SMED30014075

Overview
NameSMED30014075
Smed IDSMED30014075
Length (bp)2000
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30014075 (SMED30014075) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30014075 (SMED30014075) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30014075 (SMED30014075) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30014075 (SMED30014075) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014075

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30014075h1SMcG0022129 dd_Smed_v4_1598_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014075h1SMcG0022129 dd_Smed_v4_1598_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30014075 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.005523:25996..28778 -7641
v31.001816:22793..25236 -5842
Homology
BLAST of SMED30014075 vs. Planmine SMEST
Match: SMESG000022780.1 (SMESG000022780.1)

HSP 1 Score: 572.392 bits (1474), Expect = 0.000e+0
Identity = 334/480 (69.58%), Postives = 358/480 (74.58%), Query Frame = 3
Query:  111 MLFENLLNSELGDVKTFIESNINGLKDVNDIINNDTLKNSSKIFPLKNDEINQMINNWQIISQSTLNLFNEPEPKKIFGIGDSSAIRRPTERNVVEILYQYVLWHSVGKYISSVRDFQIDFACKLGITSFKCEKCATENQIDELECSMCGESVMSYLKANIRALGELXXXXXXXXXXXXXXXISMKNKNDENSSQWKCEYCGNANEFLSNRCAGCPNLRRESNDRSDNPAGEGFIENWDCWWRGCIKKNYGNHQYCSHCGVDKAANQNRGEIINVLKDGRKEEMWICTKCGFFNGYLDSDKCEICEEMRYEKDAYEIITDVEMKR----AAGELDD-WKCGKCEC----VNNYHLVS-----------------------------CKAC----EEIKEKLCNICSERFQAAGEICPDCNARWKCWYNLCGEMNNRNVDYCKCCGLGKGDAGKYGIPITRWLSGECDEIWICRSCRLINK 1424
            MLFENLLNSELGDVKTFIESNINGLKDVNDIINNDTLKNSSKIFPLKNDEINQMINNWQIISQSTLNLFNEPEPKKIFGIGDSSAIRRPTE+NVVEILYQYVLWHSVGKYISSVRDFQIDFA KLGITSFKCEKCATENQIDELECSMCGESVMSYLKAN RALGELKEKINKNENNEQMNNISMKNKNDENSSQWKCEYCGNANEFLSNRCAGCPNLRRESNDRSDNPAG    ENWDCWWRGC+K+NYGNHQYCSHCGVDKAANQNRGEIINVLKDGRKE+MWICTKCGF NG LDSDKCEICE  R  K+  E  ++    R    A GE+D+ W C    C      N+   S                             C  C     +I  K+C  C+E            N  WKC  ++CG+ N  +  YC  CG+ +      G  I   L+G  +++WIC  C   N+
Sbjct:    1 MLFENLLNSELGDVKTFIESNINGLKDVNDIINNDTLKNSSKIFPLKNDEINQMINNWQIISQSTLNLFNEPEPKKIFGIGDSSAIRRPTEKNVVEILYQYVLWHSVGKYISSVRDFQIDFAGKLGITSFKCEKCATENQIDELECSMCGESVMSYLKANNRALGELKEKINKNENNEQMNNISMKNKNDENSSQWKCEYCGNANEFLSNRCAGCPNLRRESNDRSDNPAGGEIDENWDCWWRGCMKRNYGNHQYCSHCGVDKAANQNRGEIINVLKDGRKEKMWICTKCGFHNGDLDSDKCEICECSR--KEEKENKSEQNRGRLGNPAGGEIDENWDCWSRNCRERNYGNHQYCSHCGVDKAANQNRGEIINVFKDGRKEKMWICNGCNHFNRDINAKICKSCNESRYEIESAINKANENWKCQQSICGKANVGSDKYCSRCGVDRAANQNRGEVIGVLLNGRKEKMWICNECNHFNR 478          

HSP 2 Score: 412.92 bits (1060), Expect = 1.755e-134
Identity = 212/292 (72.60%), Postives = 231/292 (79.11%), Query Frame = 3
Query:  675 NDENSSQWKCEYCGNANEFLSNRCAGCPNLRRESNDRSDNPAGEGFIENWDCWWRGCIKKNYGNHQYCSHCGVDKAANQNRGEIINVLKDGRKEEMWICTKCGFFNGYLDSDKCEICEEMRYEKDAYEIITDVEMKRAAGELDDWKCGKCECVNNYHLVSCKACEEIKEKLCNICSERFQAAGEICPDCNARWKCWYNLCGEMNNRNVDYCKCCGLGKGDAGKYGIPITRWLSGECDEIWICRSCRLINKGCSSFCSANGYNGYCTGRRDRLCYNCKCWVEHSQYKCPNCHR 1550
            N      W C  C + N  ++ +     N  R   + + N A E    NW C    C K N G+ +YCSHCGVD+AANQNR EIINVLKDG++E++WICTKCGFFNG L SDKCEICEEMRYEKDAYEIITDVEMKRA+GEL+DWKCGKCECVNNYHLVSC+ C EIKEKLCNICS+RFQAAGEICP CNARWKCWYNLCGEMNNRNVDYCK CGLGKGDAGKYGIPI RWLSGECDEIWICR C LINK  + +C A   NGYC GRR RLCY CKCWVEHSQYKCPNCHR
Sbjct:  461 NGRKEKMWICNECNHFNRDINAKICKSCNESRYEIESAINKANE----NWKCLQSICGKANVGSDKYCSHCGVDRAANQNR-EIINVLKDGKEEKIWICTKCGFFNGDLGSDKCEICEEMRYEKDAYEIITDVEMKRASGELNDWKCGKCECVNNYHLVSCETCGEIKEKLCNICSKRFQAAGEICPGCNARWKCWYNLCGEMNNRNVDYCKYCGLGKGDAGKYGIPIARWLSGECDEIWICRKCNLINKDYNDYCWA---NGYCPGRRGRLCYYCKCWVEHSQYKCPNCHR 744          

HSP 3 Score: 88.9669 bits (219), Expect = 4.435e-18
Identity = 52/124 (41.94%), Postives = 70/124 (56.45%), Query Frame = 3
Query:  672 KNDENSSQWKCEYCGNANEFLSNRCAGCPNLRRESNDRSDNPAGEGFIENWDCWWRGCIKKNYGNHQYCSHCGVDKAANQNRGEIINVLKDGRKEEMWICTKCGFFNGYLDSDKCEICEEMRYE 1043
            K+      W C  C + N  ++ +     N  R   + + N A E    NW C    C K N G+ +YCS CGVD+AANQNRGE+I VL +GRKE+MWIC +C  FN  +++  C+ C E RYE
Sbjct:  375 KDGRKEKMWICNGCNHFNRDINAKICKSCNESRYEIESAINKANE----NWKCQQSICGKANVGSDKYCSRCGVDRAANQNRGEVIGVLLNGRKEKMWICNECNHFNRDINAKICKSCNESRYE 494          
BLAST of SMED30014075 vs. Planmine SMEST
Match: SMESG000022814.1 (SMESG000022814.1)

HSP 1 Score: 440.654 bits (1132), Expect = 2.788e-145
Identity = 226/302 (74.83%), Postives = 241/302 (79.80%), Query Frame = 3
Query:  672 KNDENSSQWKCEYCGNANEFL-SNRCAGCPNLRRESND--------RSDNPAGEGFIENWDCWWRGCIKKNYGNHQYCSHCGVDKAANQNRGEIINVLKDGRKEEMWICTKCGFFNGYLDSDKCEICEEMRYEKDAYEIITDVEMKRAAGELDDWKCGKCECVNNYHLVSCKACEEIKEKLCNICSERFQAAGEICPDCNARWKCWYNLCGEMNNRNVDYCKCCGLGKGDAGKYGIPITRWLSGECDEIWICRSCRLINKGCSSFCSANGYNGYCTGRRDRLCYNCKCWVEHSQYKCPNCHR 1550
            K+      W C  CG  N  L S++C  C   R+E  +        R  NPAG    ENWDCW R C K+NYGNHQYCSHCGVD+AANQNRGEIIN  KDG++E++WICTKCG FNG LDSDKCEICEEMRYEKDAYEIITDVEMKRAAG L+DWKCGKCECVNNY LVSCKAC EIKEKLCNICSERFQAAGEICP CNARWKCWYNLCGEMNNRNVDYCK CGLGKGDAGKYGIPI RWLSGECDEIWICR C LINK  + +C A   NGYC GRR RLCY CKCWVE+SQYKCPNC R
Sbjct:  440 KDGRKEKMWICTKCGLFNGDLDSDKCEICECSRKEEKENKYEQNRGRLGNPAGGEIDENWDCWSRSCRKRNYGNHQYCSHCGVDRAANQNRGEIINAFKDGKEEKIWICTKCGLFNGDLDSDKCEICEEMRYEKDAYEIITDVEMKRAAGVLNDWKCGKCECVNNYDLVSCKACGEIKEKLCNICSERFQAAGEICPGCNARWKCWYNLCGEMNNRNVDYCKYCGLGKGDAGKYGIPIARWLSGECDEIWICRKCNLINKENNYYCWA---NGYCPGRRGRLCYYCKCWVEYSQYKCPNCDR 738          

HSP 2 Score: 275.404 bits (703), Expect = 2.944e-82
Identity = 194/484 (40.08%), Postives = 253/484 (52.27%), Query Frame = 3
Query:  147 DVKTFIESNINGLKDVNDI-INNDTLKNSSKIFPLKN-DEINQMINNWQIISQSTLNLFNEPE------PKKIFGIGDSS-----------AIRRPTERNVVEILYQYVLWHSVGKYISSVRDFQIDFACKLGITSFKCEKCATENQIDELECSMCGESVMSYLKANIRALGELXXXXXXXXXXXXXXXISMKNKNDENSSQWKCEYCGNANEFLSNRCAGCPNLRRESNDRSDNPAGEGFIENWDCWWRGCIKKNYGNHQYCSHCGVDKAANQNRGEIINVLKDGRKEEMWICTKCGFFNGYLDSDKCEICEEMRYE--KDAYEIITDVEMKRAAGELDD-WKCGKCECV-----NNYHLVSC---KACEEIKEKLCNICSERFQAAGEICPDC-----------------------------NARWKCWYNLCGEMNNRNVDYCKCCGLGKGDAGKYGIPITRWLSGECDEIWICRSCRLIN 1421
            DV+ ++++N NG+K+ NDI I N      S    +K+ DEI + +NN +  +Q  LNLFNE E        +I+GI + S           A ++PT  +V E LY +VLW +V +Y+  ++  Q+D A KLGITSF+C+ C  + +IDELECS+C ESVMSYLKA +                      +  NKN   +SQ                         ESNDRSDNPAGEGFIENWDCW RGC+KKNYGNHQYCSHCGVDKAANQNRGEIINVLKDGRKE+MWICTKCGF NG LDSDKC ICE  R E  ++  E         A GE+D+ W C    C      N+ +   C   KA  + + ++ N+  +  +    IC +C                             N  WKC  ++CG+ N  +  YC  CG+ +      G  I     G  +++WIC  C L N
Sbjct:   14 DVEIYVKNNSNGIKNANDINIANLKFSIKSPSLDIKDEDEIYRNLNNSKRAAQLILNLFNEFEYFKKLPISRIYGIPNCSNLDKFYGNNLTADQKPTLEDVTEALYHFVLWSAVAEYVE-MKVVQLDLAEKLGITSFECKMCTNKIRIDELECSVCEESVMSYLKAKVEK--------------GCFATETKSNKNQIGASQ-------------------------ESNDRSDNPAGEGFIENWDCWRRGCMKKNYGNHQYCSHCGVDKAANQNRGEIINVLKDGRKEKMWICTKCGFHNGDLDSDKCGICECSRKEERENKSEQNRGRLGNSAGGEIDENWDCWSRSCRKRNYGNHQYCSHCGVDKAANQNRGEIINVLKDGRKEEMWICNECNHFNWDINAKICKSCNESRYEIECAINKANENWKCQQSICGKANVGSDKYCSRCGVDRAANQNRGEIINVLKDGRKEKMWICTKCGLFN 457          
BLAST of SMED30014075 vs. Planmine SMEST
Match: SMESG000022815.1 (SMESG000022815.1)

HSP 1 Score: 78.1814 bits (191), Expect = 9.734e-15
Identity = 69/261 (26.44%), Postives = 108/261 (41.38%), Query Frame = 3
Query:  669 NKNDENSSQWKCEYCGNANEFLSNRCAGCPNLRRESNDRSDNPAGEGFIENWDCWWRGCIKKNYGNHQYCSHCGVDKAANQNRGEIINVLKDGRKEEMWICTKCGFFNGYLDSDKCE--------ICEEMRYEKDAYEIITDV--EMKRAAGEL----DDWKCGKCECVNNYHLVSCKACEEIKEKLCNICSERFQAAGEICPDCNARWKCWYNLCGEMNNRNVDYCKCCGLGKGDAGKYGIPITRWLSGECDEIWICRSC 1409
            NK   N +QW+CE C   NE    +C  C            N   +     W CW   C KKN G   +C  C +D+       +++     G  +E+WIC+KCG  N   ++DKC+        +    +   +  EIIT+   E+++   E+    + W+CGKC  +N+Y+   C AC+             F +         + W+CW   C +MN     +C+ C L +         +  +   E  EIWIC  C
Sbjct:  230 NKITLNPNQWQCEKCTLVNENRDYKCVLC------------NFPSQSHQSPWQCWKVNCGKKNKGEDVFCLQCKLDRNPPDPITKLVKSYAGGEMKEIWICSKCGNEN-RKENDKCDRKNCYQSKLNARSKEITNHKEIITNQKEELQQNGNEIILNSNKWRCGKCNLINDYN---CAACD-------------FPSQ--------SSWQCWNIDCEKMNKGVNKFCQQCRLDRNPPDPITKLVKSYAEKEIKEIWICSKC 453          

HSP 2 Score: 68.9366 bits (167), Expect = 7.629e-12
Identity = 62/253 (24.51%), Postives = 104/253 (41.11%), Query Frame = 3
Query:  684 NSSQWKCEYCGNANEFLSNRCAGCPNLRRESNDRSDNPAGEGFIENWDCWWRGCIKKNYGNHQYCSHCGVDKAANQNRGEIINVLKDGRKEEMWICTKCGFFNGYLDSDKCEI--CEEMRYEKDAYEIITDVE--------MKRAAGEL----DDWKCGKCECVNNYHLVSCKACEEIKEKLCNICSERFQAAGEICPDCNARWKCWYNLCGEMNNRNVDYCKCCGLGKGDAGKYGIPITRWLSGECDEIWIC 1400
            NS++W+C  C   N++    CA C           D P+       W CW   C K N G +++C  C +D+       +++    +   +E+WIC+KCG  N   ++DKC+   C + +    + EII D E        +++   E+    + W+C KC  +N  ++  C AC   ++  C                    W+CW   C  +N     +C+ C L +         +  +   E  EIWIC
Sbjct:  373 NSNKWRCGKCNLINDY---NCAAC-----------DFPSQSS----WQCWNIDCEKMNKGVNKFCQQCRLDRNPPDPITKLVKSYAEKEIKEIWICSKCGNEN-RKENDKCDRKNCYQSKLNARSKEIINDEEIITNQKEELQQNGNEIILNSNQWRCEKCTVINKNNVFQCSACNWERKLDC--------------------WQCWNGDCKAVNKGVNMFCQKCKLDRNPPDPKTKLVKSYTGSEMKEIWIC 586          

HSP 3 Score: 61.6178 bits (148), Expect = 1.493e-9
Identity = 69/278 (24.82%), Postives = 103/278 (37.05%), Query Frame = 3
Query:  681 ENSSQWKCEYCGNANEFLSNRCAGCPNLRRE---------------------SNDRSDNPAGEGFIENWDCWWRGCIKKNYGNHQYCSHCGVDKAANQNRGEII-NVLKDGRKEEMWICTKCGFFNGYLDSDKCE--ICEEMRYEKDAYEIITDVEMKRAAGE-----------LDDWKCGKCECVNNYHLVSCKACEEIKEKLCNICSERFQAAGEICPDCNARWKCWYNLCGEMNNRNVDYCKCCGLGKGDAGKYGIPITRWLSGECDEIWICRSC 1409
            +N  +W CE C   N F S  C GC N  R+                     + ++SD       +  W CW   C + N  + ++C  C + + A ++  +II   + +G   + WIC KC  +N   +  KCE   C   RY        T+ ++     E            + W+C KC  VN      C         LCN  S+  Q+           W+CW   CG+ N     +C  C L +         +  +  GE  EIWIC  C
Sbjct:   65 DNRDKWLCEMCQCLNPFQSADCQGCLNSCRDKCLWMCSWCDLINHINTSICSACEKSDKNVERFLM--WKCWKPHCEQLNNPDCKFCKKCFLQRDAPKSLSDIIERQMGNGSILKFWICEKCWKYNNE-NFRKCEGKNCGHPRYGNAVKWNATNSQINTGQIESQHSDNKITLNPNQWQCEKCTLVNENRDYKC--------VLCNFPSQSHQSP----------WQCWKVNCGKKNKGEDVFCLQCKLDRNPPDPITKLVKSYAGGEMKEIWICSKC 321          
BLAST of SMED30014075 vs. Planmine SMEST
Match: SMESG000022822.1 (SMESG000022822.1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.395e-13
Identity = 65/258 (25.19%), Postives = 98/258 (37.98%), Query Frame = 3
Query:  669 NKNDENSSQWKCEYCGNANEFLSNRCAGCPNLRRESNDRSDNPAGEGFIENWDCWWRGCIKKNYGNHQYCSHCGVDKAANQNRGEIINVLKDGRKEEMWICTKCGFFNGYLDSDKCEI--CEEMRYEKDAYEIITDVEMKRAAGE------------LDDWKCGKCECVNNYHLVSCKACEEIKEKLCNICSERFQAAGEICPDCNARWKCWYNLCGEMNNRNVDYCKCCGLGKGDAGKYGIPITRWLSGECDEIWIC 1400
            NK   N +QW+CE C   NE    +C  C            N   +     W CW   C KKN G   +C  C +D+       +++        +E+WIC KCG  N   ++DKC+   C + +    + EI    E+     E            L+ W+C KC  +N  ++  C AC   ++  C                    W+CW   C  +N     +C+ C L +         +  +  GE  EIWIC
Sbjct:  402 NKITLNPNQWQCEKCTLVNENRDYKCVVC------------NFPSQSHRSPWQCWKVNCGKKNKGEDVFCLQCKLDRNPPDPITKLVKSYAGKEIKEIWICEKCGNENRK-ENDKCDKKNCYQSKLNARSKEITNHKEIITNQKEELQQNGNEIILNLNQWRCEKCTLINKNNIFQCSACNWERKLDC--------------------WQCWNGDCNAVNKGVNMFCQKCKLDRNPPDPKTKLVKSYAGGEEKEIWIC 626          

HSP 2 Score: 63.929 bits (154), Expect = 2.746e-10
Identity = 69/277 (24.91%), Postives = 101/277 (36.46%), Query Frame = 3
Query:  681 ENSSQWKCEYCGNANEFLSNRCAGCPNLRRE--------------------SNDRSDNPAGEGFIENWDCWWRGCIKKNYGNHQYCSHCGVDKAANQNRGEII-NVLKDGRKEEMWICTKCGFFNGYLDSDKCE--ICEEMRYEKDAYEIITDVEMKRAAGE-----------LDDWKCGKCECVNNYHLVSCKACEEIKEKLCNICSERFQAAGEICPDCNARWKCWYNLCGEMNNRNVDYCKCCGLGKGDAGKYGIPITRWLSGECDEIWICRSC 1409
            +N  +W CE C   N F S  C GC N  R+                    S     + + E F+  W CW   C   N  + ++C  C + + A ++  +II   + +GR  + WIC KC  +N   +  KCE   C  +RYE       T+ ++     E            + W+C KC  VN      C  C              F +     P     W+CW   CG+ N     +C  C L +         +  +   E  EIWIC  C
Sbjct:  237 DNRDKWLCEMCQCLNPFQSADCQGCLNSCRDKCIWMCSWCDLINHINTSICSACEKRDKSVERFLM-WKCWKPHCEHLNNPDCKFCKKCFLQRDAPKSLSDIIERQMGNGRILKFWICEKCWKYNNE-NFRKCEGKNCGHLRYENAVKWNATNSQINTGQIESQHSDNKITLNPNQWQCEKCTLVNENRDYKCVVC-------------NFPSQSHRSP-----WQCWKVNCGKKNKGEDVFCLQCKLDRNPPDPITKLVKSYAGKEIKEIWICEKC 493          
The following BLAST results are available for this feature:
BLAST of SMED30014075 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014075 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014075 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014075 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014075 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014075 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014075 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014075 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014075 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014075 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014075 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014075 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014075 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014075 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000022780.11.755e-13469.58SMESG000022780.1[more]
SMESG000022814.12.788e-14574.83SMESG000022814.1[more]
SMESG000022815.19.734e-1526.44SMESG000022815.1[more]
SMESG000022822.11.395e-1325.19SMESG000022822.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014075 ID=SMED30014075|Name=SMED30014075|organism=Schmidtea mediterranea sexual|type=transcript|length=2000bp
GTTTATATTACTTTCAATGAAAGTTTTAACATCTCCAAGCTCAGAATTAA
GGAAATTTTATATAACAATATATTTATTATTTGTTATTTATTTTAAGTTT
TTTCAAGATAATGTTATTTGAAAATTTACTTAATTCTGAGCTTGGAGATG
TTAAAACTTTCATTGAAAGTAATATAAACGGATTGAAGGACGTGAATGAT
ATTATCAATAATGATACTTTAAAAAATTCTTCAAAAATTTTCCCGCTTAA
GAATGATGAAATAAATCAAATGATCAATAATTGGCAAATAATATCTCAAT
CGACTTTAAATCTTTTTAATGAACCTGAACCTAAAAAAATATTTGGCATT
GGTGATTCGAGCGCGATACGTCGACCAACCGAAAGGAATGTTGTCGAAAT
TCTTTATCAATACGTTTTGTGGCATTCTGTTGGGAAATATATTTCCTCTG
TGAGAGATTTTCAAATTGATTTCGCTTGCAAATTGGGAATTACAAGTTTC
AAATGCGAAAAGTGTGCAACTGAGAATCAGATTGATGAATTAGAATGTTC
CATGTGTGGTGAATCGGTTATGAGCTATCTCAAGGCAAATATTCGAGCAT
TGGGGGAATTGAAAGAAAAAATCAATAAAAATGAAAATAATGAACAAATG
AATAATATTTCAATGAAAAATAAAAATGATGAAAACAGTTCTCAGTGGAA
ATGTGAATATTGTGGTAATGCAAATGAATTTTTATCGAATCGATGCGCTG
GTTGCCCTAATTTGCGTCGGGAATCGAATGATCGATCCGACAATCCCGCT
GGTGAAGGATTTATTGAGAATTGGGATTGCTGGTGGCGGGGTTGTATAAA
AAAGAATTACGGTAATCATCAATATTGCTCGCATTGCGGTGTTGATAAGG
CAGCCAATCAGAATCGAGGAGAAATTATAAATGTGCTCAAGGATGGAAGG
AAGGAGGAAATGTGGATTTGTACTAAATGCGGGTTTTTCAATGGATATTT
GGACTCAGATAAATGCGAGATTTGTGAGGAAATGAGATATGAGAAAGATG
CCTACGAGATAATCACAGACGTAGAAATGAAGCGTGCTGCTGGAGAATTG
GATGATTGGAAATGCGGCAAATGCGAATGCGTGAACAATTATCATTTGGT
GAGCTGCAAAGCTTGTGAGGAAATCAAGGAGAAATTATGCAATATTTGCT
CCGAACGGTTTCAGGCAGCAGGTGAAATTTGTCCCGATTGCAATGCGAGA
TGGAAATGTTGGTATAATTTATGTGGTGAAATGAATAATCGCAATGTGGA
TTACTGTAAATGTTGCGGCCTCGGTAAAGGTGACGCTGGGAAATATGGGA
TTCCCATTACTCGCTGGCTCAGTGGGGAATGTGATGAAATATGGATTTGT
AGGAGTTGCCGGCTCATCAATAAGGGCTGTAGTTCTTTTTGCTCGGCTAA
CGGATATAACGGATATTGCACTGGGAGAAGGGATCGGTTGTGCTATAATT
GTAAATGCTGGGTTGAACATTCCCAATACAAATGTCCGAACTGTCATAGA
TAGTTATCATAATTATTCATCATTTACTGTGATATCTAGCTCTCATATCT
GATTAATCAATAATTATGCAAATCCACACTCACTCACACACATTTAATGC
GCCTGTAACCACGGTGATAATCCCCTATGCCTCATGGGGAATTATTGATT
ACAATGTTTATTGATCATTTCCGAATCGATTATCCAATCGGTAATTTTCC
ATTTCACATTTTCCGAGCTTTATTTGAATAAATTAATTTCCCATTCAATA
TTTGCAATCCGTGAGATTTCATTGGATTATTTTGTGATTGGATTGTTTAA
ATTGTGAATAGGAGAATTCCCATGCAAATGCTGATATGCAGTGTAGAGAT
AGTCGGCAGCGGTGCCGTCACCGTTTTATTGACCGGGGAATAATCTGTGG
AATTCACAATATCCAATAAGTTGATTGGACACAATTCGTGAGATCGGAAG
back to top

protein sequence of SMED30014075-orf-1

>SMED30014075-orf-1 ID=SMED30014075-orf-1|Name=SMED30014075-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=481bp
MLFENLLNSELGDVKTFIESNINGLKDVNDIINNDTLKNSSKIFPLKNDE
INQMINNWQIISQSTLNLFNEPEPKKIFGIGDSSAIRRPTERNVVEILYQ
YVLWHSVGKYISSVRDFQIDFACKLGITSFKCEKCATENQIDELECSMCG
ESVMSYLKANIRALGELKEKINKNENNEQMNNISMKNKNDENSSQWKCEY
CGNANEFLSNRCAGCPNLRRESNDRSDNPAGEGFIENWDCWWRGCIKKNY
GNHQYCSHCGVDKAANQNRGEIINVLKDGRKEEMWICTKCGFFNGYLDSD
KCEICEEMRYEKDAYEIITDVEMKRAAGELDDWKCGKCECVNNYHLVSCK
ACEEIKEKLCNICSERFQAAGEICPDCNARWKCWYNLCGEMNNRNVDYCK
CCGLGKGDAGKYGIPITRWLSGECDEIWICRSCRLINKGCSSFCSANGYN
GYCTGRRDRLCYNCKCWVEHSQYKCPNCHR*
back to top

protein sequence of SMED30014075-orf-2

>SMED30014075-orf-2 ID=SMED30014075-orf-2|Name=SMED30014075-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=103bp
MWITVNVAASVKVTLGNMGFPLLAGSVGNVMKYGFVGVAGSSIRAVVLFA
RLTDITDIALGEGIGCAIIVNAGLNIPNTNVRTVIDSYHNYSSFTVISSS
HI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR001876Znf_RanBP2
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 157..177
IPR001876Zinc finger, RanBP2-typeSMARTSM00547zf_4coord: 194..218
e-value: 5.1
score: 6.3
coord: 331..355
e-value: 1.3
score: 11.1
coord: 283..308
e-value: 0.52
score: 14.1
coord: 128..152
e-value: 5.5
score: 6.0
IPR001876Zinc finger, RanBP2-typePROSITEPS01358ZF_RANBP2_1coord: 238..259
IPR001876Zinc finger, RanBP2-typePROSITEPS01358ZF_RANBP2_1coord: 333..352
IPR001876Zinc finger, RanBP2-typePROSITEPS01358ZF_RANBP2_1coord: 381..402
IPR001876Zinc finger, RanBP2-typePROSITEPS01358ZF_RANBP2_1coord: 196..215
IPR001876Zinc finger, RanBP2-typePROSITEPS50199ZF_RANBP2_2coord: 192..221
score: 8.445