Mitochondrial inner membrane protein OXA1-like

Overview
NameMitochondrial inner membrane protein OXA1-like
Smed IDSMED30014066
Length (bp)1035
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mitochondrial inner membrane protein OXA1-like (SMED30014066) t-SNE clustered cells

Violin plots show distribution of expression levels for Mitochondrial inner membrane protein OXA1-like (SMED30014066) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mitochondrial inner membrane protein OXA1-like (SMED30014066) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mitochondrial inner membrane protein OXA1-like (SMED30014066) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014066

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30014066SMESG000037478.1 dd_Smed_v4_4254_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30014066SMESG000037478.1 dd_Smed_v4_4254_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30014066SMESG000037478.1 dd_Smed_v4_4254_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Ensembl Human
Match: OXA1L (OXA1L mitochondrial inner membrane protein [Source:HGNC Symbol;Acc:HGNC:8526])

HSP 1 Score: 69.707 bits (169), Expect = 1.229e-12
Identity = 59/250 (23.60%), Postives = 102/250 (40.80%), Query Frame = 1
Query:  217 TNENIVNLQKSAFEFLNLDQNVSTIIAQSIFESVHITTGLPWWATITCTAIVAKTVTIPSLANQLRITYVSENRLLNV--YSKEQRKEVLP--YLEWLPFSN----------------YILPFLQVVIFASVYPALLVLCN-KMTTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTNDVYKTEG------RNNFHLTPTLLSFGFLCFSPASISLYWCVNNTYSLYMAYLVKHLKVQKTAKVLDK 885
            T + +    + +F  L L       + Q++ E +H+  GLPWW  I    + A+ +  P +    R      N L  +  +S   R+  L   ++E+   S+                 ILP  Q  IF S + AL  + N  + + +TGG+ WF DL++ D  YILP    A +   L        +       RN   + P L++       P ++ +YW  +N +SL     ++   V+   K+  +
Sbjct:   99 TADVVQTAAEQSFAELGLGSYTPVGLIQNLLEFMHVDLGLPWWGAIAACTVFARCLIFPLIVTGQREAARIHNHLPEIQKFSSRIREAKLAGDHIEYYKASSEMALYQKKHGIKLYKPLILPVTQAPIFISFFIALREMANLPVPSLQTGGLWWFQDLTVSDPIYILPLAVTATMWAVLELGAETGVQSSDLQWMRNVIRMMP-LITLPITMHFPTAVFMYWLSSNLFSLVQVSCLRIPAVRTVLKIPQR 347          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Ensembl Human
Match: OXA1L (OXA1L mitochondrial inner membrane protein [Source:HGNC Symbol;Acc:HGNC:8526])

HSP 1 Score: 69.707 bits (169), Expect = 1.657e-12
Identity = 59/250 (23.60%), Postives = 102/250 (40.80%), Query Frame = 1
Query:  217 TNENIVNLQKSAFEFLNLDQNVSTIIAQSIFESVHITTGLPWWATITCTAIVAKTVTIPSLANQLRITYVSENRLLNV--YSKEQRKEVLP--YLEWLPFSN----------------YILPFLQVVIFASVYPALLVLCN-KMTTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTNDVYKTEG------RNNFHLTPTLLSFGFLCFSPASISLYWCVNNTYSLYMAYLVKHLKVQKTAKVLDK 885
            T + +    + +F  L L       + Q++ E +H+  GLPWW  I    + A+ +  P +    R      N L  +  +S   R+  L   ++E+   S+                 ILP  Q  IF S + AL  + N  + + +TGG+ WF DL++ D  YILP    A +   L        +       RN   + P L++       P ++ +YW  +N +SL     ++   V+   K+  +
Sbjct:   83 TADVVQTAAEQSFAELGLGSYTPVGLIQNLLEFMHVDLGLPWWGAIAACTVFARCLIFPLIVTGQREAARIHNHLPEIQKFSSRIREAKLAGDHIEYYKASSEMALYQKKHGIKLYKPLILPVTQAPIFISFFIALREMANLPVPSLQTGGLWWFQDLTVSDPIYILPLAVTATMWAVLELGAETGVQSSDLQWMRNVIRMMP-LITLPITMHFPTAVFMYWLSSNLFSLVQVSCLRIPAVRTVLKIPQR 331          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Ensembl Human
Match: OXA1L (OXA1L mitochondrial inner membrane protein [Source:HGNC Symbol;Acc:HGNC:8526])

HSP 1 Score: 69.3218 bits (168), Expect = 1.812e-12
Identity = 59/250 (23.60%), Postives = 102/250 (40.80%), Query Frame = 1
Query:  217 TNENIVNLQKSAFEFLNLDQNVSTIIAQSIFESVHITTGLPWWATITCTAIVAKTVTIPSLANQLRITYVSENRLLNV--YSKEQRKEVLP--YLEWLPFSN----------------YILPFLQVVIFASVYPALLVLCN-KMTTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTNDVYKTEG------RNNFHLTPTLLSFGFLCFSPASISLYWCVNNTYSLYMAYLVKHLKVQKTAKVLDK 885
            T + +    + +F  L L       + Q++ E +H+  GLPWW  I    + A+ +  P +    R      N L  +  +S   R+  L   ++E+   S+                 ILP  Q  IF S + AL  + N  + + +TGG+ WF DL++ D  YILP    A +   L        +       RN   + P L++       P ++ +YW  +N +SL     ++   V+   K+  +
Sbjct:   99 TADVVQTAAEQSFAELGLGSYTPVGLIQNLLEFMHVDLGLPWWGAIAACTVFARCLIFPLIVTGQREAARIHNHLPEIQKFSSRIREAKLAGDHIEYYKASSEMALYQKKHGIKLYKPLILPVTQAPIFISFFIALREMANLPVPSLQTGGLWWFQDLTVSDPIYILPLAVTATMWAVLELGAETGVQSSDLQWMRNVIRMMP-LITLPITMHFPTAVFMYWLSSNLFSLVQVSCLRIPAVRTVLKIPQR 347          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Ensembl Human
Match: OXA1L (OXA1L mitochondrial inner membrane protein [Source:HGNC Symbol;Acc:HGNC:8526])

HSP 1 Score: 69.707 bits (169), Expect = 1.921e-12
Identity = 59/250 (23.60%), Postives = 102/250 (40.80%), Query Frame = 1
Query:  217 TNENIVNLQKSAFEFLNLDQNVSTIIAQSIFESVHITTGLPWWATITCTAIVAKTVTIPSLANQLRITYVSENRLLNV--YSKEQRKEVLP--YLEWLPFSN----------------YILPFLQVVIFASVYPALLVLCN-KMTTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTNDVYKTEG------RNNFHLTPTLLSFGFLCFSPASISLYWCVNNTYSLYMAYLVKHLKVQKTAKVLDK 885
            T + +    + +F  L L       + Q++ E +H+  GLPWW  I    + A+ +  P +    R      N L  +  +S   R+  L   ++E+   S+                 ILP  Q  IF S + AL  + N  + + +TGG+ WF DL++ D  YILP    A +   L        +       RN   + P L++       P ++ +YW  +N +SL     ++   V+   K+  +
Sbjct:  159 TADVVQTAAEQSFAELGLGSYTPVGLIQNLLEFMHVDLGLPWWGAIAACTVFARCLIFPLIVTGQREAARIHNHLPEIQKFSSRIREAKLAGDHIEYYKASSEMALYQKKHGIKLYKPLILPVTQAPIFISFFIALREMANLPVPSLQTGGLWWFQDLTVSDPIYILPLAVTATMWAVLELGAETGVQSSDLQWMRNVIRMMP-LITLPITMHFPTAVFMYWLSSNLFSLVQVSCLRIPAVRTVLKIPQR 407          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Ensembl Celegans
Match: oxa-1 (OXA mitochondrial inner membrane insertase homolog [Source:UniProtKB/TrEMBL;Acc:O02207])

HSP 1 Score: 55.0694 bits (131), Expect = 3.097e-8
Identity = 51/214 (23.83%), Postives = 87/214 (40.65%), Query Frame = 1
Query:  307 FESVHITTGLPWWATITCTAIVAKT--VTIPSLANQLRITYVSENRLLNVYSK---EQRKE---------VLPYLEWLPFSNYILP--FLQVVIFASVYPALLVLCNKMTT-----FKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTNDVYKTEGRNNFHLTPTLLSFGF--LCFSPAS-----ISLYWCVNNTYSLYMAYLVKHLKVQK 864
             ES+H+   +PWW TI    +  +   + +P ++ +L        + +N +     E RKE         +L   ++L   +  L   F+ +    +V+        KM         TGG LWFTDL+  D  Y LP I+AA + L  +      T       +    +++G   + F  +S     + +YW  +N  SL  A   K   ++K
Sbjct:   95 LESIHVHLDIPWWVTIVAATVTLRALLIGVPVMSQKLVAKQSMYRKEMNEFRDRIDEARKENNQLLQQQILLEQRDFLRSKDIRLGRQFMVMAANGAVFATQFFAIKKMVVVNYPGLSTGGTLWFTDLTATDPYYALPFISAATMALVTKVGIEMGTSADQMPPIMRAFMTYGLPVVIFGVSSQFATGLCVYWTASNAVSLIYAAAFKVDAIRK 308          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Ensembl Fly
Match: OXA1L (gene:FBgn0027615 transcript:FBtr0076271)

HSP 1 Score: 71.633 bits (174), Expect = 1.974e-13
Identity = 58/238 (24.37%), Postives = 104/238 (43.70%), Query Frame = 1
Query:  244 KSAFEFLNLDQNVSTIIAQSIFESVHITTGLPWWATITCTAIVAKTVTIP----SLANQLRITY-VSENRLLNVYSKEQRK-----EVLPYLEWL----------PFSNYILPFLQVVIFASVYPALLVLCN-KMTTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTN-DVYKTEGRNNFHLTPTLLSFGFLCFS-----PASISLYWCVNNTYSLYMAYLVKHLKVQKTAKV 876
            + +F  + L       + Q+  E +H T  +PWW TI    +  +T+  P    +  N  ++   + + ++L +   E R+     E   Y + +          P  N ++P  Q  +F S +  L  + N  + + + GG+ WFTDL+M D  Y+LP I +A L LT+    D  +    N   +   L +   + F      PA+I  YW  +N  SL    +++   V++  K+
Sbjct:  120 EPSFASIGLGGWSPVGMVQNCLEFLHCTWDIPWWGTIAIGTLAVRTIIFPLVILAQRNSAKMNNNMPQMQMLQLKMTEARQSGNAIESARYAQEMMLFMREKGVNPLKNMVVPLAQAPLFISFFMGLRQMANAPVESMRDGGLFWFTDLTMADPFYLLPLITSATLYLTIEIGTDSARLSAANMNTMKYVLRALPIVIFPFTMNFPAAILTYWACSNFISLGQVAVLRIPSVREYFKI 357          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Ensembl Fly
Match: OXA1L (gene:FBgn0027615 transcript:FBtr0076272)

HSP 1 Score: 71.633 bits (174), Expect = 1.974e-13
Identity = 58/238 (24.37%), Postives = 104/238 (43.70%), Query Frame = 1
Query:  244 KSAFEFLNLDQNVSTIIAQSIFESVHITTGLPWWATITCTAIVAKTVTIP----SLANQLRITY-VSENRLLNVYSKEQRK-----EVLPYLEWL----------PFSNYILPFLQVVIFASVYPALLVLCN-KMTTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTN-DVYKTEGRNNFHLTPTLLSFGFLCFS-----PASISLYWCVNNTYSLYMAYLVKHLKVQKTAKV 876
            + +F  + L       + Q+  E +H T  +PWW TI    +  +T+  P    +  N  ++   + + ++L +   E R+     E   Y + +          P  N ++P  Q  +F S +  L  + N  + + + GG+ WFTDL+M D  Y+LP I +A L LT+    D  +    N   +   L +   + F      PA+I  YW  +N  SL    +++   V++  K+
Sbjct:  120 EPSFASIGLGGWSPVGMVQNCLEFLHCTWDIPWWGTIAIGTLAVRTIIFPLVILAQRNSAKMNNNMPQMQMLQLKMTEARQSGNAIESARYAQEMMLFMREKGVNPLKNMVVPLAQAPLFISFFMGLRQMANAPVESMRDGGLFWFTDLTMADPFYLLPLITSATLYLTIEIGTDSARLSAANMNTMKYVLRALPIVIFPFTMNFPAAILTYWACSNFISLGQVAVLRIPSVREYFKI 357          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Ensembl Zebrafish
Match: oxa1l (OXA1L mitochondrial inner membrane protein [Source:ZFIN;Acc:ZDB-GENE-071004-49])

HSP 1 Score: 78.1814 bits (191), Expect = 1.870e-15
Identity = 57/233 (24.46%), Postives = 101/233 (43.35%), Query Frame = 1
Query:  298 QSIFESVHITTGLPWWATITCTAIVAKTVTIP--------------------SLANQLRITYVSENRLLNVYSK--------EQRKEVLPYLEWLPFSNYILPFLQVVIFASVYPALLVLCN-KMTTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTNDVYKTEGRNNFHLTPTLLSFGFLCFS--------PASISLYWCVNNTYSLYMAYLVKHLKVQKTAKVLDK 885
            Q++ E +H++ GLPWW  I    IVA+    P                     L N++     S N+    +SK        +++K+V       PF  +++P +Q  IF S + AL  +    + + +TGG+ WFTDL+  D  YILP      +   L   ++    G +N +L      F  + F         P ++  YW  +N +SL    +++H  V++  ++ ++
Sbjct:  161 QNLLEFMHVSIGLPWWGAIVAGTIVARCAVFPVIVKGQREAAKLNNVMPEMTKLTNRMNEAKQSGNKF--EFSKAYTDLMMFQKKKDV------NPFRGFLVPLVQAPIFLSFFIALRKMSELPVPSLQTGGLWWFTDLTAADPFYILPIAVTGTMVAIL---ELGAESGVDNPNLRAMKTVFRIMPFVILPLTINFPTAVFTYWMTSNLFSLAQVAVLRHPAVRQKLRIPER 382          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Ensembl Zebrafish
Match: oxa1l (OXA1L mitochondrial inner membrane protein [Source:ZFIN;Acc:ZDB-GENE-071004-49])

HSP 1 Score: 78.1814 bits (191), Expect = 1.870e-15
Identity = 57/233 (24.46%), Postives = 101/233 (43.35%), Query Frame = 1
Query:  298 QSIFESVHITTGLPWWATITCTAIVAKTVTIP--------------------SLANQLRITYVSENRLLNVYSK--------EQRKEVLPYLEWLPFSNYILPFLQVVIFASVYPALLVLCN-KMTTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTNDVYKTEGRNNFHLTPTLLSFGFLCFS--------PASISLYWCVNNTYSLYMAYLVKHLKVQKTAKVLDK 885
            Q++ E +H++ GLPWW  I    IVA+    P                     L N++     S N+    +SK        +++K+V       PF  +++P +Q  IF S + AL  +    + + +TGG+ WFTDL+  D  YILP      +   L   ++    G +N +L      F  + F         P ++  YW  +N +SL    +++H  V++  ++ ++
Sbjct:  161 QNLLEFMHVSIGLPWWGAIVAGTIVARCAVFPVIVKGQREAAKLNNVMPEMTKLTNRMNEAKQSGNKF--EFSKAYTDLMMFQKKKDV------NPFRGFLVPLVQAPIFLSFFIALRKMSELPVPSLQTGGLWWFTDLTAADPFYILPIAVTGTMVAIL---ELGAESGVDNPNLRAMKTVFRIMPFVILPLTINFPTAVFTYWMTSNLFSLAQVAVLRHPAVRQKLRIPER 382          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Ensembl Xenopus
Match: mpp2 (membrane protein, palmitoylated 2 [Source:Xenbase;Acc:XB-GENE-961053])

HSP 1 Score: 63.5438 bits (153), Expect = 1.422e-10
Identity = 63/276 (22.83%), Postives = 115/276 (41.67%), Query Frame = 1
Query:  187 TLENV-----IQKLPT-NENIV--NLQKSAFEFLNLDQNVSTIIAQSIFESVHITTGLPWWATITCTAIVAKTVTIP--------------------SLANQLRITYVSENRL--------LNVYSKEQRKEVLPYLEWLPFSNYILPFLQVVIFASVYPALLVLCN-KMTTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTNDVYKTEGRN------NFHLTPTLLSFGFLCFSPASISLYWCVNNTYSLYMAYLVKHLKVQKTAKVLDK 885
            TL+NV     ++  PT +E I+  ++Q+S  + L L       + Q+  E +++  GLPWW  I    ++A+ +  P                    S+ N++     S N+         L +Y K+            P   +++P +Q  IF S + AL  +    + + ++GG+ WFTDL+  D  YILP      +   L        +  N       F + P ++    + F P ++  YW  +N +SL     ++   V+K  K+ ++
Sbjct:   78 TLDNVLPPPLVEAAPTVSETILPESVQQSLAD-LGLGGQTPVGLIQNFLEFLNVDVGLPWWGAIVTGTVLARILVFPLIVKGQREAAKLNNHMPQISSMTNRMNEAKQSGNKFEFSKAYSDLTLYQKKHDVN--------PLRGFLVPLVQAPIFISFFVALRQMSYLPVPSMQSGGLWWFTDLTAADPFYILPLTVTCTMWGVLELGAESGVDNPNLKIMKTVFRVMPLIILPLTINF-PTAVFTYWVTSNVFSLAQVSFLRIPAVRKKLKIPER 343          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Ensembl Xenopus
Match: mpp2 (membrane protein, palmitoylated 2 [Source:Xenbase;Acc:XB-GENE-961053])

HSP 1 Score: 63.1586 bits (152), Expect = 1.897e-10
Identity = 63/276 (22.83%), Postives = 115/276 (41.67%), Query Frame = 1
Query:  187 TLENV-----IQKLPT-NENIV--NLQKSAFEFLNLDQNVSTIIAQSIFESVHITTGLPWWATITCTAIVAKTVTIP--------------------SLANQLRITYVSENRL--------LNVYSKEQRKEVLPYLEWLPFSNYILPFLQVVIFASVYPALLVLCN-KMTTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTNDVYKTEGRN------NFHLTPTLLSFGFLCFSPASISLYWCVNNTYSLYMAYLVKHLKVQKTAKVLDK 885
            TL+NV     ++  PT +E I+  ++Q+S  + L L       + Q+  E +++  GLPWW  I    ++A+ +  P                    S+ N++     S N+         L +Y K+            P   +++P +Q  IF S + AL  +    + + ++GG+ WFTDL+  D  YILP      +   L        +  N       F + P ++    + F P ++  YW  +N +SL     ++   V+K  K+ ++
Sbjct:   78 TLDNVLPPPLVEAAPTVSETILPESVQQSLAD-LGLGGQTPVGLIQNFLEFLNVDVGLPWWGAIVTGTVLARILVFPLIVKGQREAAKLNNHMPQISSMTNRMNEAKQSGNKFEFSKAYSDLTLYQKKHDVN--------PLRGFLVPLVQAPIFISFFVALRQMSYLPVPSMQSGGLWWFTDLTAADPFYILPLTVTCTMWGVLELGAESGVDNPNLKIMKTVFRVMPLIILPLTINF-PTAVFTYWVTSNVFSLAQVSFLRIPAVRKKLKIPER 343          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Ensembl Xenopus
Match: cox18 (cytochrome c oxidase assembly factor COX18 [Source:NCBI gene;Acc:549087])

HSP 1 Score: 58.5362 bits (140), Expect = 5.637e-9
Identity = 62/259 (23.94%), Postives = 108/259 (41.70%), Query Frame = 1
Query:  292 IAQSIFESVHITTGLPWWATITCTAIVAKT-VTIPSLANQLRITYVSEN--RLLNVYSKEQRKEVLPYLE---WL--------------------------PFSNYILPFLQVVIFASVYPALL-VLCNKMTT---------FKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTNDVYKTEGRN------NFHLTPTLLSFGFLCFSPASISLYWCVNNTYSLYMAYLVKHLKVQKTAKV----LDKNADYKRIME 912
            +A+S+  S+H T+G+PWWA I C  +  +T VT+P    Q+ I    EN    ++  +K+ R EV  Y +   W                           PF   +L ++Q+ ++  V  AL  +  N+  +            GG+LWF DL+M D+ +ILP        L +    + K E         NF    ++         P+S++LYW  ++   L    L++   +++  ++     D +  YK I+ 
Sbjct:  113 LAESLLISLHETSGMPWWANIVCATVALRTTVTLPLSVYQMYILAKVENLQPEIDALAKQLRYEVSVYGKQHGWTDKVARFQFRKNLRRIISGLYVRDNCHPFKASLLIWIQIPMWIFVSIALRNISLNRADSATGDAVQKQLTEGGLLWFPDLTMPDSTWILPVTLGLLNLLIVEIFALRKIELSRFQKIITNFIRAVSIAMIPIASTVPSSMALYWVTSSCVGLAHNLLLRSPALRRVFRIPRSKSDSDTPYKDILS 371          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Ensembl Mouse
Match: Oxa1l (oxidase assembly 1-like [Source:MGI Symbol;Acc:MGI:1916339])

HSP 1 Score: 68.9366 bits (167), Expect = 1.987e-12
Identity = 55/223 (24.66%), Postives = 98/223 (43.95%), Query Frame = 1
Query:  244 KSAFEFLNLDQNVSTIIAQSIFESVHITTGLPWWATITCTAIVAKTVTIPSLANQLRITYVSENRL--LNVYSKEQRKEVLP------YLEWLPFSNY------------ILPFLQVVIFASVYPALLVLCN-KMTTFKTGGILWFTDLSMIDNCYILPTIAAAAL-CL-------TLRTNDVYKTEGRNNFHLTPTLLSFGFLCFSPASISLYWCVNNTYSL 825
            + +F  L L       + Q++ E +H+  GLPWW  I    ++A+ +  P +    R      N +  +  +S   R+  L       Y   +  + Y            ILP  Q  +F S + AL  + N  + + +TGG+ WF DL++ D  Y+LP +  A + C+        +++ND+     RN   + P L+        P+++ +YW  +N +SL
Sbjct:  103 EPSFTELGLGSYTPVGLIQNLLEYIHVDLGLPWWGAIATCTVLARCLVFPLIVKGQREAAKIHNHMPEMQKFSARIREAKLAGDQAEFYKATIEMTRYQKKHDIKLLRPLILPLTQAPVFISFFIALREMANLPVPSLQTGGLWWFQDLTVSDPIYVLPLVVTATMWCVLELGAETGVQSNDLQFM--RNIIRVMP-LVVLPVTIHFPSAVFMYWLSSNVFSL 322          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. UniProt/SwissProt
Match: sp|Q42191|OXA1_ARATH (Mitochondrial inner membrane protein OXA1 OS=Arabidopsis thaliana OX=3702 GN=OXA1 PE=2 SV=2)

HSP 1 Score: 85.1149 bits (209), Expect = 5.063e-17
Identity = 62/219 (28.31%), Postives = 99/219 (45.21%), Query Frame = 1
Query:  298 QSIFESVHITTGLPWWATITCTAIVAKTVTIPSLANQLRIT---YVSENRLLNVYSKEQRK--------EVLPYLEWL-------PFSNYILPFLQVVIFASVYPALLVLCNKMTTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTNDVYKTEGRNNFHLTPT------LLSFGFLCFSPASISLYWCVNNTYSLYMAYLVKHLKVQKTAKVLD 882
            Q   + VH  TG  WWA+I    I+ ++ T+P L  Q++ T    +   RL ++  + Q K        E    ++ L       PF+     F+Q  +F   + A+  +  K+ +F+TGG LWFTDL+  D+ YILP I      +T+  N     EG        T      LL+       P +I  YW  +N +SL    ++K  +V+K  ++ D
Sbjct:  138 QQCIDMVHTFTGFEWWASIVVATILIRSSTVPLLIKQMKDTTKLALMRPRLESIREEMQNKGMDSVTMAEGQKKMKNLFKEYGVTPFTPMKGMFIQGPLFICFFLAIRNMAEKVPSFQTGGALWFTDLTTPDSLYILPVITGLTFLITVECNAQEGMEGNPMAGTVKTVCRVFALLTVPMTMSFPQAIFCYWITSNLFSLMYGLVIKRPQVKKMLRIPD 356          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. UniProt/SwissProt
Match: sp|Q9SKD3|OXA1L_ARATH (Mitochondrial inner membrane protein OXA1-like OS=Arabidopsis thaliana OX=3702 GN=OXA1L PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 6.464e-15
Identity = 64/213 (30.05%), Postives = 98/213 (46.01%), Query Frame = 1
Query:  298 QSIFESVHITTGLPWWATITCTAIVAKTVTIPSLANQLRITY-------VSENRLLNVYSKEQRKEVLP----YLEWLPFSNYILPF-------LQVVIFASVYPALLVLCNKMTTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTNDVYKTEGR------NNFHLTPTLLSFGFLCFSPASISLYWCVNNTYSLYMAYLVKHLKVQK 864
            Q + ++VH  TGL WWA+I  T ++ + VTIP L NQL+ TY         E     + +K Q  E +      ++ L   + + PF       +Q  IF S + A+  +  K+ +FKTGG LWFTDL+  D  YILP + A    + + +N     EG         F      LS   L     ++  YW  +N ++L     ++   V+K
Sbjct:  141 QHLIDAVHSFTGLNWWASIALTTVLIRGVTIPILLNQLKATYKLNVLRPQLEELRQEMSTKAQDPEAMAEGQRRMQLLFKEHGVTPFTPLKGLIIQGPIFISFFFAIRNMAEKVPSFKTGGTLWFTDLTTTDTTYILPLLTAVTFLIMVESNMQEGLEGNPVAGTMKKFSRIIAFLSIPVLIGIEKALFCYWLTSNLFTLVYGLTLRRPDVRK 353          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. UniProt/SwissProt
Match: sp|Q15070|OXA1L_HUMAN (Mitochondrial inner membrane protein OXA1L OS=Homo sapiens OX=9606 GN=OXA1L PE=1 SV=3)

HSP 1 Score: 69.707 bits (169), Expect = 7.384e-12
Identity = 59/250 (23.60%), Postives = 102/250 (40.80%), Query Frame = 1
Query:  217 TNENIVNLQKSAFEFLNLDQNVSTIIAQSIFESVHITTGLPWWATITCTAIVAKTVTIPSLANQLRITYVSENRLLNV--YSKEQRKEVLP--YLEWLPFSN----------------YILPFLQVVIFASVYPALLVLCN-KMTTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTNDVYKTEG------RNNFHLTPTLLSFGFLCFSPASISLYWCVNNTYSLYMAYLVKHLKVQKTAKVLDK 885
            T + +    + +F  L L       + Q++ E +H+  GLPWW  I    + A+ +  P +    R      N L  +  +S   R+  L   ++E+   S+                 ILP  Q  IF S + AL  + N  + + +TGG+ WF DL++ D  YILP    A +   L        +       RN   + P L++       P ++ +YW  +N +SL     ++   V+   K+  +
Sbjct:   99 TADVVQTAAEQSFAELGLGSYTPVGLIQNLLEFMHVDLGLPWWGAIAACTVFARCLIFPLIVTGQREAARIHNHLPEIQKFSSRIREAKLAGDHIEYYKASSEMALYQKKHGIKLYKPLILPVTQAPIFISFFIALREMANLPVPSLQTGGLWWFQDLTVSDPIYILPLAVTATMWAVLELGAETGVQSSDLQWMRNVIRMMP-LITLPITMHFPTAVFMYWLSSNLFSLVQVSCLRIPAVRTVLKIPQR 347          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. UniProt/SwissProt
Match: sp|Q3SYV3|OXA1L_BOVIN (Mitochondrial inner membrane protein OXA1L OS=Bos taurus OX=9913 GN=OXA1L PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.193e-11
Identity = 56/221 (25.34%), Postives = 90/221 (40.72%), Query Frame = 1
Query:  244 KSAFEFLNLDQNVSTIIAQSIFESVHITTGLPWWATITCTAIVAKTVTIPSLANQLRITYVSENRLLNV--YSKEQRKEVLP--YLEWLP----------------FSNYILPFLQVVIFASVYPALLVLCN-KMTTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTNDVYKTEG------RNNFHLTPTLLSFGFLCFSPASISLYWCVNNTYSL 825
            + +F  L L       + Q++ E +H+  GLPWW  I    ++A+ +  P +    R      N L  +  +S   R+  L   + E+                  F   ILP  Q  IF S + AL  + N  + + +TGG+ WF DL++ D  Y+LP +  A +   L        +       RN   L P L         P ++ +YW  +N +SL
Sbjct:  108 EQSFAELGLGSYTPVGLIQNLLEFMHVNLGLPWWGAIAACTVLARCLVFPLIVKGQREAAKIHNHLPEIQKFSARIREAKLTGNHTEFYRASSEMTFYQKKHDIKLFRPLILPLTQAPIFISFFIALREMANLPVPSLQTGGLWWFQDLTLSDPIYVLPLVVTATMWGVLELGAETGMQSSDLQWMRNFIRLMP-LAVLPITIHFPTAVFMYWLSSNMFSL 327          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. UniProt/SwissProt
Match: sp|Q8BGA9|OXA1L_MOUSE (Mitochondrial inner membrane protein OXA1L OS=Mus musculus OX=10090 GN=Oxa1l PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.390e-11
Identity = 55/223 (24.66%), Postives = 98/223 (43.95%), Query Frame = 1
Query:  244 KSAFEFLNLDQNVSTIIAQSIFESVHITTGLPWWATITCTAIVAKTVTIPSLANQLRITYVSENRL--LNVYSKEQRKEVLP------YLEWLPFSNY------------ILPFLQVVIFASVYPALLVLCN-KMTTFKTGGILWFTDLSMIDNCYILPTIAAAAL-CL-------TLRTNDVYKTEGRNNFHLTPTLLSFGFLCFSPASISLYWCVNNTYSL 825
            + +F  L L       + Q++ E +H+  GLPWW  I    ++A+ +  P +    R      N +  +  +S   R+  L       Y   +  + Y            ILP  Q  +F S + AL  + N  + + +TGG+ WF DL++ D  Y+LP +  A + C+        +++ND+     RN   + P L+        P+++ +YW  +N +SL
Sbjct:  103 EPSFTELGLGSYTPVGLIQNLLEYIHVDLGLPWWGAIATCTVLARCLVFPLIVKGQREAAKIHNHMPEMQKFSARIREAKLAGDQAEFYKATIEMTRYQKKHDIKLLRPLILPLTQAPVFISFFIALREMANLPVPSLQTGGLWWFQDLTVSDPIYVLPLVVTATMWCVLELGAETGVQSNDLQFM--RNIIRVMP-LVVLPVTIHFPSAVFMYWLSSNVFSL 322          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. TrEMBL
Match: A0A072UZ26 (60 kDa inner membrane protein OS=Medicago truncatula OX=3880 GN=25493208 PE=3 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.822e-19
Identity = 68/219 (31.05%), Postives = 101/219 (46.12%), Query Frame = 1
Query:  298 QSIFESVHITTGLPWWATITCTAIVAKTVTIPSLANQLRITY---VSENRLLNVYSKEQRKEVLP-------------YLEW--LPFSNYILPFLQVVIFASVYPALLVLCNKMTTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTNDVYKTEGR------NNFHLTPTLLSFGFLCFSPASISLYWCVNNTYSLYMAYLVKHLKVQKTAKVLD 882
            Q + ++VH+ TGL WWA I  T +V +T T+P L NQL+ T    +   RL  +  +   K   P             + E+   PF+     F+Q  +F S + A+  +  KM +FK GG  WFTDL+  D  YI P + A +  + + TN     EG         F     LLS  F    P +I  YW  +N +SL    +++   V+KT  + D
Sbjct:  130 QYVIDAVHLYTGLDWWAAIALTTLVIRTATVPLLVNQLKATSKLTLMRPRLEQIKEEMDGKTSDPAAVAQGQERMSKLFKEYGVTPFTPLKGLFIQGPVFISFFLAITNMAEKMPSFKHGGAFWFTDLTTPDALYIFPVLTALSFLIVVETNMQEGMEGNPMGNTMKKFSRVLALLSVPFTLSFPKAIFCYWITSNLFSLTYGMVLRTPGVKKTLGIPD 348          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. TrEMBL
Match: A0A1S3EAV1 (mitochondrial inner membrane protein OXA1 OS=Cicer arietinum OX=3827 GN=LOC101489652 PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.989e-18
Identity = 69/219 (31.51%), Postives = 101/219 (46.12%), Query Frame = 1
Query:  298 QSIFESVHITTGLPWWATITCTAIVAKTVTIPSLANQLRITY---VSENRLLNVYSKEQRKEVLP-------------YLEW--LPFSNYILPFLQVVIFASVYPALLVLCNKMTTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTNDVYKTEGR------NNFHLTPTLLSFGFLCFSPASISLYWCVNNTYSLYMAYLVKHLKVQKTAKVLD 882
            Q   ++VH  TGL WWA+I  T ++ ++ TIP L NQL+ T    +   RL  +  +   K + P             + E+   PF+     F+Q  +F S + A+  +  KM +FK GG  WFTDL+  D  YI P I A +  + +  N     EG        NF     LLS  F    P +I  YW  +N +SL    ++K   V+KT  + D
Sbjct:  138 QYAIDAVHSFTGLNWWASIVLTTLLIRSATIPLLVNQLKATSKLTLMRPRLEEIKEQLDGKTMDPEAVEEGQKKMKKLFKEYGVTPFTPLKGLFIQGPVFISFFLAITNMAEKMPSFKHGGAFWFTDLTTPDALYIFPVITALSFLIVVECNMQEGMEGNPVAGTMKNFSRVLALLSVPFTMSFPKAIFCYWITSNLFSLSYGMVLKVPGVKKTLGIPD 356          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. TrEMBL
Match: A0A3Q7IF77 (AMP-binding domain-containing protein OS=Solanum lycopersicum OX=4081 PE=3 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 4.267e-18
Identity = 61/197 (30.96%), Postives = 94/197 (47.72%), Query Frame = 1
Query:  298 QSIFESVHITTGLPWWATITCTAIVAKTVTIPSLANQLRITYVSENRLLNVYSKEQRKEVLPYLEW--LPFSNYILPFLQVVIFASVYPALLVLCNKMTTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTNDVYKTEGR------NNFHLTPTLLSFGFLCFSPASISLYWCVNNTYSLYMAYLVKHLKVQK 864
            Q + + VHI TG  WWA+I  T IV + +T+P + NQL+ T           ++ Q++      E    PF+      +Q  +F S + A+  +  K+ +FK GG+LWFTDL++ D+ YI P + A    +T+  N     EG        N       L+  F    P ++  YW  +N +SL    LVK   V+K
Sbjct:  145 QYLIDYVHIFTGFDWWASIIATTIVIRCITLPLMINQLKATTKFAGMAPAAVAEGQQRMQAAMKEHGVTPFTPLKGILIQGPVFVSFFMAISNMVEKVPSFKQGGVLWFTDLTVTDSMYIFPVLTALTFWITVECNAQEGLEGNPSAKTIKNVSRAFAALTIPFTAGFPKAVFCYWMTSNLFSLSYGLLVKRPAVKK 341          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. TrEMBL
Match: A0A1X2GLZ9 (Uncharacterized protein OS=Hesseltinella vesiculosa OX=101127 GN=DM01DRAFT_1334493 PE=3 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 5.461e-18
Identity = 79/314 (25.16%), Postives = 132/314 (42.04%), Query Frame = 1
Query:  121 SANCTFKSNNVIKIPSCSFGIDTLENVIQKLPTNENI-----VNLQKSAFEFLNLDQNVSTIIAQSIFESVHITTGLPWWATITCTAIVAKTVTIPSLANQLRITYVSENRLLNVYSKEQR------------------------KEVLPYLEWLPFSNYILPFLQVVIFASVYPALLVLCN-KMTTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTND-----VYKTEGRNNFHLTPTLLSFGFLCFSPASISLYWCVNNTYSLYMAYLVKHLKVQKT---------AKVLDKNADYKRIMEKIQSES 930
             A+ T  S   IK P    G + +E V Q  PT + +     V  Q   F+ + L         +++ E+VH++ GLPWWATI    ++ +T  +P +    R    +  RL+N+    QR                        +E+    E  P  +  LP +Q+ +  S + AL  +    +     GG+ WFTDL+  D  Y+LP ++AA +   L           +++G  NF    T+L   F  + P+ + +YW  +N YS+     +K+  ++K          AK L K  D K  M+  + + 
Sbjct:   42 QASATVTSLQDIKDP---IGTNVIETVAQT-PTADAVLAAAEVAPQMGDFKAMGLCNFTPVGGLEAMLEAVHVSMGLPWWATIATATVLVRTALLPLIIKLQR----NNARLMNINPDVQRIMGNLKTAQSEGDTLATTKYSGELQELFKKNECHPMKSLGLPLIQMPVMISFFMALRAMAELPVPGMVDGGLAWFTDLTAKDPYYVLPAVSAAGMLAVLEAGTEAGSATPQSKGMKNFMRGVTVLMVPFTAWMPSGVFIYWLTSNVYSIGQILALKNPAIRKGLNIPQLIKPAKELQK--DSKGFMDNFREQQ 345          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. TrEMBL
Match: A0A443PR86 (Mitochondrial inner membrane protein OXA1-like protein OS=Cinnamomum micranthum f. kanehirae OX=337451 GN=CKAN_02252200 PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 8.678e-18
Identity = 61/212 (28.77%), Postives = 97/212 (45.75%), Query Frame = 1
Query:  298 QSIFESVHITTGLPWWATITCTAIVAKTVTIPSLANQLRIT--------YVSENRLLNVYSKEQRKEVLPYLEW---------LPFSNYILPFLQVVIFASVYPALLVLCNKMTTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTNDVYKTEGR------NNFHLTPTLLSFGFLCFSPASISLYWCVNNTYSLYMAYLVKHLKVQK 864
            Q   + +H  TGL WWA+I  T ++ ++ TIP L NQ++ T         + E R   +YS + +  V   +            PF+     F+Q  +F S + A+  +  K+ +FK GG  WFTDL+  D+ YI P + A A   T+  N     EG         F     +L+  F    P +I  YW  +N +S+   Y+++   V+K
Sbjct:  225 QYFIDGIHTLTGLNWWASIALTTLIIRSATIPLLVNQIKATTKLALIKPQMEEIRQQMLYSMDPKASVEGQMRMKALFKEHGVTPFTPLKGLFIQGPVFVSFFWAITNMVEKVPSFKGGGAFWFTDLTTPDSLYIFPVLTALAFLATVEMNVQEGMEGNPMAGTMKKFSRILAVLTVPFTMSFPKAIFCYWVTSNLFSMTYGYVIRRPPVKK 436          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Ensembl Cavefish
Match: oxa1l (OXA1L mitochondrial inner membrane protein [Source:ZFIN;Acc:ZDB-GENE-071004-49])

HSP 1 Score: 72.4034 bits (176), Expect = 1.015e-13
Identity = 59/251 (23.51%), Postives = 109/251 (43.43%), Query Frame = 1
Query:  238 LQKSAFEF----LNLDQNVSTIIAQSIFESVHITTGLPWWATITCTAIVAKTVTIPSLANQLR-----------ITYVSENRLLNVYSKEQRKEV-LPYLEWL---------PFSNYILPFLQVVIFASVYPALLVLCN-KMTTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTNDVYKTEGRNN---------FHLTPTLLSFGFLCFSPASISLYWCVNNTYSLYMAYLVKHLKVQKTAKVLDK 885
            LQ++  E     L L       + Q++ E +H+  GLPWW  I    I+A+    P++    R           +T +S NR+        + E    Y E +         P   +++P +Q  +F S + AL  +    + + +TGG+ WFTDL+  D  +ILP      +   +   ++    G +N         F + P ++    + F P ++ +YW  +N +SL    L++H  V+K  ++ ++
Sbjct:  111 LQEAGAELSLTDLGLGNYTPVGLIQNLLEFMHVNIGLPWWCAIVAGTIIARCAVFPAIVKGQREAVKLNNVLPEMTKIS-NRMNEAKHSGNKFEFSKAYSELMMFYKKHDVNPVRGFLVPLVQAPVFISFFIALRQMAYLPVPSLQTGGLGWFTDLTAADPYFILPFAVTGTMFAIV---ELGAESGLDNPNLRAMKTVFRIMPLVILPMTINF-PTAVFVYWLTSNVFSLGQVALLRHPAVRKKLRIPER 356          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Ensembl Cavefish
Match: oxa1l (OXA1L mitochondrial inner membrane protein [Source:ZFIN;Acc:ZDB-GENE-071004-49])

HSP 1 Score: 71.2478 bits (173), Expect = 2.860e-13
Identity = 59/252 (23.41%), Postives = 109/252 (43.25%), Query Frame = 1
Query:  238 LQKSAFEF----LNLDQNVSTIIAQSIFESVHITTGLPWWATITCTAIVAKTVTIPSLANQLR-----------ITYVSENRLLNVYSKEQRKE-VLPYLEWL---------PFSNYILPFLQVVIFASVYPALLVLCN-KMTTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTNDVYKTEGRNN---------FHLTPTLLSFGFLCFSPASISLYWCVNNTYSLYMAYLVKHLKVQKTAKVLDKN 888
            LQ++  E     L L       + Q++ E +H+  GLPWW  I    I+A+    P++    R           +T +S NR+        + E    Y E +         P   +++P +Q  +F S + AL  +    + + +TGG+ WFTDL+  D  +ILP      +   +   ++    G +N         F + P ++    + F P ++ +YW  +N +SL    L++H  V+K  ++ ++ 
Sbjct:  169 LQEAGAELSLTDLGLGNYTPVGLIQNLLEFMHVNIGLPWWCAIVAGTIIARCAVFPAIVKGQREAVKLNNVLPEMTKIS-NRMNEAKHSGNKFEFSKAYSELMMFYKKHDVNPVRGFLVPLVQAPVFISFFIALRQMAYLPVPSLQTGGLGWFTDLTAADPYFILPFAVTGTMFAIV---ELGAESGLDNPNLRAMKTVFRIMPLVILPMTINF-PTAVFVYWLTSNVFSLGQVALLRHPAVRKKLRIPERK 415          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Ensembl Yeast
Match: OXA1 (Mitochondrial inner membrane insertase; mediates the insertion of both mitochondrial- and nuclear-encoded proteins from the matrix into the inner membrane; also has a role in insertion of carrier proteins into the inner membrane; acts as a voltage-gated ion channel, activated by substrate peptides; interacts with mitochondrial ribosomes; conserved from bacteria to animals [Source:SGD;Acc:S000000956])

HSP 1 Score: 56.225 bits (134), Expect = 2.131e-9
Identity = 54/219 (24.66%), Postives = 94/219 (42.92%), Query Frame = 1
Query:  292 IAQSIFESVHITTGLPWWATITCTAIVAKTVTIP----SLANQLRITYVS------ENRLLNVYSKEQRKEVLPYLEWLPFSNYI------LPFLQVVIFASVYPALLVLCN-KMTTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTN-----DVYKTEGRNNFHLTPTLLSFGFLCFSPASISLYWCVNNTYSLYMAYLVKHLKVQKTAKVLD 882
            I Q + E+VH+ +GLPWW TI  T I+ + +  P    S     R +++        N+L++    +Q + V    + L  S+ I       P LQ+ I    + AL  + N  +  F   G+ WFTDL+  D    L  I AA      R         + +  +  F + P +     +  S A + LY+  N  +S+    ++++  V+   K+ +
Sbjct:  112 IIQHVLEAVHVYSGLPWWGTIAATTILIRCLMFPLYVKSSDTVARNSHIKPELDALNNKLMSTTDLQQGQLVAMQRKKLLSSHGIKNRWLAAPMLQIPIALGFFNALRHMANYPVDGFANQGVAWFTDLTQADPYLGLQVITAAVFISFTRLGGETGAQQFSSPMKRLFTILPIISIPATMNLSSA-VVLYFAFNGAFSVLQTMILRNKWVRSKLKITE 329          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Ensembl Nematostella
Match: EDO47264 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMF7])

HSP 1 Score: 70.8626 bits (172), Expect = 6.492e-14
Identity = 56/224 (25.00%), Postives = 95/224 (42.41%), Query Frame = 1
Query:  262 LNLDQNVSTIIAQSIFESVHITTGLPWWATITCTAIVAKTVTIP----SLAN----------------QLRITYVSENRLLNVYSKEQRKEVLPYLEWLPFSNYILPFLQVVIFASVYPALLVLCN-KMTTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTNDVYKTEGRNNFHLTPTLLSFGFLCFS--------PASISLYWCVNNTYSLYMAYLVK 846
            + L       + Q   E +H T GLPW  +I    I  +T+  P    S AN                QLR    S N +    +  + +++    +  P  + I P +QV +F S +  L  + N  + +FK GG+ WFTDL+  D  ++LP + +  +  ++   ++    G +N  +      F  +C +        PA+I  YW  +N +SL    L+K
Sbjct:   15 MGLGGTTPIGLVQHALEMLHATVGLPWVWSIVAATIAFRTLMFPLIVKSQANAARLNNVKPELEEVQAQLRDLMNSNNAIGKAAASARLQQLYKDNDCHPIKSIIAPLVQVPLFISFFVGLRRMANLPVESFKEGGLFWFTDLTAYDPYFVLPIVCSLTMLASI---ELGGEAGVSNPQMQHMKTFFRVMCVAMIPLTAQFPAAIFTYWVTSNLFSLGQVSLLK 235          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Ensembl Medaka
Match: oxa1l (OXA1L mitochondrial inner membrane protein [Source:NCBI gene;Acc:101170220])

HSP 1 Score: 75.8702 bits (185), Expect = 9.191e-15
Identity = 59/245 (24.08%), Postives = 100/245 (40.82%), Query Frame = 1
Query:  262 LNLDQNVSTIIAQSIFESVHITTGLPWWATITCTAIVAKTVTIP--------------------SLANQLRITYVSENRL--------LNVYSKEQRKEVLPYLEWLPFSNYILPFLQVVIFASVYPALLVLCN-KMTTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTNDVYKTEGRNNFHLTPTLLSFGFLCFS--------PASISLYWCVNNTYSLYMAYLVKHLKVQKTAKVLDK 885
            L L  N    + Q++ E  H+  GLPWW  I    ++A+    P                     L N++     S N+         LN++ K+         +  P   +++P +Q  +F S + AL  +    + + +TGG+LWFTDL+  D  YILP      +   L   ++    G +N +L      F  +           P ++  YW  +N +SL    L++H  V+K  K+ +K
Sbjct:  191 LGLAGNTPVGLIQNLLEFFHMDLGLPWWGAIVVGTVLARLAVFPVIVKGQREAAKLNNVLPEITKLTNRMNEAKQSGNKFEFAKAYSDLNLFQKKN--------DVNPLRGFLVPLVQAPVFISFFIALRKMAYLPVPSLQTGGMLWFTDLTAADPFYILPIAVTGTMFFIL---ELGAESGIDNPNLRAMKTVFRIMPLVILPLTINFPTAVFTYWLSSNLFSLGQVALLRHPAVRKKFKIPEK 424          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Ensembl Medaka
Match: oxa1l (OXA1L mitochondrial inner membrane protein [Source:NCBI gene;Acc:101170220])

HSP 1 Score: 75.485 bits (184), Expect = 9.837e-15
Identity = 59/245 (24.08%), Postives = 100/245 (40.82%), Query Frame = 1
Query:  262 LNLDQNVSTIIAQSIFESVHITTGLPWWATITCTAIVAKTVTIP--------------------SLANQLRITYVSENRL--------LNVYSKEQRKEVLPYLEWLPFSNYILPFLQVVIFASVYPALLVLCN-KMTTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTNDVYKTEGRNNFHLTPTLLSFGFLCFS--------PASISLYWCVNNTYSLYMAYLVKHLKVQKTAKVLDK 885
            L L  N    + Q++ E  H+  GLPWW  I    ++A+    P                     L N++     S N+         LN++ K+         +  P   +++P +Q  +F S + AL  +    + + +TGG+LWFTDL+  D  YILP      +   L   ++    G +N +L      F  +           P ++  YW  +N +SL    L++H  V+K  K+ +K
Sbjct:  151 LGLAGNTPVGLIQNLLEFFHMDLGLPWWGAIVVGTVLARLAVFPVIVKGQREAAKLNNVLPEITKLTNRMNEAKQSGNKFEFAKAYSDLNLFQKKN--------DVNPLRGFLVPLVQAPVFISFFIALRKMAYLPVPSLQTGGMLWFTDLTAADPFYILPIAVTGTMFFIL---ELGAESGIDNPNLRAMKTVFRIMPLVILPLTINFPTAVFTYWLSSNLFSLGQVALLRHPAVRKKFKIPEK 384          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Planmine SMEST
Match: SMESG000037478.1 (SMESG000037478.1)

HSP 1 Score: 600.512 bits (1547), Expect = 0.000e+0
Identity = 294/298 (98.66%), Postives = 294/298 (98.66%), Query Frame = 1
Query:   70 MFSFILKSNKLSNVFKTSANCTFKSNNVIKIPSCSFGIDTLENVIQKLPTNENIVNLQKSAFEFLNLDQNVSTIIAQSIFESVHITTGLPWWATITCTAIVAKTVTIPSLANQLRITYVSENRLLNVYSKEQRKEVLPYLEWLPFSNYILPFLQVVIFASVYPALLVLCNKMTTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTNDVYKTEGRNNFHLTPTLLSFGFLCFSPASISLYWCVNNTYSLYMAYLVKHLKVQKTAKVLDKNADYKRIMEKIQSESESTAQETHQSD 963
            MFSFILKSNKLSNVFKTSA CTFKSNNVIKIPSCSFGIDTLENVIQKLPTNENIVNLQKSA EFLNLDQNVSTIIAQSIFESVHITTGLPWWATITCTAIVAKTVTIPSLANQLRITYVSENRLLNVYSKEQRKEVLPYLEWLPFSNYILPFLQVVIFASVYPALLVLCNKMTTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTNDVYKTEGRNNFHL PTLLSFGFLCFSPASISLYWCVNNTYSLYMAYLVKHLKVQKTAKVLDKNADYKRIMEKIQSE ESTAQETHQSD
Sbjct:    1 MFSFILKSNKLSNVFKTSAICTFKSNNVIKIPSCSFGIDTLENVIQKLPTNENIVNLQKSALEFLNLDQNVSTIIAQSIFESVHITTGLPWWATITCTAIVAKTVTIPSLANQLRITYVSENRLLNVYSKEQRKEVLPYLEWLPFSNYILPFLQVVIFASVYPALLVLCNKMTTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTNDVYKTEGRNNFHLMPTLLSFGFLCFSPASISLYWCVNNTYSLYMAYLVKHLKVQKTAKVLDKNADYKRIMEKIQSEPESTAQETHQSD 298          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Planmine SMEST
Match: SMESG000037475.1 (SMESG000037475.1)

HSP 1 Score: 98.2117 bits (243), Expect = 6.861e-23
Identity = 93/323 (28.79%), Postives = 148/323 (45.82%), Query Frame = 1
Query:   76 SFILKSNKLSNVFKTSANCTFKSNNVIKIPSCSFGIDTLENVIQKLPTNENIVNLQKSAFEFLNLDQNVSTIIAQSIFESVHITTGLPWWATITCTAIVAKTVTIPSLANQLRITYVSENRL-----LNVYSKEQRK--------------EVLPYLEWLPFSNYILPFL-QVVIFASVYPALLVLCN-KMTTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTNDVYKTEGRNNFH-LTPTLLSFGFLCFSPASISLYWCVNNTYSLYMAYLVKHLKVQK--------TAKVLD--KNADYKRIMEKIQSESESTAQE 948
              + +SN   NVF +S++     N   ++ + S   D L + I + P+ E I+N    +F  L L+    T   Q I E+VH +  LPWWA I  TA++ ++   P   +Q R T   +N       L + + E R+              E +       F   + P L Q  +F SV+ AL  + N  + +   GG+ WF DL++ D  +ILP + A  L L +  N    T  +  F  L P  +SF F C  P+++ LYW ++N YSL  A  + + KV+K         A ++D  KN   K  M+ + + +E   +E
Sbjct:   21 GILFQSNNKLNVFSSSSHQISTDNQFTELVNSS---DRL-SYIPEHPSLEVILN---PSFSSLGLNNLTPTGFVQFILENVHNSLALPWWACIAITAVLIRSAITPLSISQRRTTVNIQNSYGKLTQLTIEATEAREMGNSFLMLQKLQEIEKISSESHFNFFKILQPLLIQAPVFISVFTALRGMTNAGIPSLAIGGLWWFPDLTVSDPYFILPAVTAGFLWLIIECNLTTTTNSKWIFRGLGP--VSFLFFCQMPSTLVLYWSISNLYSLVFALFLMNPKVKKFLKIPELVPAPIMDNPKNYGLKETMKLLPAHNELLIRE 334          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Planmine SMEST
Match: SMESG000039158.1 (SMESG000039158.1)

HSP 1 Score: 78.9518 bits (193), Expect = 4.658e-16
Identity = 60/234 (25.64%), Postives = 101/234 (43.16%), Query Frame = 1
Query:  211 LPTNENIVNLQKSAFEFLNLDQNVSTIIAQSIFESVHITTGLPWWATITCTAIVAKTVTIP--------------------SLANQLRITYVSENRLLNVYSKEQRKEVLPYLEWLPFSNYILPFLQVVIFASVYPALLVLCN-KMTTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLR--------TNDVYKTEGRNNFHLTPTLLSFGFLCFSPASISLYWCVNNTYSL 825
            LP   ++ +L +  F+ L L+    +   Q ++E +H+  GLPWW+TI  + I+ + V  P                        ++    V+ + L        ++++L   E+ P  + I   LQ+ +F SV   L  +    + + +TGG  WFTDL+M D  YILP      L L L         TN  Y   G  +      +++  F C  P+++ LYW  ++  SL
Sbjct:   65 LPKFLDLNHLGEPTFKSLGLNSYWPSGWVQHLYEIMHVDLGLPWWSTIVASGIIIRMVMSPISYKIKQLTIINSYISPKIADFDKKIHSARVANDSLSMAKLLHDQQKLLKNSEFSPIKSMIYSLLQIPVFLSVMIGLKNMAELPVASLQTGGAFWFTDLTMYDPYYILPVSTMMLLFLQLEVGADVKKNTNSGYLKWGIRSL----PIVALAFTCRLPSALLLYWWTSSCMSL 294          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Planmine SMEST
Match: SMESG000039158.1 (SMESG000039158.1)

HSP 1 Score: 78.5666 bits (192), Expect = 4.785e-16
Identity = 60/234 (25.64%), Postives = 101/234 (43.16%), Query Frame = 1
Query:  211 LPTNENIVNLQKSAFEFLNLDQNVSTIIAQSIFESVHITTGLPWWATITCTAIVAKTVTIP--------------------SLANQLRITYVSENRLLNVYSKEQRKEVLPYLEWLPFSNYILPFLQVVIFASVYPALLVLCN-KMTTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLR--------TNDVYKTEGRNNFHLTPTLLSFGFLCFSPASISLYWCVNNTYSL 825
            LP   ++ +L +  F+ L L+    +   Q ++E +H+  GLPWW+TI  + I+ + V  P                        ++    V+ + L        ++++L   E+ P  + I   LQ+ +F SV   L  +    + + +TGG  WFTDL+M D  YILP      L L L         TN  Y   G  +      +++  F C  P+++ LYW  ++  SL
Sbjct:   68 LPKFLDLNHLGEPTFKSLGLNSYWPSGWVQHLYEIMHVDLGLPWWSTIVASGIIIRMVMSPISYKIKQLTIINSYISPKIADFDKKIHSARVANDSLSMAKLLHDQQKLLKNSEFSPIKSMIYSLLQIPVFLSVMIGLKNMAELPVASLQTGGAFWFTDLTMYDPYYILPVSTMMLLFLQLEVGADVKKNTNSGYLKWGIRSL----PIVALAFTCRLPSALLLYWWTSSCMSL 297          
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Planmine SMEST
Match: SMESG000005570.1 (SMESG000005570.1)

HSP 1 Score: 50.447 bits (119), Expect = 3.353e-7
Identity = 39/167 (23.35%), Postives = 76/167 (45.51%), Query Frame = 1
Query:  457 KEQRKEVLPYLEWLPFSNYILPFLQVVIFASVYPALLVLCNKM---TTFKTGGILWFTDLSMIDNCYILPTIAAAALCLTLRTNDVYKTE-------GRNNFHLTPTLLSFGFLCFSPASISLYWCVNNTYSLYMAYLVKHLKVQK----TAKVLDKNADYKRIMEK 915
            KE R+E+    ++ P    ++   Q   + +    L VL NK      F  GG LWF+D+++ D  +I+P I      +    N + + E        R  F +  +L+ F F  + P S+++YW  ++ + L    ++ + K+++    +   L+    Y+R+  K
Sbjct:   36 KESRQEMFIEHQYHPLKPMVISMSQFPFWITTSFTLRVLYNKYHLSEAFTNGGCLWFSDITIPDQYFIIPLITLVCSYINGEINYLKQPEIFFIHKVFRYGFRVI-SLMMFIFSSYMPTSLTIYWSTSSAFHLLCNIIIMNPKIRRFFGISKSSLEYETPYRRLWWK 201          
The following BLAST results are available for this feature:
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
OXA1L1.229e-1223.60OXA1L mitochondrial inner membrane protein [Source... [more]
OXA1L1.657e-1223.60OXA1L mitochondrial inner membrane protein [Source... [more]
OXA1L1.812e-1223.60OXA1L mitochondrial inner membrane protein [Source... [more]
OXA1L1.921e-1223.60OXA1L mitochondrial inner membrane protein [Source... [more]
back to top
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
oxa-13.097e-823.83OXA mitochondrial inner membrane insertase homolog... [more]
back to top
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
OXA1L1.974e-1324.37gene:FBgn0027615 transcript:FBtr0076271[more]
OXA1L1.974e-1324.37gene:FBgn0027615 transcript:FBtr0076272[more]
back to top
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
oxa1l1.870e-1524.46OXA1L mitochondrial inner membrane protein [Source... [more]
oxa1l1.870e-1524.46OXA1L mitochondrial inner membrane protein [Source... [more]
back to top
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mpp21.422e-1022.83membrane protein, palmitoylated 2 [Source:Xenbase;... [more]
mpp21.897e-1022.83membrane protein, palmitoylated 2 [Source:Xenbase;... [more]
cox185.637e-923.94cytochrome c oxidase assembly factor COX18 [Source... [more]
back to top
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Oxa1l1.987e-1224.66oxidase assembly 1-like [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Mitochondrial inner membrane protein OXA1-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q42191|OXA1_ARATH5.063e-1728.31Mitochondrial inner membrane protein OXA1 OS=Arabi... [more]
sp|Q9SKD3|OXA1L_ARATH6.464e-1530.05Mitochondrial inner membrane protein OXA1-like OS=... [more]
sp|Q15070|OXA1L_HUMAN7.384e-1223.60Mitochondrial inner membrane protein OXA1L OS=Homo... [more]
sp|Q3SYV3|OXA1L_BOVIN1.193e-1125.34Mitochondrial inner membrane protein OXA1L OS=Bos ... [more]
sp|Q8BGA9|OXA1L_MOUSE1.390e-1124.66Mitochondrial inner membrane protein OXA1L OS=Mus ... [more]
back to top
BLAST of Mitochondrial inner membrane protein OXA1-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A072UZ261.822e-1931.0560 kDa inner membrane protein OS=Medicago truncatu... [more]
A0A1S3EAV11.989e-1831.51mitochondrial inner membrane protein OXA1 OS=Cicer... [more]
A0A3Q7IF774.267e-1830.96AMP-binding domain-containing protein OS=Solanum l... [more]
A0A1X2GLZ95.461e-1825.16Uncharacterized protein OS=Hesseltinella vesiculos... [more]
A0A443PR868.678e-1828.77Mitochondrial inner membrane protein OXA1-like pro... [more]
back to top
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
oxa1l1.015e-1323.51OXA1L mitochondrial inner membrane protein [Source... [more]
oxa1l2.860e-1323.41OXA1L mitochondrial inner membrane protein [Source... [more]
back to top
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
OXA12.131e-924.66Mitochondrial inner membrane insertase; mediates t... [more]
back to top
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO472646.492e-1425.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
oxa1l9.191e-1524.08OXA1L mitochondrial inner membrane protein [Source... [more]
oxa1l9.837e-1524.08OXA1L mitochondrial inner membrane protein [Source... [more]
back to top
BLAST of Mitochondrial inner membrane protein OXA1-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037478.10.000e+098.66SMESG000037478.1[more]
SMESG000037475.16.861e-2328.79SMESG000037475.1[more]
SMESG000039158.14.658e-1625.64SMESG000039158.1[more]
SMESG000039158.14.785e-1625.64SMESG000039158.1[more]
SMESG000005570.13.353e-723.35SMESG000005570.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014066 ID=SMED30014066|Name=Mitochondrial inner membrane protein OXA1-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1035bp
TTAATTACGACAATTATTTAAATCTTAATCATGCTTATGATTATATAAGT
TTTCTTAGATATTTGTATAATGTTTAGCTTTATCTTAAAATCAAATAAGT
TAAGTAATGTTTTTAAAACAAGTGCTAATTGTACATTTAAAAGTAATAAT
GTAATTAAAATACCTTCTTGTAGCTTTGGAATTGATACATTAGAGAATGT
TATACAGAAACTTCCAACCAATGAAAACATTGTAAACTTACAGAAATCTG
CTTTTGAATTTTTGAATCTAGATCAAAACGTTTCTACAATTATAGCCCAA
AGCATTTTCGAATCTGTTCATATAACGACAGGATTACCATGGTGGGCAAC
AATTACCTGCACGGCAATCGTTGCAAAGACAGTTACAATACCATCATTAG
CCAATCAATTACGAATTACATATGTCAGTGAAAATAGATTATTAAACGTA
TATTCAAAGGAGCAACGTAAAGAAGTTTTACCATATTTAGAATGGTTACC
ATTTTCGAATTATATTCTTCCATTTTTACAGGTGGTTATTTTCGCTTCTG
TCTATCCGGCCTTGTTGGTATTGTGTAATAAAATGACTACATTTAAAACC
GGTGGCATTTTATGGTTCACAGATTTGTCTATGATTGATAATTGCTATAT
ATTACCAACAATTGCTGCTGCTGCACTCTGTTTAACGCTTAGAACGAATG
ATGTCTACAAAACAGAAGGCCGCAATAATTTCCATCTAACGCCTACTTTA
TTATCATTTGGTTTTCTATGTTTTTCCCCTGCATCAATCTCTCTGTATTG
GTGTGTGAATAACACGTATTCACTGTATATGGCCTATTTAGTGAAACATT
TGAAAGTGCAAAAAACAGCGAAAGTTCTAGATAAGAATGCCGATTACAAG
CGCATTATGGAGAAAATTCAATCGGAATCGGAATCTACAGCACAAGAAAC
TCACCAAAGTGATTAGTCGTAAGGATCGATAAAAAGTTGAGATGTGAAAA
TTGATTAATAAAATTTTGTTTAGTTTGCTAAACAA
back to top

protein sequence of SMED30014066-orf-1

>SMED30014066-orf-1 ID=SMED30014066-orf-1|Name=SMED30014066-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=299bp
MFSFILKSNKLSNVFKTSANCTFKSNNVIKIPSCSFGIDTLENVIQKLPT
NENIVNLQKSAFEFLNLDQNVSTIIAQSIFESVHITTGLPWWATITCTAI
VAKTVTIPSLANQLRITYVSENRLLNVYSKEQRKEVLPYLEWLPFSNYIL
PFLQVVIFASVYPALLVLCNKMTTFKTGGILWFTDLSMIDNCYILPTIAA
AALCLTLRTNDVYKTEGRNNFHLTPTLLSFGFLCFSPASISLYWCVNNTY
SLYMAYLVKHLKVQKTAKVLDKNADYKRIMEKIQSESESTAQETHQSD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0032977membrane insertase activity
Vocabulary: biological process
TermDefinition
GO:0090150establishment of protein localization to membrane
GO:0051205protein insertion into membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR001708YidC/ALB3/OXA1/COX18
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005739mitochondrion
GO:0005743mitochondrial inner membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR12428:SF17MITOCHONDRIAL INNER MEMBRANE PROTEIN OXA1Lcoord: 73..110
coord: 144..290
NoneNo IPR availableTMHMMTMhelixcoord: 224..246
NoneNo IPR availableTMHMMTMhelixcoord: 148..170
NoneNo IPR availableTMHMMTMhelixcoord: 191..209
IPR001708Membrane insertase YidC/ALB3/OXA1/COX18PANTHERPTHR12428OXA1coord: 144..290
IPR001708Membrane insertase YidC/ALB3/OXA1/COX18PANTHERPTHR12428OXA1coord: 73..110