:  574 KCCYGYCIDLLEQLAEDMNFDFDLYIVGDGKYGAWKNGHWTGLVGDLLSGTANMAVTSFSINTARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWTMWLGIFVALHITAIFLTLYEWKSPFGMTPKGRNRNKVFSFSSALNVCYALLFGRTAAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGI-HDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRR--YNVPATPDGVQYLKNDPEKLDAFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTSNISELISQYKSHGFMD-VLHDKWYKVVPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVHRLLLPRIKNKSKLQYWLHTSQ 977          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. UniProt/SwissProt
Match: sp|Q8VHN2|NMD3B_RAT (Glutamate receptor ionotropic, NMDA 3B OS=Rattus norvegicus OX=10116 GN=Grin3b PE=1 SV=2)

HSP 1 Score: 160.614 bits (405), Expect = 6.483e-39
Identity = 103/421 (24.47%), Postives = 200/421 (47.51%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDL--MQEPDFILAS----------TSGTSHI-SIFLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLR---NTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQKY------TQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKFTSDL-KGFKKSHWIFSDHVMYFSQINQEPKS 2381
            +CCYG+ + LL RL  D+ FD  LY + D KYG+L +G W GL+ +++  RA +   + ++   R++ +DFT PF +   G++++ +  +    A   P    +W+ +    ++    L+ +EW SP+GL P+GR+R   ++  S +   Y + F +T   K+PK    +F  N+W  FC+++ S Y  N+ A ++     KTF +L  + +P     S          +S  ++I + F E H ++R             +     ++ AF+ ++ +L    + D     L +     +  + IG+P+++   + LS+++  Y  +G+I  LL +       C ++        QM   +F+ LF +L        +  + EHVF+      + +G K  +W+ +   ++ +     P+ 
Sbjct:  474 RCCYGYCIDLLERLAEDLAFDFELYIVGDGKYGALRDGRWTGLVGDLLAGRAHMAVTSFSINSARSQVVDFTSPFFSTSLGIMVRTRDTASPIGAFMWPLHWSMWVGVFAALHLTALFLTLYEWRSPYGLTPRGRNRGTVFSYSSALNLCYAILFGRTVSSKTPKCPTGRFLMNLWAIFCLLVLSSYTANLAAVMVG---DKTFEELSGIHDPKLHHPSQGFRFGTVWESSAEAYIKASFPEMHAHMRRHSAPTTPHGVAMLTSDPPKLNAFIMDKSLLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLTSNLSEFISRYKSSGFID-LLHDKWYKMVPCGKRVFAVTETLQMGVYHFSGLFVLLCLGLGSALLTSLGEHVFYRLVLPRIRRGNKLQYWLHTSQKIHRALNTGPPEG 890          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. UniProt/SwissProt
Match: sp|Q91ZU9|NMD3B_MOUSE (Glutamate receptor ionotropic, NMDA 3B OS=Mus musculus OX=10090 GN=Grin3b PE=1 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 2.797e-38
Identity = 102/421 (24.23%), Postives = 199/421 (47.27%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDL--MQEPDFILAS----------TSGTSHI-SIFLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLR---NTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQKY------TQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKFTSDL-KGFKKSHWIFSDHVMYFSQINQEPKS 2381
            +CCYG+ + LL RL  D+ FD  LY + D KYG+L +G W GL+ +++  RA +   + ++   R++ +DFT PF +   G++++ +  +    A   P    +W+ +    ++    L+ +EW SP+GL P+GR+R   ++  S +   Y + F +T   K+PK    +F  N+W  FC+++ S Y  N+ A ++     KTF +L  + +P     S          +S  ++I + F E H ++R             +     ++ AF+ ++ +L    + D     L +     +  + IG+P+++   + LS+++  Y  +G+I  LL +       C ++        QM   + + LF +L        +  + EHVF+      + +G K  +W+ +   ++ +     P+ 
Sbjct:  474 RCCYGYCIDLLERLAEDLAFDFELYIVGDGKYGALRDGRWTGLVGDLLAGRAHMAVTSFSINSARSQVVDFTSPFFSTSLGIMVRTRDTASPIGAFMWPLHWSMWVGVFAALHLTALFLTLYEWRSPYGLTPRGRNRGTVFSYSSALNLCYAILFGRTVSSKTPKCPTGRFLMNLWAIFCLLVLSSYTANLAAVMVG---DKTFEELSGIHDPKLHHPSQGFRFGTVWESSAEAYIKASFPEMHAHMRRHSAPTTPHGVAMLTSDPPKLNAFIMDKSLLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLTSNLSEFISRYKSSGFID-LLHDKWYKMVPCGKRVFAVTETLQMGVYHLSGLFVLLCLGLGSALLTSLGEHVFYRLVLPRIRRGNKLQYWLHTSQKIHRALNTGPPEG 890          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. UniProt/SwissProt
Match: sp|O60391|NMD3B_HUMAN (Glutamate receptor ionotropic, NMDA 3B OS=Homo sapiens OX=9606 GN=GRIN3B PE=2 SV=2)

HSP 1 Score: 157.918 bits (398), Expect = 5.285e-38
Identity = 104/420 (24.76%), Postives = 196/420 (46.67%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDL--MQEPDF----------ILASTSGTSHI-SIFLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLR---NTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQKY------TQMKYKNFTSLFHVLLCAFPICFIILMVEHVFF-YKFTSDLKGFKKSHWIFSDHVMYFSQINQEPK 2378
            KCCYG+ + LL RL  D  FD  LY + D KYG+L +G W GL+ +++  RA +   + ++   R++ +DFT PF +   G++++ +  +    A   P     W+ +    ++    L+ +EW SP+GL P+GR+R   ++  S +   Y + FR+T   K+PK    +   N+W  FC+++ S Y  N+ A ++     KTF +L  + +P             +  +S  ++I   F + H ++R             +     ++ AF+ ++ +L    + D     L +     +  + IG+P+++   + LS+++  Y  +G+I  LL +       C ++        QM   +F  LF +L        +  + EH FF        KG +  +W+ +   ++ + +N EP 
Sbjct:  474 KCCYGYCIDLLERLAEDTPFDFELYLVGDGKYGALRDGRWTGLVGDLLAGRAHMAVTSFSINSARSQVVDFTSPFFSTSLGIMVRARDTASPIGAFMWPLHWSTWLGVFAALHLTALFLTVYEWRSPYGLTPRGRNRSTVFSYSSALNLCYAILFRRTVSSKTPKCPTGRLLMNLWAIFCLLVLSSYTANLAAVMVG---DKTFEELSGIHDPKLHHPAQGFRFGTVWESSAEAYIKKSFPDMHAHMRRHSAPTTPRGVAMLTSDPPKLNAFIMDKSLLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLTSNLSEFISRYKSSGFID-LLHDKWYKMVPCGKRVFAVTETLQMSIYHFAGLFVLLCLGLGSALLSSLGEHAFFRLALPRIRKGSRLQYWLHTSQKIHRA-LNTEPP 888          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. TrEMBL
Match: K1Q881 (Glutamate [NMDA] receptor subunit 3A OS=Crassostrea gigas OX=29159 GN=CGI_10021967 PE=3 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 1.122e-52
Identity = 131/416 (31.49%), Postives = 212/416 (50.96%), Query Frame = 3
Query: 1164 NQRMDVELKCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVL-IQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIET----NVKKTFSDLMQEPDFILASTSGTSHISIFLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLRNTDYCPNRLE-------ILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASREC-PQKYTQMKYK----NFTSLFHVLLCAFPICFIILMVEHVFFYKFTSDLKGFKKSHWIFSDHVMYFSQ 2360
            N     +LKCC GF+V LL +L  D++F+ VLY + D  YG   NG+W+G+M+++    A +     ++T +R + IDF+ P++  +F VL  Q   K+Y   A   PFS  +W  I +   ++   +S FEW SPFGLNP GR RK+NY +GSG+T VY+L F  T   KSPKS+P+K  QN W   CI I + Y  N+ A +       +    F   + E    +   S    ++  + K  Y R++ + V T  +    L N  + A+L +  +L   DY   +L+       +    G   + IG PKD+  +  +S+ +  Y  +GY+ +L+ ++     +C  Q   Q ++     + + LF +L  A   C ++++VEH+ F       +G     +  S +VM+FSQ
Sbjct:  251 NDSSSFQLKCCRGFAVDLLNKLASDLEFEYVLYIVHDTTYGKEKNGTWDGMMRDLTNGIAHMAIAAFSITGNRLRAIDFSYPYYFSRFTVLYTQQSQKTYMY-AFLEPFSPEVWCTIFVSASLSALGMSMFEWNSPFGLNPWGRKRKQNYTIGSGMTMVYSLLFGHTVSTKSPKSWPSKVLQNFWASACIFIIASYTANLAAFLAGKHNGIDYNSVFDSRLMEIRVGVLGGSAVEALTNNINKKLYQRSQHYLVPTTNDAINMLINGNIDAYLGDYPIL---DYARVKLDPNCNLYIVPQSFGEDEYGIGFPKDSPLQKPVSEKIKHYHESGYLENLI-DIHFDEEKCFNQGINQQRFSLTVFHHSGLFALLSIAIVCCILLVLVEHLVFKFLLPICRGRPDDSFWKSLNVMFFSQ 661          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. TrEMBL
Match: A0A210Q7T0 (Glutamate receptor ionotropic, NMDA 3A OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT07996 PE=3 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 2.235e-51
Identity = 131/429 (30.54%), Postives = 209/429 (48.72%), Query Frame = 3
Query: 1116 KNIYVTLLNEAFKSQRNQRMDVELKCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQEPDF-ILASTSGTSHISIFLEKHPY---LRNKIFYVKTETEGKVALRNKQVTAFLSEELVLR----NTD-YCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASREC-----PQKYTQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKFTSDLKGFKKSHWIFSDHVMYFSQ 2360
            K   + +L +    + N+    E++CC G ++ LL RL  D+DFD  LY + D  YG  +NGSWNG++K++++  A +     ++T  R K IDFT P+    F VL  ++ +     A   PF+  +W+ I +   +   A++ FEW SPFGLNP GR RK+NY L SG+T VY++ F  T   KSPKS+P+K  QN W   CI + + Y  N+ A +   +    + D+     F I       S +   ++K  Y   L ++  +V    E    L   Q+ A+L +  +L     N D  C  RL +    G   + IG+ KD+  +  LS+ +  Y   GYI  L+ ++  A  EC       + ++++  +   LF +L        I+  VEH  +       +       + S H+M+FSQ
Sbjct:  438 KQATIRVLRDYENGRINKSNPYEVRCCRGLAIDLLNRLSRDLDFDYTLYIVGDVTYGKEINGSWNGMVKDLMVGSAHMAVAAFSITRKRLKVIDFTHPYFFSGFSVLYSERKRHTRMHAFLEPFAVEVWVAIFISATIGAIAMALFEWNSPFGLNPWGRKRKQNYTLASGLTMVYSVLFGHTVRTKSPKSWPSKVMQNFWAFACIFVIASYTANLAAFIAGKHAGINYQDIYDSRMFDIRVGVLEASAVESIVKKINYRLFLTSQRHHVPKSDEAIEMLIAGQLDAYLGDYPILEYARGNLDPKCQLRL-LSQTFGEDGYGIGIAKDSPLKIPLSEKIKEYHEIGYIDDLI-DVHFADAECYKQRITSEESRLEVLHHAGLFVMLSVGIVFGIILCFVEHAIYRNLVPRFRKKSPKSCMKSSHLMFFSQ 864          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. TrEMBL
Match: R7TA67 (Uncharacterized protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_24092 PE=3 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 1.402e-47
Identity = 122/388 (31.44%), Postives = 191/388 (49.23%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDL----MQEPDFILASTSGTSHISIFLEKHPYLRNKIFYVKTETEGK--------VALRNKQVTAFLSEELVLRNT-----DYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASR------ECPQKYTQMKYKNFTSLFHVLLCAFPICFIILMVEHVFF 2282
            +CC G S+ LL RL  D++FD  LY   D +YG++VNGSWNG+++++    A +     ++T  R + IDFT P+    F +L+ +  +S    A   PF + +WI I +   +   ALS  EW SPFGLNP GR RK NY LGSG+  VY + F+ T   KSPK++P+K+ QN W    IV +S Y  N+ A +   N   T +      + EP+  +    GT+   +F+ K   + N++   K +T             L N    A+L +  VL          C  RL +    G   + IG+P  +W +  +S+ ++ Y  +G+I  L       SR      E   + ++M +     L+ +LL     C +++ +EH  F
Sbjct:    1 RCCQGLSIMLLERLARDLNFDFQLYITADEQYGTIVNGSWNGMVQDLSNGLAHMGVAAFSITRMRARVIDFTHPYFYSGFSILVSEHKRSPPIYAFMEPFDSWVWISIVVSSTIVAVALSLLEWNSPFGLNPWGRKRKTNYTLGSGLNMVYAILFQHTIKTKSPKAWPSKWLQNFWAAASIVFYSSYTANLAAFLAGKNAGVTITVFTYFQLLEPNRQVGILKGTAS-EMFVAK---INNQLL-AKADTRNSTLPIRSALALLGNGTFAAYLDDTPVLEYAISTMDAQCTLRL-VGEGFGEDSYGIGLPAYSWLKKPVSEKIMEYHQSGFIEDLQDLYFRRSRCKDLAIEGQLQASRMNFDQHAGLYLLLLVGVFTCILLMFLEHATF 382          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. TrEMBL
Match: A0A0L8FX18 (Uncharacterized protein (Fragment) OS=Octopus bimaculoides OX=37653 GN=OCBIM_22005422mg PE=3 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 5.021e-45
Identity = 87/245 (35.51%), Postives = 133/245 (54.29%), Query Frame = 3
Query: 1050 CIFTLPCLIFNNMSDLYSYKDIKNIYVTLLNEAFKSQRNQRMDVELKCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETN 1784
            C+   PCL  ++     + + +++    +LN        Q    E++CC G S+ LL +L ID+DFD  L+ + D  YG+  NGSWNG++++++   A +     ++T  R K IDFT P+    F +L+ D+++     A   PFS  +W  I +   V   A++ FEW SPFGLNP GR RK NY + SG+  VY++ F  T   KSPK++P+K  QN W    I I + Y  N+ A +   N
Sbjct:   99 CMSDTPCLKLSSKDKERTIEALRDFEAGVLN--------QSNPWEIRCCRGLSIDLLNKLSIDLDFDFTLFLVFDKSYGAYSNGSWNGMIEDLLESTAHIAMAAFSITKSRVKAIDFTDPYFFSGFSILVADRVRDPHMQAFLEPFSIGVWFAIFISATVTAVAMALFEWNSPFGLNPWGRKRKSNYTMASGLNMVYSVLFGHTVSTKSPKAWPSKVMQNFWAFAAIFIIASYTANLAAFIAGKN 335          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. TrEMBL
Match: A0A2T7NPA1 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_16261 PE=3 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.161e-44
Identity = 123/414 (29.71%), Postives = 207/414 (50.00%), Query Frame = 3
Query: 1185 LKCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQEPDFILASTSGT---SHISIFLEKHPYLRNKIFYV-------KTETEGKVALRNKQVTAFLSEELVLRNTDYCPNRLE-------ILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASREC-----PQKYTQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKFTSDLKGFKKSHWIFSDHVMYFSQ 2360
            ++CC G ++ LL +L  D+DFD  LY ++D +YG   N +W G++K+++   A       ++T  R K IDFT P+    F VL  D+ +  +  A   PF T +W  I +       A++ FEW SPFGLNP GR RK+NY+L SG+T V+++ F  T   KSPK++P+K  QN W    I I + Y  N+ A +   +    ++D+      +L+   GT   S +  FL +   L++K++ V       KT+      ++ + + A+L +  +L   DY    L        I    G   + +G+PK++  +  LSK +  Y   GY+   LK++  A   C      ++ ++++  +   LF +L   F +  + L +E+V F      ++    +    S H+M+FSQ
Sbjct:  323 IQCCRGLTIDLLNKLASDLDFDFTLYIVQDEQYGQWKNETWTGIIKDLVDHTAHFAVAAFSITRARQKVIDFTHPYFFSGFSVLYSDRTRETSMLAFLEPFDTSVWFAIFVSANFTAVAMALFEWNSPFGLNPWGRKRKQNYSLASGLTMVFSVLFGHTVKTKSPKAWPSKVMQNFWAFAAIFIIASYTANLAAFIAGKHAGIYYNDIKDH--RLLSIRIGTLQGSAVDDFLRR---LQSKLYDVSNRNLVPKTDVGIDWVIKGR-LDAYLGDYPIL---DYARAHLAPSCELKLISKIFGDDQYGLGLPKNSPLKVTLSKKIQEYHETGYVDD-LKDVHFADAHCFKKRISEEDSKLEVGHHAGLFVMLCVGFGVGLLTLALEYVIFKWLVPFIREAPSTSIWKSVHLMFFSQ 726          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Cavefish
Match: grin3bb (glutamate receptor, ionotropic, N-methyl-D-aspartate 3Bb [Source:ZFIN;Acc:ZDB-GENE-131122-77])

HSP 1 Score: 171.014 bits (432), Expect = 3.799e-43
Identity = 109/389 (28.02%), Postives = 189/389 (48.59%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQEPDFILASTS-----GTSHIS--------IFLEKHPYLRNKIFYVKTETEGKVALRN--KQVTAFLSEELVLR---NTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQKY------TQMKYKNFTSLFHVLLCAFPICFIILMVEHVFF 2282
            KCCYG+ + LL +L  DMDF+  LY + D KYG+   G W GL+ +++   A +   + ++   R+K +DFT PF +   G+L++ K  +    A   P    +W+ I +  ++    L+ +EW SPFG+ P GR+R R ++  S +   Y + F +T   K+PK +  +F  N+W  FC+++ S Y  N+ A ++    +KTF +L    D  L   S     GT   S         F E H Y+R   F   T  +G   L+    Q+ AF+ ++ +L    + D     L +     +  + IG+P+++   + +S+++  Y  +GY+  +L +       C ++        QM  ++F+ LF +L        + L  EH F+
Sbjct:  426 KCCYGYCIDLLEKLSEDMDFEFDLYIVGDGKYGAWKGGRWTGLVGDLLNGVADMAVTSFSINSARSKVMDFTSPFFSTSLGILVRSKDTAAPIGAFMWPLHWSMWVGIFVALHITALFLTLYEWKSPFGMTPHGRNRVRVFSYSSALNLCYAILFGRTVSSKTPKCWTGRFLMNLWAIFCLLVLSSYTANLAAVMVG---EKTFEELSGIHDAKLHHPSHGFRFGTVRESSAEDYMKKSFPEMHEYMRR--FNEPTTPDGVATLKTDPPQLDAFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLTSNISEFISRYKSDGYMD-MLHDKWYKVVPCGKRVFAVTETLQMGIRHFSGLFVLLCVGVTGALLTLAGEHAFY 808          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Cavefish
Match: GRIN3A (glutamate ionotropic receptor NMDA type subunit 3A [Source:NCBI gene;Acc:103022487])

HSP 1 Score: 164.851 bits (416), Expect = 3.902e-41
Identity = 106/387 (27.39%), Postives = 187/387 (48.32%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDL--MQEPDFILASTS---GTSHIS--------IFLEKHPYLRNKIFYVKTETEGKVALRN--KQVTAFLSEELVLR---NTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQK------YTQMKYKNFTSLFHVLLCAFPICFIILMVEHV 2276
            KCCYG+ + LL +L  DM FD  LY + D KYG+  NG W GL+ +++   A L   + ++   R++ IDFT PF +   G+L++ +  +    A   P    +W+ I +  +V    L+ +EW SPFG+ PKGR+R R ++  S +   Y + F +T   K PK +  +F  N+W  FC+   S Y  N+ A ++    +KT+  L  + +P     S     GT   S         F E H Y+R   + V T  +G   L+   +++ AF+ ++ +L    + D     L +     +  + IG+ +++   + +S+ +  Y  +G++  +L +       C ++        QM  K+F+ LF +L     +  +  + EH+
Sbjct:  604 KCCYGYCIDLLEKLAEDMGFDFDLYIVGDGKYGAYKNGRWTGLVGDLMSGAAHLAVTSFSINSARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWSMWLGIFVSLHVTAVFLTLYEWKSPFGMTPKGRNRDRVFSFSSALNVCYAILFGRTAAIKPPKCWTGRFLMNLWAIFCLFCLSTYTANLAAVMVG---EKTYEQLSGIHDPKLHHPSQGFRFGTVRESSAEDYVKKSFPEMHEYMRR--YNVPTTPDGIDHLKADPQKLDAFIMDKALLDYEVSIDADCKTLTVGKPFAIEGYGIGLKQNSPLTSNISELVSQYKSDGFMD-MLHDKWYKVVPCGKRSFAVTETLQMGIKHFSGLFVMLCVGVALSLLTTIAEHI 984          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Cavefish
Match: GRIN3A (glutamate ionotropic receptor NMDA type subunit 3A [Source:NCBI gene;Acc:103022487])

HSP 1 Score: 164.851 bits (416), Expect = 4.259e-41
Identity = 106/387 (27.39%), Postives = 187/387 (48.32%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDL--MQEPDFILASTS---GTSHIS--------IFLEKHPYLRNKIFYVKTETEGKVALRN--KQVTAFLSEELVLR---NTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQK------YTQMKYKNFTSLFHVLLCAFPICFIILMVEHV 2276
            KCCYG+ + LL +L  DM FD  LY + D KYG+  NG W GL+ +++   A L   + ++   R++ IDFT PF +   G+L++ +  +    A   P    +W+ I +  +V    L+ +EW SPFG+ PKGR+R R ++  S +   Y + F +T   K PK +  +F  N+W  FC+   S Y  N+ A ++    +KT+  L  + +P     S     GT   S         F E H Y+R   + V T  +G   L+   +++ AF+ ++ +L    + D     L +     +  + IG+ +++   + +S+ +  Y  +G++  +L +       C ++        QM  K+F+ LF +L     +  +  + EH+
Sbjct:  583 KCCYGYCIDLLEKLAEDMGFDFDLYIVGDGKYGAYKNGRWTGLVGDLMSGAAHLAVTSFSINSARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWSMWLGIFVSLHVTAVFLTLYEWKSPFGMTPKGRNRDRVFSFSSALNVCYAILFGRTAAIKPPKCWTGRFLMNLWAIFCLFCLSTYTANLAAVMVG---EKTYEQLSGIHDPKLHHPSQGFRFGTVRESSAEDYVKKSFPEMHEYMRR--YNVPTTPDGIDHLKADPQKLDAFIMDKALLDYEVSIDADCKTLTVGKPFAIEGYGIGLKQNSPLTSNISELVSQYKSDGFMD-MLHDKWYKVVPCGKRSFAVTETLQMGIKHFSGLFVMLCVGVALSLLTTIAEHI 963          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Cavefish
Match: grin3bb (glutamate receptor, ionotropic, N-methyl-D-aspartate 3Bb [Source:ZFIN;Acc:ZDB-GENE-131122-77])

HSP 1 Score: 162.155 bits (409), Expect = 2.363e-40
Identity = 98/335 (29.25%), Postives = 168/335 (50.15%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQEPDFILASTS-----GTSHIS--------IFLEKHPYLRNKIFYVKTETEGKVALRN--KQVTAFLSEELVLR---NTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHL 2138
            KCCYG+ + LL +L  DMDF+  LY + D KYG+   G W GL+ +++   A +   + ++   R+K +DFT PF +   G+L++ K  +    A   P    +W+ I +  ++    L+ +EW SPFG+ P GR+R R ++  S +   Y + F +T   K+PK +  +F  N+W  FC+++ S Y  N+ A ++    +KTF +L    D  L   S     GT   S         F E H Y+R   F   T  +G   L+    Q+ AF+ ++ +L    + D     L +     +  + IG+P+++   + +S+++  Y  +GY+  L
Sbjct:  426 KCCYGYCIDLLEKLSEDMDFEFDLYIVGDGKYGAWKGGRWTGLVGDLLNGVADMAVTSFSINSARSKVMDFTSPFFSTSLGILVRSKDTAAPIGAFMWPLHWSMWVGIFVALHITALFLTLYEWKSPFGMTPHGRNRVRVFSYSSALNLCYAILFGRTVSSKTPKCWTGRFLMNLWAIFCLLVLSSYTANLAAVMVG---EKTFEELSGIHDAKLHHPSHGFRFGTVRESSAEDYMKKSFPEMHEYMRR--FNEPTTPDGVATLKTDPPQLDAFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLTSNISEFISRYKSDGYMDML 755          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Cavefish
Match: grin3ba (glutamate receptor, ionotropic, N-methyl-D-aspartate 3Ba [Source:ZFIN;Acc:ZDB-GENE-070912-354])

HSP 1 Score: 150.214 bits (378), Expect = 8.406e-37
Identity = 113/439 (25.74%), Postives = 202/439 (46.01%), Query Frame = 3
Query: 1134 LLNEAFKSQRNQRMDVELKCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQEPDFILASTS-----GTSHIS--------IFLEKHPYLRNKIFYVKTETEGKVALRN--KQVTAFLSEELVLR---NTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQKY------TQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKFTSDLKGFKKSHWIFSDHVMYFSQINQEPK 2378
            +LN+ F+   +       KCCYG+ + LL +L  DM F+  LY + D KYG+   G W GL+ +++   A +   + ++   R++ IDFT PF +   G+L++ K  +    A   P    +W+ I +  ++    L+ +EW SPF            ++  S +   Y + F +T   K+PK +  +F  N+W  FC+++ S Y  N+ A ++    +KTF ++    D  L   S     GT   S         F E H Y+R   F   T  EG   L+    Q+ AF+ ++ +L    + D     L +     +  + IG+P+++     +S+Y+  Y  +GY+  +L +       C ++        QM  ++F+ LF +L        + L+ EH  FY+F   L   +  H +   + ++ SQ+ + P+
Sbjct:  383 VLNQLFRDSGSSIPSEIRKCCYGYCIDLLEKLAEDMQFEFDLYIVGDGKYGAWKGGEWTGLVGDLLRGAADMAVTSFSINSARSRVIDFTSPFFSTSLGILVRSKDTAAPIGAFMWPLHWSMWVGIFVALHITALFLTLYEWNSPF-----------VFSYSSALNLCYAILFGRTVASKTPKCWTGRFLMNLWAIFCLLVLSSYTANLAAVMVG---EKTFEEVSGIHDAKLHHPSLGFRFGTVRESSAEDYMKKSFPEMHEYMRR--FNKPTTPEGVSTLKTDPAQLDAFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLTRNVSEYVSRYKSDGYMD-MLHDKWYKVVPCGKRVFAVTETLQMGIQHFSGLFVLLCVGVAGALLTLLGEHA-FYRFI--LPHLRHQHRL--RYWLHTSQVRKLPR 799          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010716.1 (pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1 gene:ENSPMAG00000009705.1 transcript:ENSPMAT00000010716.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 146.362 bits (368), Expect = 2.463e-36
Identity = 97/397 (24.43%), Postives = 194/397 (48.87%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWC-YVAGFALSSFEWLSPFGLNPKGRHRKR----NYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNV---------KKTFSDLMQEPDFILAST-SGTSHISI---FLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLRNTDYCPNRLEILNYLGVAP--------FAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQKY-----TQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFY 2285
            KCC GF + +L +L   + F   LY + + K+GS +NG WNG++ E++  RA +   +LT+  +R++ +DF++PF      V++     + +  A   PFS  +W+++ + C  V+G A+  FE+ SP G N +    K      + +G  +  ++ + F  + P ++P+   +KF  +VW  F ++  + Y  N+ A +I+ +          KK  S L   P F   +  +G++  +I   +L+ H Y+    F+ K+  +  ++L+  ++ AF+ +  VL   +Y   + E    + +          + I + K + ++  +   LL +  +G +  L   M+  +  C  +      +Q+   N   +F++LL A  + FI+ + EH F++
Sbjct:  394 KCCKGFCIDILKKLSKTVKFTYDLYLVTNGKHGSKINGVWNGMIGEVVNMRAHMAVGSLTINEERSEVVDFSVPFVETGISVMVPRSNGTVSPSAFLEPFSADVWVMMFILCLLVSGIAVFIFEYFSPVGYNRQLSAGKEFGGPAFTIGKSIWLLWAIVFNNSVPVENPRGTTSKFMVSVWAFFAVIFLASYTANLAAFMIQEDYIDQVSGLSDKKFQSPLEHSPPFRFGTVPNGSTERNIRNNYLQMHGYMSK--FHQKSVEDALMSLKAGKLDAFIYDAAVL---NYMAGKDEGCRLVTIGSGKVFVATGYGIALQKSSRWKRAIDLALLQFIGDGEMDEL--EMIWLTGICHGERNDVMSSQLDIDNMAGVFYMLLVAMGLSFIVFVCEHFFYH 783          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000889.1 (pep scaffold:Pmarinus_7.0:GL476542:184998:205948:1 gene:ENSPMAG00000000813.1 transcript:ENSPMAT00000000889.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.5077 bits (223), Expect = 1.041e-20
Identity = 40/132 (30.30%), Postives = 75/132 (56.82%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWC-YVAGFALSSFEWLSPFGLN 1580
            +CC GF + +L +L   + F   LY + + K+G  + G WNG++ E+  +RA +   +LT+  +R++ +DF++PF      V++     + +  A   PFS  +W+++ + C  ++  A+  FE+LSP G N
Sbjct:   85 RCCKGFCIDILRKLSTTVRFTYDLYLVVNGKHGKKIQGVWNGMVGEVEQKRAHMAVGSLTINEERSQVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSAAVWVMMFILCLMLSAIAVWLFEYLSPVGFN 216          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005084.1 (pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 gene:ENSPMAG00000004612.1 transcript:ENSPMAT00000005084.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 2.065e-10
Identity = 71/327 (21.71%), Postives = 133/327 (40.67%), Query Frame = 3
Query: 1338 RAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFR---PFSTHIWILIALW-----CYVAGFA-LSSFEWLSPFGLNPKGRHRKRNYN-LGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFS---DLMQEPDFILASTSGTSHISIFLEKHPYLRNKIFYVKTETEGKVALRNKQ-VTAFLSEELVL----RNTDYCPNR----LEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQ----KYTQMKYKNFTSLFHVLLCAF 2240
            +A L    LT+ Y R K IDF+ PF     G+ I  +  + T+  +F    P S  IW+ I L      C +   A  S +EW +P   NP     + N+  L S    V  L  + ++    PK+   +    +W  F ++I S Y  N+ A +    ++   S   DL ++      +    S ++ F +       K++   +  +  +   N++ +   L+ +  +     N +Y   R     +I   +    + IG P  + YR++++  +L     G + H++K        CP+    + + +  +N   +F VL    
Sbjct:    9 KADLAVAPLTINYMREKAIDFSKPFMT--LGISILYRKPNGTNPGIFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTMLNSFWFGVGALMQQGSELM--PKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPISSADDLAKQTRIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQTALIKNNEEGIQRVLTTDYAMLMESTNIEYVTQRNCNLTQIGGLIDNKGYGIGTPLGSPYRDKITIAILQLQEEGKL-HMMKEKWWRGNGCPEEDSNEASALGVQNIGGIFIVLAAGL 330          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000621.1 (pep scaffold:Pmarinus_7.0:GL479810:19620:30867:-1 gene:ENSPMAG00000000562.1 transcript:ENSPMAT00000000621.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 7.760e-10
Identity = 46/190 (24.21%), Postives = 83/190 (43.68%), Query Frame = 3
Query: 1200 GFSVRLLIRLMIDMDFDVVLYSIKDYKYG-SLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIA 1766
            GFSV ++  L   + F   ++   D  YG    +G+W+G++ E++ +RA +    LT+T +R   +DFT  +     GV  +    S    A+  P     W  + L   + G  +     ++P       R  + + +L + +  VY  F ++  P  S  S  A+    VW  F  ++ S Y  ++ A
Sbjct:   22 GFSVDVMDALSKSLGFSYEIFMPADLSYGLPQADGTWSGMIGELLNKRADVAISALTITPERESVVDFTKRYMDYSVGVAARRPADSAGLFALLSPLEPATWACLGLAVGLVGLLVYLLNRVTPR------REPRHSPSLPASLWLVYGSFMQQG-PELSSSSLSARLVMGVWWLFAFIVVSSYTASLTA 204          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010600.1 (pep scaffold:Pmarinus_7.0:GL477914:43885:60233:1 gene:ENSPMAG00000009599.1 transcript:ENSPMAT00000010600.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.6026 bits (122), Expect = 5.216e-7
Identity = 38/133 (28.57%), Postives = 65/133 (48.87%), Query Frame = 3
Query: 1128 VTLLNEAFKSQRNQRMDVELKCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSL-VNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFR---PFSTHIWILIA 1514
            VT+L+  F    +  +  + K   GF+V +L  L   + F   LY   D  YG     GSW+GL+ EI+ +RA +    +T+T +R   +DFT  F      ++++++        +F    PF+T +W  +A
Sbjct:  189 VTVLDPPFVMMSDNVLG-QPKRFVGFAVDVLEELSRHLGFTYDLYQAPDNSYGRPGPGGSWSGLLGEILHKRADVGIGAVTITPERESVVDFTKRFMDRGVAIMLREQHHHQRHADLFSCLAPFAT-VWAGLA 319          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Nematostella
Match: EDO35545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL56])

HSP 1 Score: 120.168 bits (300), Expect = 1.111e-27
Identity = 93/342 (27.19%), Postives = 163/342 (47.66%), Query Frame = 3
Query: 1200 GFSVRLLIRLMIDMDFDVVLYSIKDYKYGSL--VNGS----WNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRN--YNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDL----MQEP--DFILASTSGTSHISIFLEKHPYLRN-----KIFYVKTETEGKVALRNKQVTAFLSEELVLRNTDYCPNRLEILNYL-GVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASR 2165
            GF + LLIRL   ++F   +   +D  YGSL  VNGS    WNG++ E+I  +A L+   LT+  +R + I+F+ PF      +L++   +S + D+  RPF  H+W+L+ L  ++    L   +  SPFG     R  K     NL S +   + +         +P+S+ A+    VW  F ++I + Y  N+ A ++    K   S +    ++ P   FI A+ + +S +  +  +   L +     + + VKT  EG   ++N ++ AF+ +  VL         L     L G + + IG+PK + + N +S  +L +  +G +  L    + AS+
Sbjct:  441 GFCMDLLIRLGEKVNFTYSVSLSEDGSYGSLRRVNGSDTKQWNGMVGEVIQGKADLIVAALTINNERAEWIEFSKPFKYQGLTILVKKNEQSNSLDSFLRPFQIHLWLLVLLSVHIVAVILYLLDRFSPFGRFKLARKEKEETALNLSSAMWFSWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPKAVVSGIDDPNLRNPSKQFIYATVANSS-VDAYFRRQVELSSMYTFMEGYNVKTAKEGIEKVKNGELKAFIWDSPVLYYEASKDCTLTTAGELFGRSGYGIGMPKGSPWSNAISLAILNFHESGVMEELETTWIDASK 781          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Nematostella
Match: EDO30203 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1G4])

HSP 1 Score: 98.2117 bits (243), Expect = 6.714e-21
Identity = 91/396 (22.98%), Postives = 172/396 (43.43%), Query Frame = 3
Query: 1200 GFSVRLLIRLMIDMDFDVVLYSIKDYKYGSL--VNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQ-DKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFG------------LNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIA--TVIE-TNVKKTFSDLMQEPDF----ILASTSG----TSHISIFLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSE----ELVLRNTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQKY------TQMKYKNFTSLFHVLLCAFPICFIILMVEHVF 2279
            G+ + LL +L   + F   +Y + D  +G+   V   WNG+++E++  RA L   +LT++ +R K IDFT P+      VLI+ D  +     A+ RPF   +W+ I     + GF L  F   SPFG            + P+        +L   + +    +  ++     P S   +    V+    +++ S Y  N+ A  T+   T+   +  DL ++ D     +L S       ++ +  F+    Y+R    +V    EG   + N+   AF+ +    E V  N   C   +   +  G   +  G+ KD+ Y  +LS  +L     GY+  L +  + A+ +C +         Q+ +++ + +F VL+    +  ++L++E ++
Sbjct:  475 GYCIELLRKLSEMLRFKFEVYLVPDNNFGAQDPVTKEWNGVVREVLNGRADLAVTSLTISPERQKVIDFTQPYMDLGLTVLIKPDPTEEKNPFAILRPFRYDLWMAIGGTMIIVGFFLWLFSTFSPFGFYGRCVQKCHTKIEPRYLKLHDTLSLVRALWSTVVYYVGQSSDHLHPVSSSGRITVAVYWFAMLIVMSTYTANLAAFLTIKRFTSPISSVDDLARQKDISYGTVLNSQPQAFFESASVPSFVTMWQYMRYHHTFVNNSAEGIEKVMNENY-AFIWDSAVLEFVAHNQISCGTLITSGSVFGRIGYGFGLAKDSPYTKQLSNAILQLRHAGYMEFLDRKWLKANDKCAEAAEKAKSENQLTFEDLSGVFIVLIAGIGVSCVVLVLEWIW 869          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Nematostella
Match: EDO44842 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUE9])

HSP 1 Score: 93.2041 bits (230), Expect = 2.061e-20
Identity = 82/329 (24.92%), Postives = 149/329 (45.29%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPF-HAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDL----MQEPDFILAS---------TSGTSHISI-FLEKHPYLRNKIF-----YVKTETEGKVALRNKQVTAFLSEELVLRNTDYCPNRLEILNYLGVAPFAIGVPKDA-WYRNELSKYLLIY 2111
            KCCYG  + L+  L  D+ F  V+ +I+  + GS  NG W GL+ E++   A +   ++++T  R+K +DF+ PF H G   +L+  +  S+  D   +PF    W+LI    Y+    +  FE  +P     K R+ +  +++   V  +++ FF        P+   ++   + W+   ++I ++Y  N+ A ++  +       +    +Q P   LAS         TS   +  I F   + ++RN  F      V+   EG V + +  +    + E  + N   C + L +      + FA   PK + W RN +S ++L Y
Sbjct:    1 KCCYGLCIDLIKLLSRDIGFIPVIETIQGGRAGSFKNGKWTGLIGEVVAGNADMAMSSISITSQRSKFVDFSEPFIHTGS-TILVAKRHGSFKGDGFLKPFKVSAWLLIFAVLYLVAVVVLLFESHNPGLQRQKHRNYRGEFDIHQSVWLMFSRFFSGILNAPIPRFVSSRVVLSSWSFATLMIDALYTANLAAFMVLQDQAHYIDGINDSRIQNP---LASVLKFTTIRDTSVEKYFKINFPHVYSFMRNYRFNHSSEGVRAVKEGYVIVIDAFIWESATMERYVANDTRC-SLLTVGKLFDTSGFAAAFPKGSPWTRN-ISDFILKY 323          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Nematostella
Match: EDO37551 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFF8])

HSP 1 Score: 82.4185 bits (202), Expect = 5.664e-16
Identity = 74/315 (23.49%), Postives = 147/315 (46.67%), Query Frame = 3
Query: 1191 CCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGS--LVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPF-HAG-KFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFG---LNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQEP-----DFILASTSGTSHISIFLE--KHPY-------LRNKIFYVKTETEGKVALRNKQVTAFLSEELVL-------RNTDYCPNRLEILNYLGVAPFA 2051
            CCYG ++ +L  +  +++F+  +Y ++D  YG+  L +G WNG+++++I   A +  + +T    R+  +DF++ + HAG    VL+ +K     D A F PF+  +W+ I     V   AL   + LSP+G   +N +    KR++ L   +   + + F      + P +Y ++        F ++  + Y  N+ A ++  + K   + +  +        I +    +S++  + E  + P        +R+    V   T+G   +++ ++  F+SE L L       +NT Y   RL+++      PFA
Sbjct:  449 CCYGLAIDVLNYVKTELEFEPFVYFVRDGNYGAKNLTSGEWNGVVRDLIRGEADISIDLMT-NEARSDVVDFSLRWTHAGLALLVLVGEKNVEPIDFAFFDPFTWQLWVGIIATVNVYLVALWIADRLSPYGYHQINKRSVDNKRHFELDGSMWYCWGVCFDNQFVEQRPAAYSSRAMSVCLAMFALLCLTSYTANLTAHLVSDDTKPYVTGIRDKKFTAKDSQISSGVVKSSYVDSYFELNQDPVMQMLFRRMRDNGHLVDNFTDGVRRVKSGELDIFISEILSLDYEVAKQKNTGY--PRLQVVG--ASKPFA 758          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Nematostella
Match: EDO34363 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPJ5])

HSP 1 Score: 78.5666 bits (192), Expect = 2.251e-15
Identity = 91/392 (23.21%), Postives = 164/392 (41.84%), Query Frame = 3
Query: 1191 CCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSL--VNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDK--IKSYTDDAVFRPFSTHIWILI---ALWCYVAGFALSSFEWLSPFGLNPKGRHR-----KRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDL----MQ--EPDFILASTSGTSHISIF-LEKHPYLRNKIFYVKTET-----EGKVALRNKQVTAFLSE----ELVLRNTDYCPNRLEILNYLGVAPFAIGVPKDA-WYR---NELSKYLLIYDFNGYISHLLKNMMLASRECPQKYTQMKYKNFTSLFHVLLCAFPICFIILMVE 2270
            C  G  + LL  +   + F    Y I+D+KYGS+  V G WNG++ +II   A +   TLT+T  R++ IDF+ P+     G+L +    + S  +     P S+ +W +I    L+  +  + L  +EW        KGR       KR  +L   +T  ++ F         P S  A+     +    +++ + Y   + A  ++       S +    MQ   PDF  A+   +S  + F   K   LR    ++K        +G   L + +   ++ +    E ++ ++  C  R+ I    G++ + I + K++ W R   N + K   +       S  LK   +   E  +  + +  +N   LF V+   F +C + L +E
Sbjct:    1 CISGQMIELLELIREYVHFTYEFYLIRDHKYGSVDPVTGLWNGMVGDIITGEADMALATLTITASRSRVIDFSSPYGEVGIGILARTDTTLGSVVNMDFMIPLSSQLWTVILATILFVIIVLWVLGDWEWYL------KGRSHFIPDYKRRVSLLESMTYSWSTFVHVQAGTGLPMSTSARLVALFFALAMLIVNTSYTAELAAFKVKEQFVPPISGIEDPKMQNPPPDFKFATLRDSSTEAYFRFSKDEKLRRIYEHMKDNNVEMVEDGVAKLISGEFKLYIDDQPYLEHLVSSSGNCMLRM-IGRPFGISGYGIALAKNSPWTRPISNAIIKLNDMKALENLWSKWLKRKCVTQDEFGKSPSGLSIENVNGLFVVVCAGFAMCALFLGIE 385          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Medaka
Match: GRIN3A (glutamate receptor ionotropic, NMDA 3A [Source:NCBI gene;Acc:101161818])

HSP 1 Score: 164.081 bits (414), Expect = 5.950e-41
Identity = 105/420 (25.00%), Postives = 196/420 (46.67%), Query Frame = 3
Query: 1155 SQRNQRMDVELK-CCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDL----MQEPD--FILASTSGTSHISI----FLEKHPYLRNKIFYVKTETEGKVALRN--KQVTAFLSEELVLR---NTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQK------YTQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKFTSDLKGFKKSHWIFSDHVM 2348
             +RN  +   LK CCYG+ + LL +L  DM F   LY + D KYG   NG W GL+ +++   A L   + ++   R++ IDFT PF +   G+L++ +  +    A   P    +W+ I +  +V    L+ +EW SPFG+ P+GR+R R ++  S +   Y + F +T   K PK +  +   N+W  FC+   S Y  N+ A ++     +  S +    +  P   F  A+   +S        F E H Y+R   + V    +G   L+   +++ AF+ ++ +L    + D     L +     +  + IG+P+++   +  S+ +  Y  +G++  +L +       C ++        QM  K+F+ LF +L     +  +  + EH+ +      +K  +  +W+ +  ++
Sbjct:  537 GRRNGSVPTHLKKCCYGYCIDLLEKLGEDMGFTFDLYIVGDGKYGGFKNGRWTGLVGDLLSGAAHLAVTSFSINSARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWSMWLGIFVSLHVTAIFLTLYEWHSPFGMTPRGRNRNRVFSFSSALNVCYAILFGRTVAIKPPKCWTGRLLMNLWAIFCLFCLSTYTANLAAVMVGEKTYEQLSGIHDPKLHHPSQGFRFATVRESSAEDYVKKSFPEMHEYMRR--YNVPATPDGIHNLKADPQKLDAFIMDKALLDYEVSIDADCKTLTVGKPFAIEGYGIGLPQNSPLTSNFSELVSQYKSDGFMD-MLHDKWYKVVPCGKRSFAVTETLQMGIKHFSGLFVMLCVGVALSLLTTLAEHIVYKLVIPRVKEPRSKYWLHTSQIV 953          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Medaka
Match: GRIN3A (glutamate receptor ionotropic, NMDA 3A [Source:NCBI gene;Acc:101161818])

HSP 1 Score: 162.925 bits (411), Expect = 1.949e-40
Identity = 105/421 (24.94%), Postives = 196/421 (46.56%), Query Frame = 3
Query: 1155 SQRNQRMDVELK-CCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDL----MQEPD--FILASTSGTSHIS----IFLEKHPYLRNKIFYVKTETEGKVALRN--KQVTAFLSEELVLR---NTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQK------YTQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKFTSDLKGFKKSHWIFSDHVMY 2351
             +RN  +   LK CCYG+ + LL +L  DM F   LY + D KYG   NG W GL+ +++   A L   + ++   R++ IDFT PF +   G+L++ +  +    A   P    +W+ I +  +V    L+ +EW SPFG+ P+GR+R R ++  S +   Y + F +T   K PK +  +   N+W  FC+   S Y  N+ A ++     +  S +    +  P   F  A+   +S        F E H Y+R   + V    +G   L+   +++ AF+ ++ +L    + D     L +     +  + IG+P+++   +  S+ +  Y  +G++  +L +       C ++        QM  K+F+ LF +L     +  +  + EH+ +      +K  +  +W+ +   ++
Sbjct:  596 GRRNGSVPTHLKKCCYGYCIDLLEKLGEDMGFTFDLYIVGDGKYGGFKNGRWTGLVGDLLSGAAHLAVTSFSINSARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWSMWLGIFVSLHVTAIFLTLYEWHSPFGMTPRGRNRNRVFSFSSALNVCYAILFGRTVAIKPPKCWTGRLLMNLWAIFCLFCLSTYTANLAAVMVGEKTYEQLSGIHDPKLHHPSQGFRFATVRESSAEDYVKKSFPEMHEYMRR--YNVPATPDGIHNLKADPQKLDAFIMDKALLDYEVSIDADCKTLTVGKPFAIEGYGIGLPQNSPLTSNFSELVSQYKSDGFMD-MLHDKWYKVVPCGKRSFAVTETLQMGIKHFSGLFVMLCVGVALSLLTTLAEHIVYKLVIPRVKEPRSKYWLHTSQRLH 1013          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Medaka
Match: grin3ba (glutamate ionotropic receptor NMDA type subunit 3B [Source:NCBI gene;Acc:101155155])

HSP 1 Score: 154.066 bits (388), Expect = 1.100e-37
Identity = 109/404 (26.98%), Postives = 189/404 (46.78%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVN-GSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQEPDFILASTS-----GTSHIS--------IFLEKHPYLRNKIFYVKTETEGKVALRN--KQVTAFLSEELVLR---NTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQKY------TQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKFTSDLKGFKKSH 2324
            KCCYG+ + LL +L  DM F   LY + D KYG+L   G W GL+ +++   A +   + ++   R++ IDFT PF++   G+L++    +    A   P    +W  I +  ++    L+ +EW SPFG+ P GR+R R ++  S +   Y + F +T   K+PK +  +F  N+W  FC+++ S Y  N+ A ++    +KTF  +    D  L   S     GT   S         F E H Y+R   F   T  EG   L+     + AF+ ++ +L    + D     L +     +  + IG+P+ +     +S+++  Y  +G++  +L +       C ++        QM  ++F+ LF +L        + L  EH F++     L   ++SH
Sbjct:  585 KCCYGYCIDLLEKLAEDMGFTFDLYIVGDGKYGALSGTGRWTGLVGDLLSGAADMAVTSFSINSARSRVIDFTSPFYSTSLGILVRSHDTAAPIGAFMWPLHWSMWAGIFVTLHLTALFLTLYEWNSPFGMTPHGRNRLRVFSYSSALNLCYAILFGRTVATKTPKCWTGRFLMNLWAIFCLLVLSSYTANLAAVMVG---EKTFEQVSGIHDEKLHHPSMGFRFGTVRESSAEDYMKKSFPEMHDYMRR--FNQPTTPEGVHMLKTDPPALDAFIMDKALLDFEVSIDADCKLLTVGKPFAIEGYGIGLPQGSPLTRNVSEFVSRYKSDGFMD-MLHDKWYKVVPCGKRVFAVTETLQMGIQHFSGLFVLLCIGVGGALLTLAGEHTFYHLVIPRL---RRSH 979          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Medaka
Match: grin2bb (glutamate receptor ionotropic, NMDA 2B-like [Source:NCBI gene;Acc:101163953])

HSP 1 Score: 134.806 bits (338), Expect = 1.438e-31
Identity = 94/405 (23.21%), Postives = 189/405 (46.67%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILI-ALWCYVAGFALSSFEWLSPFGLN---PKGRH-RKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQE---------PDFILAST-SGTSHISI---FLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLRNTDYCPNRLEILNYLGVAP--------FAIGVPKDAWYRNELSKYLLIYDFNGY-----------ISHLLKNMMLASRECPQKYTQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKF 2291
            +CC GF + +L ++   + F   LY + + K+G  VNG+WNG++ E+++++A +   +LT+  +R++ IDF++PF      V++     + +  A   PFS  +W+++  +   V+  A+  FE+ SP G N     GR     ++ +G  +  ++ L F  + P ++PK   +K   +VW  F ++  + Y  N+ A +I+       S L  +         P F   +  +G++  +I   + + H Y+ +  F+ K   E   +L+  ++ AF+ +  VL   +Y   R E    + +          + I + KD+ ++  +   +L+   +G            I H  KN +++S        Q+   N   +F++L  A  +  I  + EH F+++ 
Sbjct:  456 RCCKGFCIDILKKIAKAVKFTYDLYLVTNGKHGKKVNGTWNGMVGEVVLKKAHMAVGSLTINEERSEVIDFSVPFIETGISVMVSRSNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYVDQVSGLSDKKFQKPNEFSPPFRFGTVPNGSTERNIRNNYRDMHTYMTS--FHQKNVDEALYSLKTGKLDAFIYDAAVL---NYMAGRDEGCKLVTIGSGKVFASTGYGIAIQKDSGWKRAVDLAILMLFGDGEMEELEALWLTGICHNEKNEVMSS--------QLDVDNMAGVFYMLGAAMILSLITFICEHWFYWQL 847          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Medaka
Match: ENSORLT00000018671.2 (glutamate ionotropic receptor NMDA type subunit 2B [Source:NCBI gene;Acc:101173552])

HSP 1 Score: 129.028 bits (323), Expect = 8.733e-30
Identity = 91/405 (22.47%), Postives = 186/405 (45.93%), Query Frame = 3
Query: 1188 KCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILI-ALWCYVAGFALSSFEWLSPFGLN---PKGRH-RKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQE---------PDFILAST-SGTSHISI---FLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLRNTDYCPNRLEILNYLGVAP--------FAIGVPKDAWYRNELSKYLLIYDFNGY-----------ISHLLKNMMLASRECPQKYTQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKF 2291
            +CC GF + +L ++   + F   LY + + K+G  VNG+WNG++ E++++ A +   +LT+  +R++ IDF++PF      V++     + +  A   PFS  +W+++  +   V+  A+  FE+ SP G N     G+     ++ +G  +  ++ L F  + P ++PK   +K   +VW  F ++  + Y  N+ A +I+       + L  +         P F   +  +G++  +I   + E H Y+    F+ +   E   +L+  ++ AF+ +  VL   +Y   R E    + +          + I + K++ ++  +   +L    +G            I H  KN +++S        Q+   N   +F++L  A  +  I  + EH F+++ 
Sbjct:  512 RCCKGFCIDILKKIAKQVKFTYDLYLVTNGKHGKKVNGTWNGMVGEVVLKNAHMAVGSLTINEERSEVIDFSVPFIETGISVMVSRSNGTVSPSAFLEPFSADVWVMMFVMLLLVSAMAVFIFEYFSPVGYNRCLADGKEPHGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYVDQVTGLSDKKFQSPNDFSPPFRFGTVPNGSTERNIRNNYPEMHSYMTK--FHQRNVNEALQSLKAGKLDAFIYDAAVL---NYMAGRDEGCKLVTIGSGYIFATTGYGIAIQKESLWKRHVDLAILQLFGDGEMEELESLWLTGICHHEKNEVMSS--------QLDVDNMAGVFYMLGAAMALSLITFICEHWFYWQL 903          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Planmine SMEST
Match: SMESG000006949.1 (SMESG000006949.1)

HSP 1 Score: 1374.76 bits (3557), Expect = 0.000e+0
Identity = 665/668 (99.55%), Postives = 665/668 (99.55%), Query Frame = 3
Query:  357 KKFITLNFYIICAILEDDIQVHNNWHSINKSQNKYKIRKYFLTMSRINETLLDFMENCTSKIDYNERVIFIIMLKKFNFNDLFNAIFSTARVSHLENHNSILWVTVDLVFSHFYCKRCPKDTLSLRSELEENYENIINGSDTNESSQIGKAIKESFKNKLTLNIYIKVGENENSMFTFCANHKFSAKEIQRYCKIMKGVNHISTAIHFDELVVFNLNTFLPNDGILNKHSLCIFTLPCLIFNNMSDLYSYKDIKNIYVTLLNEAFKSQRNQRMDVELKCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQEPDFILASTSGTSHISIFLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLRNTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQKYTQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKFTSDLKGFKKSHWIFSDHVMYFSQ 2360
            KKFITLNFYIICAILEDDIQVHNNWHSINKSQNKYKIRKYFLTMSRINETLLDFMENCTSKIDYNERVIFIIMLKKFNFNDLFN IFSTARVSHLENHNSILWVTVDLVFSHFYCKRCPKDTLSLRSELEENYENIINGSDTNESSQIGKAIKESFKNKLTLNIYIKVGENENSMFTFCANHKFSAKEIQRYCKIMKGVNHISTAIHFDELVVFNLNTFLPNDGILNKHSLCIFTLPCLIFNNMSDLYSYKDIKNIYVTLLNEAFKSQ NQRMDVELKCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVF TLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQEPDFILASTSGTSHISIFLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLRNTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQKYTQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKFTSDLKGFKKSHWIFSDHVMYFSQ
Sbjct:   87 KKFITLNFYIICAILEDDIQVHNNWHSINKSQNKYKIRKYFLTMSRINETLLDFMENCTSKIDYNERVIFIIMLKKFNFNDLFNTIFSTARVSHLENHNSILWVTVDLVFSHFYCKRCPKDTLSLRSELEENYENIINGSDTNESSQIGKAIKESFKNKLTLNIYIKVGENENSMFTFCANHKFSAKEIQRYCKIMKGVNHISTAIHFDELVVFNLNTFLPNDGILNKHSLCIFTLPCLIFNNMSDLYSYKDIKNIYVTLLNEAFKSQTNQRMDVELKCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFGTLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQEPDFILASTSGTSHISIFLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLRNTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQKYTQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKFTSDLKGFKKSHWIFSDHVMYFSQ 754          

HSP 2 Score: 164.081 bits (414), Expect = 1.805e-41
Identity = 80/81 (98.77%), Postives = 81/81 (100.00%), Query Frame = 1
Query:  100 LTENELNEKLNRSLLDIMSDPIFADQKIIFSNVLNKNIRLLATFFENTTFLVHDSSWNTAFQAVNSNLIHLGIDGAVWFEM 342
            +TENELNEKLNRSLLDIMSDPIFADQKIIFSNVLNKNIRLLATFFENTTFLVHDSSWNTAFQAVNSNLIHLGIDGAVWFEM
Sbjct:    1 MTENELNEKLNRSLLDIMSDPIFADQKIIFSNVLNKNIRLLATFFENTTFLVHDSSWNTAFQAVNSNLIHLGIDGAVWFEM 81          

HSP 3 Score: 98.2117 bits (243), Expect = 1.041e-20
Identity = 49/62 (79.03%), Postives = 51/62 (82.26%), Query Frame = 1
Query: 2314 RSHIGFSVTTLCIS---VRLIRNPKAEYSYKEQINQILESMDMNIWFEDARRLKEIHRPIPF 2490
            +SH  FS   +  S    RLIRNPKAEYSYKEQINQILESMDMNIWFEDARRLKEIHRPIPF
Sbjct:  740 KSHWIFSDHVMYFSQKLYRLIRNPKAEYSYKEQINQILESMDMNIWFEDARRLKEIHRPIPF 801          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Planmine SMEST
Match: SMESG000006949.1 (SMESG000006949.1)

HSP 1 Score: 1373.99 bits (3555), Expect = 0.000e+0
Identity = 665/668 (99.55%), Postives = 665/668 (99.55%), Query Frame = 3
Query:  357 KKFITLNFYIICAILEDDIQVHNNWHSINKSQNKYKIRKYFLTMSRINETLLDFMENCTSKIDYNERVIFIIMLKKFNFNDLFNAIFSTARVSHLENHNSILWVTVDLVFSHFYCKRCPKDTLSLRSELEENYENIINGSDTNESSQIGKAIKESFKNKLTLNIYIKVGENENSMFTFCANHKFSAKEIQRYCKIMKGVNHISTAIHFDELVVFNLNTFLPNDGILNKHSLCIFTLPCLIFNNMSDLYSYKDIKNIYVTLLNEAFKSQRNQRMDVELKCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQEPDFILASTSGTSHISIFLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLRNTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQKYTQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKFTSDLKGFKKSHWIFSDHVMYFSQ 2360
            KKFITLNFYIICAILEDDIQVHNNWHSINKSQNKYKIRKYFLTMSRINETLLDFMENCTSKIDYNERVIFIIMLKKFNFNDLFN IFSTARVSHLENHNSILWVTVDLVFSHFYCKRCPKDTLSLRSELEENYENIINGSDTNESSQIGKAIKESFKNKLTLNIYIKVGENENSMFTFCANHKFSAKEIQRYCKIMKGVNHISTAIHFDELVVFNLNTFLPNDGILNKHSLCIFTLPCLIFNNMSDLYSYKDIKNIYVTLLNEAFKSQ NQRMDVELKCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVF TLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQEPDFILASTSGTSHISIFLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLRNTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQKYTQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKFTSDLKGFKKSHWIFSDHVMYFSQ
Sbjct:   92 KKFITLNFYIICAILEDDIQVHNNWHSINKSQNKYKIRKYFLTMSRINETLLDFMENCTSKIDYNERVIFIIMLKKFNFNDLFNTIFSTARVSHLENHNSILWVTVDLVFSHFYCKRCPKDTLSLRSELEENYENIINGSDTNESSQIGKAIKESFKNKLTLNIYIKVGENENSMFTFCANHKFSAKEIQRYCKIMKGVNHISTAIHFDELVVFNLNTFLPNDGILNKHSLCIFTLPCLIFNNMSDLYSYKDIKNIYVTLLNEAFKSQTNQRMDVELKCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFGTLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQEPDFILASTSGTSHISIFLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLRNTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQKYTQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFYKFTSDLKGFKKSHWIFSDHVMYFSQ 759          

HSP 2 Score: 175.252 bits (443), Expect = 5.025e-45
Identity = 85/86 (98.84%), Postives = 86/86 (100.00%), Query Frame = 1
Query:   85 MTFICLTENELNEKLNRSLLDIMSDPIFADQKIIFSNVLNKNIRLLATFFENTTFLVHDSSWNTAFQAVNSNLIHLGIDGAVWFEM 342
            MTFIC+TENELNEKLNRSLLDIMSDPIFADQKIIFSNVLNKNIRLLATFFENTTFLVHDSSWNTAFQAVNSNLIHLGIDGAVWFEM
Sbjct:    1 MTFICMTENELNEKLNRSLLDIMSDPIFADQKIIFSNVLNKNIRLLATFFENTTFLVHDSSWNTAFQAVNSNLIHLGIDGAVWFEM 86          

HSP 3 Score: 98.2117 bits (243), Expect = 1.066e-20
Identity = 49/62 (79.03%), Postives = 51/62 (82.26%), Query Frame = 1
Query: 2314 RSHIGFSVTTLCIS---VRLIRNPKAEYSYKEQINQILESMDMNIWFEDARRLKEIHRPIPF 2490
            +SH  FS   +  S    RLIRNPKAEYSYKEQINQILESMDMNIWFEDARRLKEIHRPIPF
Sbjct:  745 KSHWIFSDHVMYFSQKLYRLIRNPKAEYSYKEQINQILESMDMNIWFEDARRLKEIHRPIPF 806          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Planmine SMEST
Match: SMESG000006949.1 (SMESG000006949.1)

HSP 1 Score: 1309.28 bits (3387), Expect = 0.000e+0
Identity = 634/637 (99.53%), Postives = 634/637 (99.53%), Query Frame = 3
Query:  357 KKFITLNFYIICAILEDDIQVHNNWHSINKSQNKYKIRKYFLTMSRINETLLDFMENCTSKIDYNERVIFIIMLKKFNFNDLFNAIFSTARVSHLENHNSILWVTVDLVFSHFYCKRCPKDTLSLRSELEENYENIINGSDTNESSQIGKAIKESFKNKLTLNIYIKVGENENSMFTFCANHKFSAKEIQRYCKIMKGVNHISTAIHFDELVVFNLNTFLPNDGILNKHSLCIFTLPCLIFNNMSDLYSYKDIKNIYVTLLNEAFKSQRNQRMDVELKCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQEPDFILASTSGTSHISIFLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLRNTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQKYTQMKYKNFTSLFHVLLCAFPICFIILMV 2267
            KKFITLNFYIICAILEDDIQVHNNWHSINKSQNKYKIRKYFLTMSRINETLLDFMENCTSKIDYNERVIFIIMLKKFNFNDLFN IFSTARVSHLENHNSILWVTVDLVFSHFYCKRCPKDTLSLRSELEENYENIINGSDTNESSQIGKAIKESFKNKLTLNIYIKVGENENSMFTFCANHKFSAKEIQRYCKIMKGVNHISTAIHFDELVVFNLNTFLPNDGILNKHSLCIFTLPCLIFNNMSDLYSYKDIKNIYVTLLNEAFKSQ NQRMDVELKCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVF TLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQEPDFILASTSGTSHISIFLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLRNTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQKYTQMKYKNFTSLFHVLLCAFPICFIILMV
Sbjct:   92 KKFITLNFYIICAILEDDIQVHNNWHSINKSQNKYKIRKYFLTMSRINETLLDFMENCTSKIDYNERVIFIIMLKKFNFNDLFNTIFSTARVSHLENHNSILWVTVDLVFSHFYCKRCPKDTLSLRSELEENYENIINGSDTNESSQIGKAIKESFKNKLTLNIYIKVGENENSMFTFCANHKFSAKEIQRYCKIMKGVNHISTAIHFDELVVFNLNTFLPNDGILNKHSLCIFTLPCLIFNNMSDLYSYKDIKNIYVTLLNEAFKSQTNQRMDVELKCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFGTLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQEPDFILASTSGTSHISIFLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLRNTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQKYTQMKYKNFTSLFHVLLCAFPICFIILMV 728          

HSP 2 Score: 175.637 bits (444), Expect = 3.707e-45
Identity = 85/86 (98.84%), Postives = 86/86 (100.00%), Query Frame = 1
Query:   85 MTFICLTENELNEKLNRSLLDIMSDPIFADQKIIFSNVLNKNIRLLATFFENTTFLVHDSSWNTAFQAVNSNLIHLGIDGAVWFEM 342
            MTFIC+TENELNEKLNRSLLDIMSDPIFADQKIIFSNVLNKNIRLLATFFENTTFLVHDSSWNTAFQAVNSNLIHLGIDGAVWFEM
Sbjct:    1 MTFICMTENELNEKLNRSLLDIMSDPIFADQKIIFSNVLNKNIRLLATFFENTTFLVHDSSWNTAFQAVNSNLIHLGIDGAVWFEM 86          

HSP 3 Score: 131.724 bits (330), Expect = 3.997e-31
Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 1
Query: 2308 VSRSHIGFSVTTLCISVRLIRNPKAEYSYKEQINQILESMDMNIWFEDARRLKEIHRPIPF 2490
            VSRSHIGFSVTTLCISVRLIRNPKAEYSYKEQINQILESMDMNIWFEDARRLKEIHRPIPF
Sbjct:  728 VSRSHIGFSVTTLCISVRLIRNPKAEYSYKEQINQILESMDMNIWFEDARRLKEIHRPIPF 788          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Planmine SMEST
Match: SMESG000037019.1 (SMESG000037019.1)

HSP 1 Score: 211.846 bits (538), Expect = 6.491e-57
Identity = 132/439 (30.07%), Postives = 214/439 (48.75%), Query Frame = 3
Query: 1125 YVTLLNEAFKSQRNQRMDVE---LKCCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNI---IATVI-------ETNVKKTFSDLMQEPDFILASTSGTSHISIFLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLRN----TDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQ--------KYTQMKYK--NFTSLFHVLLCAFPICFIILMVEHVFFYKFTSDLKGFKKSHWIFSDHVMYFSQ 2360
            Y  + N   + Q+N  +      ++CCYGFS+ +L +L +D+ +D+  Y + +  YGS +N  WNG+++ I+   A +     ++T DR K ID + PF+     +L   K +      V++PF+  +W+ I +   V   A+  FEW SPFGL+P GR R +NY L S + +VY + F  T   K+PKS+P K+ QN W   CIVI +MY  N+   IA V        E NV  T   ++++ + I       + I +  +++P ++  + Y+ +  + +    NK +   L E LV+RN       C      LN +G   +  G  KD+W +NE+   L IY   G+   L K++  ++  C +        K  +  YK  N   LF  L     + F+IL +EH+ ++          K     S HVM+ SQ
Sbjct:  404 YFDIYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVDRTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAGVAHLSNTNSELNVGNTQIGIIKDSNII------QTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLN-IGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCWKSIHVMFISQ 835          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Planmine SMEST
Match: SMESG000009938.1 (SMESG000009938.1)

HSP 1 Score: 145.976 bits (367), Expect = 2.272e-35
Identity = 104/394 (26.40%), Postives = 187/394 (47.46%), Query Frame = 3
Query: 1191 CCYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWC-YVAGFALSSFEWLSPFGLNPKGRHR-KRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDL------------MQEPDFILAST-SGTSHISI---FLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVLRNTDYCPNRLE------ILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASRECPQKYT------QMKYKNFTSLFHVLLCAFPICFIILMVEHVFF 2282
            CC G ++ LL  +M D++F V L+ + D K+G      WNGL+K ++  +A LV  +L +T +R++ IDF+ PF      +++  +  + +  A   P+    W LI ++  +  G AL  +EWLSP GL+     R    ++L   +  ++++ F       +P+   ++F  N+W  F +V  + Y  N+ A +I    K  F DL              +P F  A+  SG +  ++   F +   Y++N  F   T  +G  AL+  ++ AF+ +  VL   DY   + +      + N   +  + +G PK + +R +++  +L Y   G +    +  M    +C ++ T      ++   NF S F +LL    +C  IL +EH+FF
Sbjct:  576 CCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMI---AKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQN--FNKTTVDDGIKALKTGEIDAFIYDSNVL---DYKAAKDKKCKLKTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTG--QCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFF 959          
The following BLAST results are available for this feature:
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIN3A1.721e-4126.03glutamate ionotropic receptor NMDA type subunit 3A... [more]
GRIN3B1.101e-3824.76glutamate ionotropic receptor NMDA type subunit 3B... [more]
GRIN2B1.915e-3223.21glutamate ionotropic receptor NMDA type subunit 2B... [more]
GRIN2A1.839e-3123.60glutamate ionotropic receptor NMDA type subunit 2A... [more]
GRIN2A1.883e-3123.60glutamate ionotropic receptor NMDA type subunit 2A... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nmr-21.709e-3424.57NMDA class glutamate Receptor [Source:UniProtKB/T... [more]
nmr-29.348e-2222.50NMDA class glutamate Receptor [Source:UniProtKB/T... [more]
glr-52.028e-1923.76GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-62.759e-1625.42GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-34.696e-1420.05GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nmdar26.729e-2925.51gene:FBgn0053513 transcript:FBtr0091453[more]
Nmdar26.729e-2925.51gene:FBgn0053513 transcript:FBtr0301842[more]
Nmdar26.729e-2925.51gene:FBgn0053513 transcript:FBtr0091454[more]
Nmdar28.695e-2925.51gene:FBgn0053513 transcript:FBtr0301843[more]
Nmdar21.089e-2825.51gene:FBgn0053513 transcript:FBtr0070288[more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grin3bb4.264e-4326.58glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
grin3bb1.158e-4227.51glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
grin3ba2.544e-4227.76glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
grin3a3.510e-3726.93glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
grin3a4.268e-3726.93glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nup1552.836e-4326.68nucleoporin 155kDa [Source:Xenbase;Acc:XB-GENE-973... [more]
GRIN3B3.108e-3525.76glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
GRIN2B3.456e-3323.95glutamate receptor, ionotropic, N-methyl D-asparta... [more]
GRIN2B5.523e-3323.95glutamate receptor, ionotropic, N-methyl D-asparta... [more]
GRIN2B6.985e-3323.95glutamate receptor, ionotropic, N-methyl D-asparta... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Grin3a4.063e-4226.23glutamate receptor ionotropic, NMDA3A [Source:MGI ... [more]
Grin3a4.638e-4226.23glutamate receptor ionotropic, NMDA3A [Source:MGI ... [more]
Grin3b1.954e-4123.92glutamate receptor, ionotropic, NMDA3B [Source:MGI... [more]
Grin3b3.998e-3924.23glutamate receptor, ionotropic, NMDA3B [Source:MGI... [more]
Grin2b1.457e-3223.21glutamate receptor, ionotropic, NMDA2B (epsilon 2)... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8TCU5|NMD3A_HUMAN8.266e-4126.03Glutamate receptor ionotropic, NMDA 3A OS=Homo sap... [more]
sp|Q9R1M7|NMD3A_RAT8.271e-4126.23Glutamate receptor ionotropic, NMDA 3A OS=Rattus n... [more]
sp|Q8VHN2|NMD3B_RAT6.483e-3924.47Glutamate receptor ionotropic, NMDA 3B OS=Rattus n... [more]
sp|Q91ZU9|NMD3B_MOUSE2.797e-3824.23Glutamate receptor ionotropic, NMDA 3B OS=Mus musc... [more]
sp|O60391|NMD3B_HUMAN5.285e-3824.76Glutamate receptor ionotropic, NMDA 3B OS=Homo sap... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1Q8811.122e-5231.49Glutamate [NMDA] receptor subunit 3A OS=Crassostre... [more]
A0A210Q7T02.235e-5130.54Glutamate receptor ionotropic, NMDA 3A OS=Mizuhope... [more]
R7TA671.402e-4731.44Uncharacterized protein (Fragment) OS=Capitella te... [more]
A0A0L8FX185.021e-4535.51Uncharacterized protein (Fragment) OS=Octopus bima... [more]
A0A2T7NPA11.161e-4429.71Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grin3bb3.799e-4328.02glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
GRIN3A3.902e-4127.39glutamate ionotropic receptor NMDA type subunit 3A... [more]
GRIN3A4.259e-4127.39glutamate ionotropic receptor NMDA type subunit 3A... [more]
grin3bb2.363e-4029.25glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
grin3ba8.406e-3725.74glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010716.12.463e-3624.43pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1... [more]
ENSPMAT00000000889.11.041e-2030.30pep scaffold:Pmarinus_7.0:GL476542:184998:205948:1... [more]
ENSPMAT00000005084.12.065e-1021.71pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 ... [more]
ENSPMAT00000000621.17.760e-1024.21pep scaffold:Pmarinus_7.0:GL479810:19620:30867:-1 ... [more]
ENSPMAT00000010600.15.216e-728.57pep scaffold:Pmarinus_7.0:GL477914:43885:60233:1 g... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO355451.111e-2727.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302036.714e-2122.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448422.061e-2024.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375515.664e-1623.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343632.251e-1523.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIN3A5.950e-4125.00glutamate receptor ionotropic, NMDA 3A [Source:NCB... [more]
GRIN3A1.949e-4024.94glutamate receptor ionotropic, NMDA 3A [Source:NCB... [more]
grin3ba1.100e-3726.98glutamate ionotropic receptor NMDA type subunit 3B... [more]
grin2bb1.438e-3123.21glutamate receptor ionotropic, NMDA 2B-like [Sourc... [more]
ENSORLT00000018671.28.733e-3022.47glutamate ionotropic receptor NMDA type subunit 2B... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006949.11.805e-4199.55SMESG000006949.1[more]
SMESG000006949.15.025e-4599.55SMESG000006949.1[more]
SMESG000006949.13.707e-4599.53SMESG000006949.1[more]
SMESG000037019.16.491e-5730.07SMESG000037019.1[more]
SMESG000009938.12.272e-3526.40SMESG000009938.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014085 ID=SMED30014085|Name=Glutamate receptor ionotropic, NMDA 3A|organism=Schmidtea mediterranea sexual|type=transcript|length=2751bp
ATGTCGTTTTTTCAAGTTATAATTTTTGTTGACTGTGCCCTATTCATAAA
CAAAAATAATAACAGAAATTGTTCAGACTTACCAATGACTTTTATTTGCC
TGACAGAAAATGAATTAAATGAAAAACTGAATCGGTCTCTCCTTGACATT
ATGTCTGATCCAATTTTTGCCGATCAGAAAATAATATTTTCTAATGTTTT
GAATAAAAACATCCGATTGTTGGCGACATTCTTTGAAAATACAACTTTTC
TCGTGCATGACTCCAGTTGGAATACCGCATTTCAGGCAGTAAATTCTAAT
TTGATCCATTTGGGAATTGATGGGGCAGTTTGGTTTGAAATGCTGAAAAT
TCTTTCAAAAAATTTATTACTCTGAATTTCTACATTATTTGTGCAATTCT
AGAAGACGACATCCAAGTCCACAACAATTGGCATAGCATTAATAAAAGCC
AAAATAAGTATAAAATAAGGAAATATTTCCTGACAATGAGTCGTATCAAT
GAAACTTTGTTGGATTTTATGGAAAACTGTACGAGCAAAATAGATTATAA
TGAACGAGTTATTTTCATAATTATGCTTAAAAAATTTAACTTCAACGATT
TGTTCAACGCAATATTCTCAACTGCCCGTGTTAGCCACCTAGAAAATCAC
AATTCCATTCTTTGGGTCACGGTTGACTTGGTTTTCAGTCATTTTTATTG
CAAACGATGTCCAAAGGATACGTTAAGTTTACGATCGGAGTTAGAGGAAA
ATTACGAAAATATAATTAATGGATCAGATACTAATGAAAGCTCACAAATT
GGAAAGGCTATCAAAGAGTCATTCAAAAATAAACTGACATTGAACATTTA
CATAAAGGTTGGTGAAAATGAAAATTCCATGTTTACATTTTGTGCAAATC
ATAAGTTTTCAGCCAAAGAAATCCAAAGATATTGTAAAATCATGAAAGGT
GTCAACCATATTTCCACTGCAATCCATTTTGACGAATTAGTCGTTTTTAA
CCTCAACACCTTCTTGCCAAATGATGGAATTCTAAATAAGCATAGTTTAT
GTATTTTTACCCTACCTTGTCTTATTTTTAATAACATGTCTGATTTATAC
AGTTATAAAGACATTAAAAATATTTATGTAACTCTCCTAAATGAGGCCTT
CAAATCTCAAAGAAACCAACGAATGGATGTCGAACTAAAATGTTGTTACG
GGTTTTCTGTCCGACTACTGATACGATTGATGATAGACATGGACTTCGAT
GTGGTCCTTTATTCCATAAAAGATTATAAATACGGTTCCTTAGTCAATGG
ATCATGGAATGGCCTAATGAAAGAAATCATAATTCGAAGAGCTCAGTTAG
TGTTTGAGACTTTGACAGTGACCTACGACAGAAATAAACATATAGATTTT
ACCATTCCGTTTCATGCTGGAAAATTTGGAGTTCTAATTCAAGATAAAAT
AAAGTCATACACAGACGATGCTGTGTTTCGACCGTTTTCAACTCATATTT
GGATTTTAATTGCTCTTTGGTGTTACGTAGCCGGTTTCGCTTTATCCTCT
TTTGAATGGTTAAGTCCGTTCGGATTGAATCCAAAAGGAAGACATAGAAA
ACGAAATTATAATTTAGGTAGTGGCGTAACCGCTGTATATACTTTATTTT
TCAGGAAAACCCAACCTTTTAAATCGCCAAAGTCTTATCCAGCCAAATTC
TTTCAAAACGTATGGACTTGTTTCTGTATTGTTATTTTCTCCATGTATAT
CAACAATATAATTGCCACAGTCATTGAAACTAACGTCAAAAAAACATTTT
CCGATTTAATGCAAGAACCTGATTTCATTCTTGCATCGACTTCCGGTACA
AGTCATATTTCGATTTTCCTAGAAAAACATCCGTATTTAAGAAATAAAAT
TTTCTATGTCAAAACGGAAACCGAGGGAAAAGTAGCTTTAAGAAATAAGC
AAGTCACCGCATTTCTCAGTGAAGAATTAGTCTTAAGAAACACAGATTAT
TGCCCCAACAGATTGGAGATTTTGAATTATTTAGGAGTTGCTCCCTTTGC
AATAGGCGTCCCCAAGGATGCTTGGTATCGAAATGAATTATCCAAATACC
TACTAATTTACGATTTTAATGGTTACATCAGTCATTTATTAAAAAATATG
ATGCTAGCTTCTCGAGAATGCCCGCAAAAATATACTCAAATGAAATACAA
AAATTTCACATCTTTATTTCACGTTTTACTTTGTGCATTTCCGATTTGTT
TCATTATTCTGATGGTCGAGCACGTCTTTTTCTACAAGTTCACGTCTGAT
TTGAAAGGTTTCAAGAAGTCACATTGGATTTTCAGTGACCACGTTATGTA
TTTCAGTCAGATTAATCAGGAACCCAAAAGCTGAATACTCTTACAAAGAG
CAAATTAATCAAATACTAGAGTCAATGGATATGAATATATGGTTCGAAGA
TGCCAGAAGATTAAAAGAAATTCATAGGCCAATTCCATTTTATTTGATCG
TAGAAGTCATAATAGCAAAAAACCGGATAATGAAAAGAATTGAAATGATG
AAAAAGATCAAGGAGATCAAATCTAAACCTGTGAATAATTTAACAAAATC
ATTATCAGAAATAAATAACAGAAATAAAAAAAGGCATTCAAATTTGTGTT
TAAAAAGAAAGTGTCACAGTTCAAAGTTTTCTGCATTTCCCTTGACAGAA
TTTTATTCTAATGATGCTTTTGAAATTGATTCTATTCCTTTTCAACATTT
G
back to top

protein sequence of SMED30014085-orf-1

>SMED30014085-orf-1 ID=SMED30014085-orf-1|Name=SMED30014085-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=109bp
MDMNIWFEDARRLKEIHRPIPFYLIVEVIIAKNRIMKRIEMMKKIKEIKS
KPVNNLTKSLSEINNRNKKRHSNLCLKRKCHSSKFSAFPLTEFYSNDAFE
IDSIPFQHL
back to top

protein sequence of SMED30014085-orf-2

>SMED30014085-orf-2 ID=SMED30014085-orf-2|Name=SMED30014085-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=125bp
MSFFQVIIFVDCALFINKNNNRNCSDLPMTFICLTENELNEKLNRSLLDI
MSDPIFADQKIIFSNVLNKNIRLLATFFENTTFLVHDSSWNTAFQAVNSN
LIHLGIDGAVWFEMLKILSKNLLL*
back to top

protein sequence of SMED30014085-orf-3

>SMED30014085-orf-3 ID=SMED30014085-orf-3|Name=SMED30014085-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=633bp
MSRINETLLDFMENCTSKIDYNERVIFIIMLKKFNFNDLFNAIFSTARVS
HLENHNSILWVTVDLVFSHFYCKRCPKDTLSLRSELEENYENIINGSDTN
ESSQIGKAIKESFKNKLTLNIYIKVGENENSMFTFCANHKFSAKEIQRYC
KIMKGVNHISTAIHFDELVVFNLNTFLPNDGILNKHSLCIFTLPCLIFNN
MSDLYSYKDIKNIYVTLLNEAFKSQRNQRMDVELKCCYGFSVRLLIRLMI
DMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRAQLVFETLTVTYDRN
KHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAG
FALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKS
YPAKFFQNVWTCFCIVIFSMYINNIIATVIETNVKKTFSDLMQEPDFILA
STSGTSHISIFLEKHPYLRNKIFYVKTETEGKVALRNKQVTAFLSEELVL
RNTDYCPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISH
LLKNMMLASRECPQKYTQMKYKNFTSLFHVLLCAFPICFIILMVEHVFFY
KFTSDLKGFKKSHWIFSDHVMYFSQINQEPKS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0015276ligand-gated ion channel activity
GO:0038023signaling receptor activity
GO:0004970ionotropic glutamate receptor activity
GO:0005234extracellular-glutamate-gated ion channel activity
GO:0004872receptor activity
GO:0005216ion channel activity
Vocabulary: cellular component
TermDefinition
GO:0030054cell junction
GO:0045202synapse
GO:0045211postsynaptic membrane
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
GO:0098794postsynapse
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001320Iontro_rcpt
IPR019594Glu/Gly-bd
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0034220ion transmembrane transport
GO:0035235ionotropic glutamate receptor signaling pathway
GO:0060079excitatory postsynaptic potential