slc16a-1

Overview
Nameslc16a-1 (AKN21496.1)
Smed IDSMED30014065
Length (bp)1570
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc16a-1 (SMED30014065) t-SNE clustered cells

Violin plots show distribution of expression levels for slc16a-1 (SMED30014065) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc16a-1 (SMED30014065) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc16a-1 (SMED30014065) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014065

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30014065SMESG000028667.1 Contig4237GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30014065SMESG000026518.1 SMESG000026516.1 Contig5527GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30014065SMESG000026518.1 Contig4237GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30014065SMESG000026518.1 SMESG000026516.1 dd_Smed_v4_3252_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014065SMESG000026518.1 SMESG000026516.1 dd_Smed_v4_3252_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc16a-1 vs. Ensembl Human
Match: SLC16A12 (solute carrier family 16 member 12 [Source:HGNC Symbol;Acc:HGNC:23094])

HSP 1 Score: 58.5362 bits (140), Expect = 1.593e-8
Identity = 50/203 (24.63%), Postives = 88/203 (43.35%), Query Frame = 2
Query:  146 WLILGFAAVNVIFLGGKRRAFGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKNLDLKEVSSTGKSKYSCQT 754
            W+I+    +  I      R    F  +F + Y      +  WI         +   L   +  + + + G+   LG L      I SSF  +   L+LT  +  G+G +L  S A  +V +YF +  R  +     +SG  + + +   +   LI++++W GAL ILG     +C C A+   + + LKE  +T +  + C+T
Sbjct:   49 WMIVAGCFLVTICTRAVTRCISIFFVEF-QTYFTQDYAQTAWIHSIVDCVTMLCAPLGSVVSNHLSCQVGIM--LGGLLASTGLILSSFATSLKHLYLTLGVLTGLGFALCYSPAIAMVGKYFSR--RKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVLNLCVCGALM--RPITLKEDHTTPEQNHVCRT 244          
BLAST of slc16a-1 vs. Ensembl Human
Match: SLC16A4 (solute carrier family 16 member 4 [Source:HGNC Symbol;Acc:HGNC:10925])

HSP 1 Score: 54.299 bits (129), Expect = 3.559e-7
Identity = 49/171 (28.65%), Postives = 77/171 (45.03%), Query Frame = 2
Query:  146 WLI-LGFAAVNVIFLGGKRRAFGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVL 655
            W+I + F  VNV F+ G  + F  F   F +E+   S  ++ WIG   S+  + +  L   I      +      LGA  V    + SS+  +  +L +T  L  G+GS+ +   A +V  +YF K+     L+T +   G   + L      FLI  Y W GAL + G +
Sbjct:   21 WMIVIHFFLVNV-FVMGMTKTFAIFFVVFQEEFEGTS-EQIGWIGSIMSSLRFCAGPLVAIICDILGEKTT--SILGAFVVTGGYLISSWATSIPFLCVTMGLLPGLGSAFLYQVAAVVTTKYFKKRLA---LSTAIARSGMGLTFLLAPFTKFLIDLYDWTGALILFGAI 184          
BLAST of slc16a-1 vs. Ensembl Human
Match: SLC16A4 (solute carrier family 16 member 4 [Source:HGNC Symbol;Acc:HGNC:10925])

HSP 1 Score: 51.9878 bits (123), Expect = 1.515e-6
Identity = 45/164 (27.44%), Postives = 73/164 (44.51%), Query Frame = 2
Query:  149 LILGFAAVNVIFLGGKRRAFGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQ 640
            +++ F  VNV F+ G  + F  F   F +E+   S  ++ WIG   S+  + +  L   I      +      LGA  V    + SS+  +  +L +T  L  G+GS+ +   A +V  +YF K+     L+T +   G   + L      FLI  Y W G L+
Sbjct:   23 IVIHFFLVNV-FVMGMTKTFAIFFVVFQEEFEGTS-EQIGWIGSIMSSLRFCAGPLVAIICDILGEKTT--SILGAFVVTGGYLISSWATSIPFLCVTMGLLPGLGSAFLYQVAAVVTTKYFKKRLA---LSTAIARSGMGLTFLLAPFTKFLIDLYDWTGILE 179          
BLAST of slc16a-1 vs. Ensembl Fly
Match: Sln (gene:FBgn0033657 transcript:FBtr0088032)

HSP 1 Score: 50.447 bits (119), Expect = 3.794e-6
Identity = 53/200 (26.50%), Postives = 93/200 (46.50%), Query Frame = 2
Query:  146 WLILGFAAVNVIF-LGGKRRAFGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTL-VSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKNLDLKEVSSTGKSK 739
            W I+ F A +V F + G  +++G    +  + +P+ + T  +WI    SA   +   L+  +   F+ R     F+G ++  +  I S F  +   L LT  +  GIG  L  +   ++V++YFD KHR   LA  + VSG +  S +  +L   L +   + G + ILG     VC  A ++   +    + S  G+ +
Sbjct:  232 WFIV-FGAFSVQFWVAGLVKSYGVLYVEIMETFPSSTATVASWIPAILSALCLVLAPLSSALCQRFSCR--TVVFVGGIFCAMGMILSYFATSLLHLLLTFGVLTGIGGGLSTTPGIVIVSQYFD-KHR--ALANGICVSGTAAGSFILPVLIKHLAENCGFHGTILILGGCMLHVCVSATLYRPISAYTDQDSGQGQEE 425          
BLAST of slc16a-1 vs. Ensembl Zebrafish
Match: slc16a13 (solute carrier family 16 member 13 [Source:ZFIN;Acc:ZDB-GENE-120907-2])

HSP 1 Score: 55.0694 bits (131), Expect = 1.268e-7
Identity = 80/318 (25.16%), Postives = 138/318 (43.40%), Query Frame = 2
Query:  146 WLILGFAAVNVIFLGGKRRAFGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYG------LFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTL-VSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKNLDLKEVSSTGKSKYSCQTYIRWKNIPLLILWFVDRVLTSVVTYGILL------------NLTTHSYEKHYSLVDSSISTVLFASGEASTYLIGAIIMAITKDLFKERLRYVLLVTSFTMCASLILI 1042
            W+++G   V    + G  R+ G F  +F  +Y + S   ++WI    ++ G     L   I    +  YG      +  FL  L  +++   +S +   H L+LT  L  G+G +L+ +     V +YF K+     LA  L  +G  +AS  F  LF +L++ Y W GAL ILG L F +  C A+          V +   +K +  +++  +      L  +       VTY + +            +L  HS  +H    +   + V+  +G A   ++G +      DL K RL ++L+V +  +  SL+LI
Sbjct:   26 WVVVGALFVISALVFGLIRSLGVFFVEF-VQYFDESAQAVSWI----TSIGLAMQQLMSPIGAAASNVYGTRPVVMIGGFLSGLGFILASQATSLL---H-LYLTMGLISGLGWALVFTPTMASVMQYFTKRRS---LAMGLGFTGVGLASFAFSPLFQYLVEAYAWRGALLILGGLSFNMVACGALIRPLGTPKVAVKTENSTKLNKCSFLLSRIYECFELSLLTH--RGFVTYAVAITFFNAGYFIPYVHLVAHS--RHIGFTEYQAAFVISITGVAD--IVGRVASGWASDLGKIRLLHMLVVWTGLLGLSLMLI 325          
BLAST of slc16a-1 vs. Ensembl Zebrafish
Match: CR352261.2 (solute carrier family 16 member 13 [Source:NCBI gene;Acc:793210])

HSP 1 Score: 54.6842 bits (130), Expect = 1.800e-7
Identity = 82/320 (25.62%), Postives = 139/320 (43.44%), Query Frame = 2
Query:  146 WLILGFAAVNVIFLGGKRRAFGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYG------LFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTL-VSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKNLDLKEVSSTGKSKYSCQTYIR--WKNIPLLILWFVDRVLTSVVTYGILL------------NLTTHSYEKHYSLVDSSISTVLFASGEASTYLIGAIIMAITKDLFKERLRYVLLVTSFTMCASLILI 1042
            W+++G   V    + G  R+ G F  +F  +Y + S   ++WI    ++ G     L   I    +  YG      +  FL  L  +++   +S +   H L+LT  L  G+G +L+ +     V +YF K+     LA  L  +G  +AS  F  LF +L++ Y W GAL ILG L F +  C A+   + L   +V+        C   +   ++   L +L          VTY + +            +L  HS  +H    +   + V+  +G A   ++G +      DL K RL ++L+V +  +  SL+LI
Sbjct:   18 WVVVGALFVISALVFGLIRSLGVFFVEF-VQYFDESAQAVSWI----TSIGLAMQQLMSPIGAAASNVYGTRPVVMMGGFLSGLGFILASQATSLL---H-LYLTMGLISGLGWALVFTPTMASVMQYFTKRRS---LAMGLGFTGVGLASFAFSPLFQYLVEAYAWRGALLILGGLSFNMVACGALI--RPLGTPKVTENSTKLNKCSFLLSRIYECFELSLL-----THRGFVTYAVAITFFNAGYFIPYVHLVAHS--RHIGFTEYQAAFVISITGVAD--IVGRVASGWASDLGKIRLLHMLVVWTGLLGLSLMLI 314          
BLAST of slc16a-1 vs. Ensembl Xenopus
Match: slc16a12 (solute carrier family 16 member 12 [Source:NCBI gene;Acc:394932])

HSP 1 Score: 51.9878 bits (123), Expect = 1.267e-6
Identity = 44/172 (25.58%), Postives = 80/172 (46.51%), Query Frame = 2
Query:  206 FGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKNLDLKEVS 721
            F  F + F ++Y   +     WI         +   +   +  +F+ + G+   LG +      + SSF  +  +L+LT  +  G+G +L  S A  +V +YF+K  R  +     +SG  + + +   +   LI++++W GAL ILG     +C C A+   + + LKE S
Sbjct:   43 FVEFQSYFAQDYARTA-----WIHSIVDCSTMLCAPIGSYVSNHFSCQVGII--LGGVLASTGLVLSSFATSLEYLYLTLGVLTGLGFALCYSPAIAMVGKYFEK--RKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVSNLCVCGALM--RPITLKEDS 203          
BLAST of slc16a-1 vs. Ensembl Mouse
Match: Slc16a4 (solute carrier family 16 (monocarboxylic acid transporters), member 4 [Source:MGI Symbol;Acc:MGI:2385183])

HSP 1 Score: 54.299 bits (129), Expect = 2.362e-7
Identity = 51/182 (28.02%), Postives = 79/182 (43.41%), Query Frame = 2
Query:  119 PCYKPSILMW---LILGFAAVNVIFLGGKRRAFGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVL 655
            P  KP    W   ++L F  VNV F+ G  + F  F   F +E+   S  ++ WIG   S+  + +  L   I      +      LG   V    + SS+     +L +T  L  G+GS+ +   A +V+ +YF K+     L+T +   G   + L      FLI  Y W GAL + G +
Sbjct:   10 PYTKPLDGGWGWMVVLHFFLVNV-FVMGMTKTFAIFFVVFQEEFEGTS-EQIGWIGSIMSSLRFSAGPLAAIICDVLGEKAT--SILGTFLVSGGYVISSWATGIPFLCVTMGLLPGLGSAFLYQVAAVVITKYFKKRLG---LSTAIARSGMGLTFLLAPFTKFLIDLYDWTGALILFGAI 184          
BLAST of slc16a-1 vs. Ensembl Mouse
Match: Slc16a4 (solute carrier family 16 (monocarboxylic acid transporters), member 4 [Source:MGI Symbol;Acc:MGI:2385183])

HSP 1 Score: 54.299 bits (129), Expect = 2.414e-7
Identity = 51/182 (28.02%), Postives = 79/182 (43.41%), Query Frame = 2
Query:  119 PCYKPSILMW---LILGFAAVNVIFLGGKRRAFGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVL 655
            P  KP    W   ++L F  VNV F+ G  + F  F   F +E+   S  ++ WIG   S+  + +  L   I      +      LG   V    + SS+     +L +T  L  G+GS+ +   A +V+ +YF K+     L+T +   G   + L      FLI  Y W GAL + G +
Sbjct:   10 PYTKPLDGGWGWMVVLHFFLVNV-FVMGMTKTFAIFFVVFQEEFEGTS-EQIGWIGSIMSSLRFSAGPLAAIICDVLGEKAT--SILGTFLVSGGYVISSWATGIPFLCVTMGLLPGLGSAFLYQVAAVVITKYFKKRLG---LSTAIARSGMGLTFLLAPFTKFLIDLYDWTGALILFGAI 184          
BLAST of slc16a-1 vs. Ensembl Mouse
Match: Slc16a12 (solute carrier family 16 (monocarboxylic acid transporters), member 12 [Source:MGI Symbol;Acc:MGI:2147716])

HSP 1 Score: 49.2914 bits (116), Expect = 8.906e-6
Identity = 45/200 (22.50%), Postives = 83/200 (41.50%), Query Frame = 2
Query:  146 WLILGFAAVNVIFLGGKRRAFGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKNLDLKEVSSTGKSKYS 745
            W+I+    +  I      R    F  +F   +     ++  WI         +   L   +    + + G+   LG L      I  SF  +   L+L+  +  G+G +L  S A  +V +YF +  R  +     +SG  + + +   +   LI++++W GAL ILG     +C C A+   + + LKE  S  +  ++
Sbjct:   19 WMIVAGCFLVTICTRAVTRCISIFFVEFQTYFAQ-DYSQTAWIHSIVDCMTMLCAPLGSVVSNQLSCQAGIM--LGGLLASTGFILGSFATSLKHLYLSLGVLTGLGFALCYSPAIAMVGKYFSR--RKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVLNLCVCGALM--RPITLKEDRSVPEKNHN 211          
BLAST of slc16a-1 vs. UniProt/SwissProt
Match: sp|Q6ZSM3|MOT12_HUMAN (Monocarboxylate transporter 12 OS=Homo sapiens OX=9606 GN=SLC16A12 PE=1 SV=3)

HSP 1 Score: 58.5362 bits (140), Expect = 7.648e-8
Identity = 50/203 (24.63%), Postives = 88/203 (43.35%), Query Frame = 2
Query:  146 WLILGFAAVNVIFLGGKRRAFGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKNLDLKEVSSTGKSKYSCQT 754
            W+I+    +  I      R    F  +F + Y      +  WI         +   L   +  + + + G+   LG L      I SSF  +   L+LT  +  G+G +L  S A  +V +YF +  R  +     +SG  + + +   +   LI++++W GAL ILG     +C C A+   + + LKE  +T +  + C+T
Sbjct:   49 WMIVAGCFLVTICTRAVTRCISIFFVEF-QTYFTQDYAQTAWIHSIVDCVTMLCAPLGSVVSNHLSCQVGIM--LGGLLASTGLILSSFATSLKHLYLTLGVLTGLGFALCYSPAIAMVGKYFSR--RKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVLNLCVCGALM--RPITLKEDHTTPEQNHVCRT 244          
BLAST of slc16a-1 vs. UniProt/SwissProt
Match: sp|Q8R0M8|MOT5_MOUSE (Monocarboxylate transporter 5 OS=Mus musculus OX=10090 GN=Slc16a4 PE=2 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 1.652e-6
Identity = 51/182 (28.02%), Postives = 79/182 (43.41%), Query Frame = 2
Query:  119 PCYKPSILMW---LILGFAAVNVIFLGGKRRAFGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVL 655
            P  KP    W   ++L F  VNV F+ G  + F  F   F +E+   S  ++ WIG   S+  + +  L   I      +      LG   V    + SS+     +L +T  L  G+GS+ +   A +V+ +YF K+     L+T +   G   + L      FLI  Y W GAL + G +
Sbjct:   10 PYTKPLDGGWGWMVVLHFFLVNV-FVMGMTKTFAIFFVVFQEEFEGTS-EQIGWIGSIMSSLRFSAGPLAAIICDVLGEKAT--SILGTFLVSGGYVISSWATGIPFLCVTMGLLPGLGSAFLYQVAAVVITKYFKKRLG---LSTAIARSGMGLTFLLAPFTKFLIDLYDWTGALILFGAI 184          
BLAST of slc16a-1 vs. UniProt/SwissProt
Match: sp|O15374|MOT5_HUMAN (Monocarboxylate transporter 5 OS=Homo sapiens OX=9606 GN=SLC16A4 PE=1 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 1.709e-6
Identity = 49/171 (28.65%), Postives = 77/171 (45.03%), Query Frame = 2
Query:  146 WLI-LGFAAVNVIFLGGKRRAFGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVL 655
            W+I + F  VNV F+ G  + F  F   F +E+   S  ++ WIG   S+  + +  L   I      +      LGA  V    + SS+  +  +L +T  L  G+GS+ +   A +V  +YF K+     L+T +   G   + L      FLI  Y W GAL + G +
Sbjct:   21 WMIVIHFFLVNV-FVMGMTKTFAIFFVVFQEEFEGTS-EQIGWIGSIMSSLRFCAGPLVAIICDILGEKTT--SILGAFVVTGGYLISSWATSIPFLCVTMGLLPGLGSAFLYQVAAVVTTKYFKKRLA---LSTAIARSGMGLTFLLAPFTKFLIDLYDWTGALILFGAI 184          
BLAST of slc16a-1 vs. UniProt/SwissProt
Match: sp|Q90632|MOT3_CHICK (Monocarboxylate transporter 3 OS=Gallus gallus OX=9031 GN=SLC16A3 PE=2 SV=2)

HSP 1 Score: 52.373 bits (124), Expect = 7.491e-6
Identity = 45/186 (24.19%), Postives = 76/186 (40.86%), Query Frame = 2
Query:  206 FGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASIL-FVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKNLDLKEVSSTGKSKYSCQTYI 760
            F   +  FH  Y     ++  WI     A  Y +  +   ++  F  R      +G L      I +SF  N   L+LT  +  G+G +L    + +++  YFDK+     LA  L + GS   +     L   L++K+ W G   I+G L    C C A+    +  +K  +   + KY  +  +
Sbjct:   48 FKELMKDFHVGY-----SDTAWISSIMLAMLYGTGPVCSIMVNQFGCRP--VMLIGGLLASSGMILASFTTNIIELYLTAGVLTGLGMALNFQPSLIMLGTYFDKRRP---LANGLAAAGSPVFLSSLSPLGQVLLEKFGWRGGFLIMGGLLLNCCTCGAVMRPLDAGMKRKTEKAQDKYEAKEML 223          
BLAST of slc16a-1 vs. UniProt/SwissProt
Match: sp|Q6GM59|MOT12_XENLA (Monocarboxylate transporter 12 OS=Xenopus laevis OX=8355 GN=slc16a12 PE=2 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 9.070e-6
Identity = 44/172 (25.58%), Postives = 80/172 (46.51%), Query Frame = 2
Query:  206 FGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKNLDLKEVS 721
            F  F + F ++Y   +     WI         +   +   +  +F+ + G+   LG +      + SSF  +  +L+LT  +  G+G +L  S A  +V +YF+K  R  +     +SG  + + +   +   LI++++W GAL ILG     +C C A+   + + LKE S
Sbjct:   43 FVEFQSYFAQDYARTA-----WIHSIVDCSTMLCAPIGSYVSNHFSCQVGII--LGGVLASTGLVLSSFATSLEYLYLTLGVLTGLGFALCYSPAIAMVGKYFEK--RKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVSNLCVCGALM--RPISLKEDS 203          
BLAST of slc16a-1 vs. TrEMBL
Match: A0A0H3YIZ4 (Slc16a-1 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc16a-1 PE=2 SV=1)

HSP 1 Score: 853.588 bits (2204), Expect = 0.000e+0
Identity = 438/452 (96.90%), Postives = 447/452 (98.89%), Query Frame = 2
Query:  107 LSKLPCYKPSILMWLILGFAAVNVIFLGGKRRAFGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKNLDLKEVSSTGKSKYSCQTYIRWKNIPLLILWFVDRVLTSVVTYGILLNLTTHSYEKHYSLVDSSISTVLFASGEASTYLIGAIIMAITKDLFKERLRYVLLVTSFTMCASLILIYFFEANKTVLRSLLFVAGFSLGPSITFLFPAGEELTRLPGHVAYPFSLGGMGFGMMISPLLTAKIIELYNFQMFFLVQGGLIGIKFVCXXXXXXXXFFWQNKIDLLNRSISISNSKNYLENGLTDDETVSILKRSINGSY 1462
            L +LPCY+ S+L W+IL FAA+NVIFLGGKRRAFGSF+AQFHKEYPNISLTELNWIGDSYSA GYMSTSL+++IIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKNLDLKEVSSTGKSKYSCQTYIRWKNIPLLILWFVDRVLTSVVTYGILLNLTTHSYEKHYSLVDSSISTVLFASGEASTYLIGAIIMAITKDLFKERLRYVLLVTSFTMCASLILIYFFEANKTVLRSLLFVAGFSLGPSITFLFPAGEELTRLPGHVAYPFSLGGMGFGMMISPLLTAKIIELYNFQMFFLVQGGLIGIKFVCLLLILIILFFWQNKIDLLNRSISISNSKNYLENGLTDDETVSILKRSINGSY
Sbjct:   10 LYRLPCYRASVLPWIILAFAAINVIFLGGKRRAFGSFVAQFHKEYPNISLTELNWIGDSYSAIGYMSTSLSISIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKNLDLKEVSSTGKSKYSCQTYIRWKNIPLLILWFVDRVLTSVVTYGILLNLTTHSYEKHYSLVDSSISTVLFASGEASTYLIGAIIMAITKDLFKERLRYVLLVTSFTMCASLILIYFFEANKTVLRSLLFVAGFSLGPSITFLFPAGEELTRLPGHVAYPFSLGGMGFGMMISPLLTAKIIELYNFQMFFLVQGGLIGIKFVCLLLILIILFFWQNKIDLLNRSISISNSKNYLENGLTDDETVSILKRSINGSY 461          
BLAST of slc16a-1 vs. TrEMBL
Match: A0A0H3YF92 (Slc16a-2 OS=Schmidtea mediterranea OX=79327 GN=slc16a-2 PE=2 SV=1)

HSP 1 Score: 531.561 bits (1368), Expect = 0.000e+0
Identity = 268/418 (64.11%), Postives = 332/418 (79.43%), Query Frame = 2
Query:   95 MVEFLSKLPCYKPSILMWLILGFAAVNVIFLGGKRRAFGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKNLDLKEVSSTGKSKYSCQTYIRWKNIPLLILWFVDRVLTSVVTYGILLNLTTHSYEKHYSLVDSSISTVLFASGEASTYLIGAIIMAITKDLFKERLRYVLLVTSFTMCASLILIYFFEANKTVLRSLLFVAGFSLGPSITFLFPAGEELTRLPGHVAYPFSLGGMGFGMMISPLLTAKIIELYNFQMFFLVQGGLIGIKFVCXXXXXXXXFFWQNK 1348
            M   +SKLP  + S+L W+IL FAA+NVIFLGGKRRAFGSF+A+  ++YPNI+LTELNWIGDSY+A GYM++ +++ II++F RRYG+FQF+GA+WVL+SC+TSSFVPNPHWLFLTHTLFHGIGSSLIIST GLVVN++FD KH YHILATTLVSGGSVASI+FV LF+ LIQ Y W  A  ILG LYFIV   AA+FFRK+ +  E ++       C+ +I+  +IPLL LWF+DRV+TSVVTYG+LLNLT + Y    +LV S+  T LFASGEA TYLIGA I AIT+D FK++LRY+LL TSF M   LI + +F+   +V   L F+AGF+LGPSITFLFPAGEELTRLPGH+AYP SL GMGFGM++SPLLTAKI E++ ++ FF VQG LI IK   +L I++IL F+ +K
Sbjct:    1 MTNLVSKLPWNRASVLPWVILFFAALNVIFLGGKRRAFGSFVAEMRRDYPNITLTELNWIGDSYAAVGYMTSGISIAIILFFKRRYGMFQFMGAIWVLVSCVTSSFVPNPHWLFLTHTLFHGIGSSLIISTVGLVVNDHFDSKHPYHILATTLVSGGSVASIIFVTLFASLIQSYGWRYAFIILGCLYFIVNASAALFFRKSNNQVEDTNKKTVSCRCEGHIKIIHIPLLCLWFIDRVMTSVVTYGLLLNLTDYMYRTEKNLVRSTTLTTLFASGEAITYLIGATITAITRDFFKDKLRYILLGTSFAMSICLIALEYFKGIISVCYILCFLAGFTLGPSITFLFPAGEELTRLPGHMAYPISLAGMGFGMLVSPLLTAKIAEIFLYKWFFFVQGCLILIKVASILAIILILHFYDDK 418          
BLAST of slc16a-1 vs. TrEMBL
Match: A0A3S5B7D0 (MFS domain-containing protein (Fragment) OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS29338 PE=4 SV=1)

HSP 1 Score: 469.544 bits (1207), Expect = 2.266e-158
Identity = 229/387 (59.17%), Postives = 298/387 (77.00%), Query Frame = 2
Query:  146 WLILGFAAVNVIFLGGKRRAFGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKNLDLKEVSSTGKSKYSCQTYIRWKNIPLLILWFVDRVLTSVVTYGILLNLTTHSYEKHYSLVDSSISTVLFASGEASTYLIGAIIMAITKDLFKERLRYVLLVTSFTMCASLILIYFFEANKTVLRSLLFVAGFSLGPSITFLFPAGEELTRLPGHVAYPFSLGGMGFGMMISPLLTAKIIELYNFQMFFLVQGGLIGIKFVC 1306
            W IL  AA+NVIFLGGKRRAFG F+AQ   E+   SL ELNWIGDSY+A GY++T+L+ ++I+   RRYGLFQF GA +VL +C++S++VPNPHWLFLTHT+ HGIGSSLI+STAGLVVNE+FDK HRYHILATTLVSGGSVASI+FV  ++FL++ Y W  A+ ILGV+YF V   A++ FRK++    VS  G+  +S + ++  + IPLL+LW VDR++TS+VTYG+LLNLT   +    SL  S++ T LFASGEASTYL+GA+   +TK+L K RL+Y+L+VT+  M ASL     + +N  +   L ++ GF LGPSITFLFPAGEE+TRLPGH+AYPFSLGGMG GM +SPLL+A I +++ ++ FFLVQ GL+ IK +C
Sbjct:   10 WFILSSAALNVIFLGGKRRAFGVFVAQLRDEFNATSLAELNWIGDSYAAIGYLTTTLSTSLILKLGRRYGLFQFAGACFVLFACVSSAYVPNPHWLFLTHTVLHGIGSSLILSTAGLVVNEHFDKSHRYHILATTLVSGGSVASIVFVQFYAFLVESYGWRHAMIILGVVYFFVIASASLVFRKSVQTTGVSE-GRLVHSWREHLVGRQIPLLVLWTVDRIITSIVTYGMLLNLTDFMHRIEPSLTKSAVLTTLFASGEASTYLLGAMTTGLTKNLLKNRLKYILIVTTLLMSASLAAWEAWASNLLMSHILAYICGFCLGPSITFLFPAGEEMTRLPGHLAYPFSLGGMGLGMSLSPLLSALIAQIFLYKWFFLVQAGLMAIKLIC 395          
BLAST of slc16a-1 vs. TrEMBL
Match: A0A267GLF3 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009632g1 PE=4 SV=1)

HSP 1 Score: 454.521 bits (1168), Expect = 8.630e-153
Identity = 229/397 (57.68%), Postives = 291/397 (73.30%), Query Frame = 2
Query:  119 PCYKPSILMWLILGFAAVNVIFLGGKRRAFGSFIAQFHKEY-PNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKNLDLKEVSSTGKSKYSCQTYIRWKNIPLLILWFVDRVLTSVVTYGILLNLTTHSYEKHYSLVDSSISTVLFASGEASTYLIGAIIMAITKDLFKERLRYVLLVTSFTMCASLILIYFFEANKTVLRSLLFVAGFSLGPSITFLFPAGEELTRLPGHVAYPFSLGGMGFGMMISPLLTAKIIELYNFQMFFLVQGGLIGIKFVC 1306
            P        WLIL FAA+NVIFLGGKRRAFG F+AQ H E+   I+L ELNWIGDSY+AFGYM+T+L+ +II+ + RR+ LFQ LG L +L++C+TS+FVPNPHWLFLTHTLFHGIGSSLI+S  GLVVNE+FDK+H YHILATTLVSGGS+ASILFV L+++LI+ Y W  A  ILGV+YF V    + FF K  DL   ++  K   +     R K +P L+LWF DR++TS+VTYG+LLNL  +   +  SL  SS  T+LFASGEASTY I A+I  +TK+L K RL+Y+L  T+F M  SLI      +N+T+   L +++GF +GPSITFLFPAGEE+T LPGH+AYPFSL GMG GM +SP +TA I E Y ++ FF++QG L+  KF+ 
Sbjct:   16 PQRPQQTWAWLILAFAAINVIFLGGKRRAFGVFVAQLHVEFNQTITLAELNWIGDSYAAFGYMTTTLSTSIILAYGRRFQLFQLLGTLAILLACVTSAFVPNPHWLFLTHTLFHGIGSSLILSVVGLVVNEHFDKQHPYHILATTLVSGGSIASILFVQLYAYLIEVYNWRNAFLILGVIYFFVTLTGSCFFTKREDLPPYANDKKCLGAIWDVERDK-VPYLVLWFFDRIMTSIVTYGMLLNLADYVRRREASLTKSSHLTLLFASGEASTYAIAAVIAVLTKNLLKNRLKYILSSTTFVMSCSLIYWEVVASNETLSYFLAYLSGFCMGPSITFLFPAGEEMTMLPGHLAYPFSLAGMGVGMALSPSVTAMIAERYEYRYFFVIQGFLMFFKFLA 411          
BLAST of slc16a-1 vs. TrEMBL
Match: A0A5J4NSI4 (MFS domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0008634 PE=4 SV=1)

HSP 1 Score: 456.062 bits (1172), Expect = 1.348e-152
Identity = 224/387 (57.88%), Postives = 293/387 (75.71%), Query Frame = 2
Query:  146 WLILGFAAVNVIFLGGKRRAFGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKNLDLKEVSSTGKSKYSCQTYIRWKNIPLLILWFVDRVLTSVVTYGILLNLTTHSYEKHYSLVDSSISTVLFASGEASTYLIGAIIMAITKDLFKERLRYVLLVTSFTMCASLILIYFFEANKTVLRSLLFVAGFSLGPSITFLFPAGEELTRLPGHVAYPFSLGGMGFGMMISPLLTAKIIELYNFQMFFLVQGGLIGIKFVC 1306
            WLIL  +A++V+FLGGKRRAFG F+AQ H E+   SL ELNWIGDSY+A GY++TSL+ ++I+   RR+ + Q  GA+ +L++CITS++VPNPHWLF+THT+ HGIGSSL++STAGLVVNE+FD+ HRYHILATTLVSGGSVA+I+FV  +++LI+ + W  A  ILGV+YF+V    A+ F KN +  +  S  K     Q  +  +   LLILWFVDR++TSVVTYG+LLNL  + Y +  SL  S++ T LFA+GEASTYLIGA++  IT++LFK RLR++L+VTS  M  SL L  F   N+ + R L F+ GF LGPSITFLFPAGEELT LPGH+AYPFSLGGMG GM +SP+L+A I +++ ++ FFLVQG L+ IK  C
Sbjct:    8 WLILVISALSVVFLGGKRRAFGIFVAQLHAEFNRTSLAELNWIGDSYAALGYLTTSLSTSLILATGRRFWVSQMFGAIAILLACITSAYVPNPHWLFITHTILHGIGSSLVLSTAGLVVNEHFDENHRYHILATTLVSGGSVAAIVFVEFYAYLIEAFGWRKAFIILGVIYFLVLLIGALVFEKNANKPDYRSE-KCVLLAQRQLSIRRSSLLILWFVDRIMTSVVTYGMLLNLADYMYRRETSLRRSALLTTLFAAGEASTYLIGAVVTGITRNLFKNRLRFILIVTSCIMALSLTLWEFTADNRNLSRFLAFLCGFCLGPSITFLFPAGEELTMLPGHMAYPFSLGGMGVGMALSPVLSALIAQMFTYRWFFLVQGSLMYIKCAC 393          
BLAST of slc16a-1 vs. Ensembl Cavefish
Match: zgc:114041 (monocarboxylate transporter 13-like [Source:NCBI gene;Acc:103030368])

HSP 1 Score: 53.9138 bits (128), Expect = 2.402e-7
Identity = 59/233 (25.32%), Postives = 105/233 (45.06%), Query Frame = 2
Query:  200 RAFGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGS-VASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFF----------RKNLDLKEVSSTGKSKYSCQTYIRWKNI--PLLILWFVDRVLTSVVTYGILLNLTTHS 859
            R FG F       Y ++  + ++W+  +  A  ++   +   + +Y  +R G+   +GA       I +SF  +  W++L+  +  G+G S        +V+ YF    R+  +A ++ S G  V S+ F   F +LI+ Y+W+GAL I+G L   +  C A+            +   D KE+  +G SK   +   +W  I  P L+L+ V   L +   +   L L  H+
Sbjct:   33 RNFGLFFLHIQNYY-SVPTSTVSWVTSTGIATFHLGAPVAGALSVYLTQR-GVIM-IGAALAASGMIIASFGLSLPWMYLSIGVLQGLGVSFCWMPTNSMVSHYF---KRWRPVAFSISSSGECVFSMAFSPFFQWLIEAYSWQGALLIIGGLQLNLWVCGALMRPLTPKASPQGKLMEDSKELDQSGPSK---KAPFQWSLIRRPELLLYIVFATLATAGFFIPPLFLVPHA 256          
BLAST of slc16a-1 vs. Ensembl Cavefish
Match: zgc:114041 (monocarboxylate transporter 13-like [Source:NCBI gene;Acc:103030368])

HSP 1 Score: 53.9138 bits (128), Expect = 2.402e-7
Identity = 59/233 (25.32%), Postives = 105/233 (45.06%), Query Frame = 2
Query:  200 RAFGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGS-VASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFF----------RKNLDLKEVSSTGKSKYSCQTYIRWKNI--PLLILWFVDRVLTSVVTYGILLNLTTHS 859
            R FG F       Y ++  + ++W+  +  A  ++   +   + +Y  +R G+   +GA       I +SF  +  W++L+  +  G+G S        +V+ YF    R+  +A ++ S G  V S+ F   F +LI+ Y+W+GAL I+G L   +  C A+            +   D KE+  +G SK   +   +W  I  P L+L+ V   L +   +   L L  H+
Sbjct:   33 RNFGLFFLHIQNYY-SVPTSTVSWVTSTGIATFHLGAPVAGALSVYLTQR-GVIM-IGAALAASGMIIASFGLSLPWMYLSIGVLQGLGVSFCWMPTNSMVSHYF---KRWRPVAFSISSSGECVFSMAFSPFFQWLIEAYSWQGALLIIGGLQLNLWVCGALMRPLTPKASPQGKLMEDSKELDQSGPSK---KAPFQWSLIRRPELLLYIVFATLATAGFFIPPLFLVPHA 256          
BLAST of slc16a-1 vs. Ensembl Cavefish
Match: zgc:114041 (monocarboxylate transporter 13-like [Source:NCBI gene;Acc:103030368])

HSP 1 Score: 53.9138 bits (128), Expect = 2.402e-7
Identity = 59/233 (25.32%), Postives = 105/233 (45.06%), Query Frame = 2
Query:  200 RAFGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGS-VASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFF----------RKNLDLKEVSSTGKSKYSCQTYIRWKNI--PLLILWFVDRVLTSVVTYGILLNLTTHS 859
            R FG F       Y ++  + ++W+  +  A  ++   +   + +Y  +R G+   +GA       I +SF  +  W++L+  +  G+G S        +V+ YF    R+  +A ++ S G  V S+ F   F +LI+ Y+W+GAL I+G L   +  C A+            +   D KE+  +G SK   +   +W  I  P L+L+ V   L +   +   L L  H+
Sbjct:   33 RNFGLFFLHIQNYY-SVPTSTVSWVTSTGIATFHLGAPVAGALSVYLTQR-GVIM-IGAALAASGMIIASFGLSLPWMYLSIGVLQGLGVSFCWMPTNSMVSHYF---KRWRPVAFSISSSGECVFSMAFSPFFQWLIEAYSWQGALLIIGGLQLNLWVCGALMRPLTPKASPQGKLMEDSKELDQSGPSK---KAPFQWSLIRRPELLLYIVFATLATAGFFIPPLFLVPHA 256          
BLAST of slc16a-1 vs. Ensembl Cavefish
Match: si:dkey-246g23.4 (monocarboxylate transporter 2-like [Source:NCBI gene;Acc:103034909])

HSP 1 Score: 53.1434 bits (126), Expect = 3.589e-7
Identity = 43/172 (25.00%), Postives = 75/172 (43.60%), Query Frame = 2
Query:  200 RAFGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGS-VASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKNLDLK 712
            ++FG F  + H+ Y   + T  +WI     A  ++   +   +      R      LG L   +  +  +F  N   L++T     G G +L  +    ++  YF+K+     LA  L S G  + + LF   F  L+ +Y+W GA+ +LG +   +C C A+    N  +K
Sbjct:   37 KSFGVFYVEIHR-YFGTTATACSWITSISVATVHIGAPVGSAMSACVGHR--AVVMLGGLLSSVGMVAGAFAQNLLQLYITVGFISGFGYALTWTPTVTMLGCYFEKRRP---LANALASTGECIITFLFTPFFQLLVDEYSWRGAMLVLGAVQLNLCVCGALLRPLNDPVK 202          
BLAST of slc16a-1 vs. Ensembl Cavefish
Match: si:dkey-246g23.4 (monocarboxylate transporter 2-like [Source:NCBI gene;Acc:103034909])

HSP 1 Score: 53.1434 bits (126), Expect = 3.809e-7
Identity = 43/172 (25.00%), Postives = 75/172 (43.60%), Query Frame = 2
Query:  200 RAFGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGS-VASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKNLDLK 712
            ++FG F  + H+ Y   + T  +WI     A  ++   +   +      R      LG L   +  +  +F  N   L++T     G G +L  +    ++  YF+K+     LA  L S G  + + LF   F  L+ +Y+W GA+ +LG +   +C C A+    N  +K
Sbjct:   37 KSFGVFYVEIHR-YFGTTATACSWITSISVATVHIGAPVGSAMSACVGHR--AVVMLGGLLSSVGMVAGAFAQNLLQLYITVGFISGFGYALTWTPTVTMLGCYFEKRRP---LANALASTGECIITFLFTPFFQLLVDEYSWRGAMLVLGAVQLNLCVCGALLRPLNDPVK 202          
BLAST of slc16a-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001631.1 (pep scaffold:Pmarinus_7.0:GL477961:12469:26731:1 gene:ENSPMAG00000001470.1 transcript:ENSPMAT00000001631.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.9954 bits (136), Expect = 5.817e-9
Identity = 59/202 (29.21%), Postives = 94/202 (46.53%), Query Frame = 2
Query:  146 WLILGFAAVNVIFLGGKRRAFGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAA----IFFRKNLDLKEVSSTGKSK 739
            WLI+  A V V  + G  R+ G F  +F  EY   S T ++WI          ++ +  T+   F  R  +   +G +   I  + +SF      L+L+  L  G G +++ S +   +++YFDK  R  +      SG  ++S  F  LF  L++ YTW GAL IL  L   +C C A    I  R++ DL +  +  K +
Sbjct:   14 WLIVLAAFVQVSLVFGVVRSVGVFFIEF-TEYFQESSTAISWITSIALCVHQFASPIASTLSNQFGSRSVVI--VGGISACIGFLCASFAHCLLHLYLSLGLLTGFGWAMVFSPSISTLSKYFDK--RRSLALGIAFSGVGMSSFAFSPLFQMLVETYTWRGALMILAGLELNLCVCGALLRPIRLRED-DLFQTENAAKHR 209          
BLAST of slc16a-1 vs. Ensembl Sea Lamprey
Match: SLC16A12 (solute carrier family 16 member 12 [Source:HGNC Symbol;Acc:HGNC:23094])

HSP 1 Score: 49.6766 bits (117), Expect = 1.387e-6
Identity = 44/162 (27.16%), Postives = 71/162 (43.83%), Query Frame = 2
Query:  206 FGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTL-VSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIF 688
            F  F + F K+Y   +     WI         +   +   +  +F  R  +    G L+     I +SF  +   L++   +F G G SL  S + ++V +YF    R   LAT L +SG  V + L   L  +L+  ++W GAL +LG     +C C A+ 
Sbjct:   36 FMEFQSHFQKDYATTA-----WINSMVDCLTMLCAPIGSLLSSHFGCRATVMA--GGLFSSAGFIMASFATSIEMLYVFLGVFAGFGFSLCYSPSIVMVTKYF---RRRRALATGLAMSGSGVGTFLLAPLVQYLLDVFSWRGALLLLGAFVSNLCVCGALL 187          
BLAST of slc16a-1 vs. Ensembl Sea Lamprey
Match: SLC16A12 (solute carrier family 16 member 12 [Source:HGNC Symbol;Acc:HGNC:23094])

HSP 1 Score: 48.9062 bits (115), Expect = 1.808e-6
Identity = 35/98 (35.71%), Postives = 54/98 (55.10%), Query Frame = 2
Query:  398 ITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTL-VSGGSVAS-ILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAI 685
            I +SF P   +L+L   L  G+G +L  S +  +V+ YF    R+ +LAT L +SG  V + +L  ++   LI+ Y W GAL +LG     +C C A+
Sbjct:  100 IIASFSPTIEFLYLFLGLMAGLGFALCYSPSIAIVSRYF---QRHRLLATGLAMSGNGVGTFVLAPVVQQLLIEVYAWRGALLLLGAFVAQLCVCGAL 194          
BLAST of slc16a-1 vs. Ensembl Nematostella
Match: EDO46207 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQQ5])

HSP 1 Score: 56.225 bits (134), Expect = 1.990e-8
Identity = 46/182 (25.27%), Postives = 90/182 (49.45%), Query Frame = 2
Query:  212 SFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGL--FQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHI-LATTLVSGG-SVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKNLDLKEVSSTGKSKYS 745
            + +  FH+     S  +  W+G     F ++ + +T  +      RYG+     LG +++ +    +S+ PN   +++T+ L  G G+SL  + A ++  +YFDK    H+ LAT +V+ G S+ +++      FL++K  W  A++IL  +  +   CA   +R +   +E  S  ++  S
Sbjct:   78 ALLNHFHE-----SKAKTAWVGSIGLNFLFLGSPVTSRV----AERYGIRTVTILGGVFISLGLFLTSYAPNIVVIYITYGLLFGSGTSLCGTMALIISVDYFDK----HLSLATGIVAAGCSIGTLVLAPTLQFLVEKLGWRYAVRIL-AMSGVFIACAGFVYRPHERRRETFSNDRATRS 245          
BLAST of slc16a-1 vs. Ensembl Nematostella
Match: EDO46709 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPB5])

HSP 1 Score: 53.5286 bits (127), Expect = 9.115e-8
Identity = 47/199 (23.62%), Postives = 88/199 (44.22%), Query Frame = 2
Query:  191 GKRRAFGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKN---LDLKEVSSTGK----SKYSCQTYIRW 766
            G   +FG        E   +   E  WIG       ++   LT  +   ++ +     F+GAL  ++    +SFV  P  ++LT+ L  G+GSSL   ++ +++ EYF K  R  ++     SG  V S++   + ++L+    W+  +++L     ++   AA  F+ N   +  +     GK    S +  + Y+ W
Sbjct:   24 GIHNSFGVVYVNLLDEL-KLGKAETAWIGAMAMGLNFLCGPLTSILCTRYSCQ--ATAFIGALLSVLGLFLTSFVQEPPKMYLTYGLLFGVGSSLSFVSSIVILGEYFQK--RLALVNGIATSGSGVGSLVTGPVMNYLLANIGWQNCMRVLSGFAMLLW-IAAFLFKPNKRRVSTRPSKDAGKLVDLSIWRNKAYVTW 216          
BLAST of slc16a-1 vs. Ensembl Nematostella
Match: EDO46666 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPD0])

HSP 1 Score: 53.1434 bits (126), Expect = 1.544e-7
Identity = 35/139 (25.18%), Postives = 66/139 (47.48%), Query Frame = 2
Query:  257 TELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGL--FQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIV 667
             E  WIG    +  +    L   +  +   RYG     F+G +  ++    +SFV NP  +++T+ L  G+GS L  + + +V+ +YF K  R+ +      SG  +  +L      FL+  + W+ +++IL  +  I+
Sbjct:   62 AESAWIGSVAGSLNF----LCGPVASFLCDRYGCRSVAFIGGILSVLGLFLTSFVQNPGKMYVTYGLLWGVGSGLSFTPSIIVLGQYFRK--RFPLANGIASSGSGIGGLLAAPFIQFLLSNFGWQNSMRILACIANIL 194          
BLAST of slc16a-1 vs. Ensembl Nematostella
Match: EDO48615 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ37])

HSP 1 Score: 51.9878 bits (123), Expect = 3.394e-7
Identity = 55/240 (22.92%), Postives = 91/240 (37.92%), Query Frame = 2
Query:  215 FIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKNLDLKEVSSTGKSKYSCQTYIRWKN--------------IPLLILWFVDRVLTSVVTYGILLNLTTHSYEKHYSLVDSS 892
             I +F++   N +     W+G    +  Y    L+    + F  R      +G L   +S I SSF P    ++  +    GIG   I ++  L   +YF K+     LAT +V+ G+    L   ++  LI    W  + +I+G L+ I C    I    + D K          SC+   + ++              IP   +  +   + +V  Y  L +L  H  E   S   SS
Sbjct:   50 LIQEFNETRENAA-----WVGSIAYSMSYFCAPLSAWCCVRFGCRR--TAIVGTLTCAVSLIISSFAPGLLMMYFIYGALFGIGGGFIHTSGLLTTTKYFYKRRS---LATGIVAAGASIGTLIGPVYQALIDGVGWRNSYRIIGALFSIAC----ILVWVSYDPKVKDGQEDRTVSCEQGSQRRSGSCACPSLDCAVWRIPEYTVVLIAATVEAVGVYVPLAHLVKHCREIGVSAQKSS 275          
BLAST of slc16a-1 vs. Ensembl Nematostella
Match: EDO40585 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6T8])

HSP 1 Score: 51.6026 bits (122), Expect = 3.426e-7
Identity = 39/129 (30.23%), Postives = 65/129 (50.39%), Query Frame = 2
Query:  374 ALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKY-TWEGALQILGVLYFIVCGCAAIFFRKNLDLKE-VSSTGKSKYSCQT 754
            +L  +I  ++SSFVPN   L+ T+   +GIGS+LI  ++ +V   YF ++    +LAT +VS G  AS+  +      I K   W   L  L  L  + C        KN  +++ ++  G S+  C++
Sbjct:   35 SLITIIGLVSSSFVPNIVLLYFTYGFMNGIGSNLIYISSMMVPALYFKRR---RMLATAIVSTGPGASLFIMSPIVEAIHKVLDWRKTLLCLAGLCLVPCLGGWALREKNKKVEQTIAQRGSSERRCRS 160          
BLAST of slc16a-1 vs. Ensembl Medaka
Match: si:dkey-246g23.4 (monocarboxylate transporter 2 [Source:NCBI gene;Acc:101159501])

HSP 1 Score: 55.0694 bits (131), Expect = 1.009e-7
Identity = 53/214 (24.77%), Postives = 93/214 (43.46%), Query Frame = 2
Query:  191 GKRRAFGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGS-VASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIF------FRKNLDLKEVSSTGKSKYSCQTYIRWKNIPLLILWFVDRVL 811
            G  ++FG F  +  ++Y   +    +WI     A  +++  L   +   ++ R  +    G L   +  I  SF  N   L+LT    +G G +L  +    ++  YFDK+     +A  L S G  + + +   +F  LI  ++W GAL I+G L   +C C  +         K L  +E +     KYS  T +R +++   +  +VD  L
Sbjct:   41 GVVKSFGVFYVEI-QQYFGTTAAGTSWITSIAVATIHVAAPLASALSSRYSHRSVVIA--GGLICSVGAILGSFGNNLVQLYLTVGFLNGFGYALTWTPTVTMLGMYFDKRRP---VANALASAGECILTFILTPMFQLLINSFSWRGALLIMGALQLNLCVCGLLLRPLKSTRDKELYTEESNQETSKKYS--TSLRERDLRTRVQQYVDYTL 246          
BLAST of slc16a-1 vs. Ensembl Medaka
Match: zgc:114041 (monocarboxylate transporter 13 [Source:NCBI gene;Acc:101160486])

HSP 1 Score: 53.5286 bits (127), Expect = 3.113e-7
Identity = 36/100 (36.00%), Postives = 53/100 (53.00%), Query Frame = 2
Query:  428 WLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGS-VASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKNLDLKEVSS 724
            WL+ +  +  GIG S    +A  VVN YF    R+  +A  + S G  V + +F   F +LI+ YTW GAL I+G L   +C C A+   + LD  E ++
Sbjct:  106 WLYFSMGILEGIGLSFSWVSAMSVVNHYF---ARWRPIAYAITSSGECVFAFIFSPFFKWLIEMYTWRGALLIIGGLQLNLCVCGALM--RPLDSTESTA 200          
BLAST of slc16a-1 vs. Ensembl Medaka
Match: slc16a13 (solute carrier family 16 member 13 [Source:NCBI gene;Acc:101164595])

HSP 1 Score: 53.5286 bits (127), Expect = 3.806e-7
Identity = 56/203 (27.59%), Postives = 89/203 (43.84%), Query Frame = 2
Query:  161 FAAVNVIFLGGKRRAFGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQ--FLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKNLDLKEVSSTGKSKYSCQTYIR 763
            F +++++F  G  R+ G F  +F  +Y   S   ++WI     A     + L+  +   FN R  +    FL  L ++++   +  V   H L+LT  L  G+G  LI +   +V     +  HR  +      S   ++S  F  LF  L++ Y W GAL ILG L   +  C A+  R     K +    KS  SC   +R
Sbjct:   31 FVSMSLVF--GLMRSLGIFFMEF-VQYFEESAQAISWISSIGLAAQQFFSPLSAALCNAFNARAVVMTGGFLAGLGLILASQATCLV---H-LYLTMGLISGLGWGLIFTP--MVATVIANFSHRRTLALGLGFSSIGLSSFAFNPLFQLLVETYAWRGALLILGGLSLNIVPCGAL-IRPQPRPKALQKESKSTLSCSDVLR 223          
BLAST of slc16a-1 vs. Ensembl Medaka
Match: slc16a13 (solute carrier family 16 member 13 [Source:NCBI gene;Acc:101164595])

HSP 1 Score: 53.5286 bits (127), Expect = 3.806e-7
Identity = 56/203 (27.59%), Postives = 89/203 (43.84%), Query Frame = 2
Query:  161 FAAVNVIFLGGKRRAFGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQ--FLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKNLDLKEVSSTGKSKYSCQTYIR 763
            F +++++F  G  R+ G F  +F  +Y   S   ++WI     A     + L+  +   FN R  +    FL  L ++++   +  V   H L+LT  L  G+G  LI +   +V     +  HR  +      S   ++S  F  LF  L++ Y W GAL ILG L   +  C A+  R     K +    KS  SC   +R
Sbjct:   31 FVSMSLVF--GLMRSLGIFFMEF-VQYFEESAQAISWISSIGLAAQQFFSPLSAALCNAFNARAVVMTGGFLAGLGLILASQATCLV---H-LYLTMGLISGLGWGLIFTP--MVATVIANFSHRRTLALGLGFSSIGLSSFAFNPLFQLLVETYAWRGALLILGGLSLNIVPCGAL-IRPQPRPKALQKESKSTLSCSDVLR 223          
BLAST of slc16a-1 vs. Ensembl Medaka
Match: slc16a3 (solute carrier family 16 member 3 [Source:NCBI gene;Acc:101173471])

HSP 1 Score: 53.1434 bits (126), Expect = 4.171e-7
Identity = 47/191 (24.61%), Postives = 83/191 (43.46%), Query Frame = 2
Query:  200 RAFGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQ-KYTWEGALQILGVLYFIVCGCAAIFFRKNLDLKEVSSTGKSKYSCQTYIRWK 769
            +A   F  +  KE+ ++  ++  WI     A  Y +  L   ++  F  R      +G L+  +  I SSF  N   ++LT  +  G+G +L    + +++N YF +K     LA  L + GS  ++  +     ++Q  Y W G   ILG +    C C A+  +  +D K+V     +K       + K
Sbjct:   40 KAVSVFFKELTKEF-DVGYSDTAWISSILLAMLYGTGPLCSILVNRFGCRP--VMMVGGLFASLGMILSSFATNIIHIYLTTGVITGLGLALNFQPSLIMLNRYFSEKRP---LANGLSAAGSPVALCCLSPLGQVLQYHYGWRGGFLILGGILLNCCVCGAL-MKPLVDPKKVKKQDHNKEQSPEEEKMK 223          
BLAST of slc16a-1 vs. Planmine SMEST
Match: SMESG000026518.1 (SMESG000026518.1)

HSP 1 Score: 892.108 bits (2304), Expect = 0.000e+0
Identity = 451/456 (98.90%), Postives = 454/456 (99.56%), Query Frame = 2
Query:   95 MVEFLSKLPCYKPSILMWLILGFAAVNVIFLGGKRRAFGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKNLDLKEVSSTGKSKYSCQTYIRWKNIPLLILWFVDRVLTSVVTYGILLNLTTHSYEKHYSLVDSSISTVLFASGEASTYLIGAIIMAITKDLFKERLRYVLLVTSFTMCASLILIYFFEANKTVLRSLLFVAGFSLGPSITFLFPAGEELTRLPGHVAYPFSLGGMGFGMMISPLLTAKIIELYNFQMFFLVQGGLIGIKFVCXXXXXXXXFFWQNKIDLLNRSISISNSKNYLENGLTDDETVSILKRSINGSY 1462
            MVEFLSKLPCYKPSILMWLILGFAAVNVIFLGGKRRAFGSFIAQF+KEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKN DLKEVSSTGKSKYSCQTYIRWKNIPLLILWFVDRVLTSVVTYG+LLNLTTHSYEKHYSLVDSSISTVLFASGEASTYLIGAIIMAITKDLFKERLRYVLLVTSFTMCASLILIYFFEANKTVLRSLLFVAGFSLGPSITFLFPAGEELTRLPGHVAYPFSLGGMGFGMMISPLLTAKII LYNFQMFFLVQGGLIGIKFVCLLLILIILFFWQNKIDLLNRSISISNSKNYLENGLTDDET+SILKRSINGSY
Sbjct:    1 MVEFLSKLPCYKPSILMWLILGFAAVNVIFLGGKRRAFGSFIAQFNKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKNPDLKEVSSTGKSKYSCQTYIRWKNIPLLILWFVDRVLTSVVTYGLLLNLTTHSYEKHYSLVDSSISTVLFASGEASTYLIGAIIMAITKDLFKERLRYVLLVTSFTMCASLILIYFFEANKTVLRSLLFVAGFSLGPSITFLFPAGEELTRLPGHVAYPFSLGGMGFGMMISPLLTAKIIVLYNFQMFFLVQGGLIGIKFVCLLLILIILFFWQNKIDLLNRSISISNSKNYLENGLTDDETISILKRSINGSY 456          
BLAST of slc16a-1 vs. Planmine SMEST
Match: SMESG000026516.1 (SMESG000026516.1)

HSP 1 Score: 579.711 bits (1493), Expect = 0.000e+0
Identity = 308/445 (69.21%), Postives = 355/445 (79.78%), Query Frame = 2
Query:  107 LSKLPCYKPSILMWLILGFAAVNVIFLGGKRRAFGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKNLDLKEVSSTGKSKYSCQTYIRWKNIPLLILWFVDRVLTSVVTYGILLNLTTHSYEKHYSLVDSSISTVLFASGEASTYLIGAIIMAITKDLFKERLRYVLLVTSFTMCASLILIYFFEANKTVLRSLLFVAGFSLGPSITFLFPAGEELTRLPGHVAYPFSLGGMGFGMMISPLLTAKIIELYNFQMFFLVQGGLIGIKFVCXXXXXXXXFFWQNKIDLLNRSISISNSKNYLENGLTDDETVSILK 1441
            L +LPCY+ S+L W+IL FAA+NVIFLGGKRRAFGSF+AQFHKEYPNISLTELNWIGDSYSA GYMSTSL+++IIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFV LFS LI+ Y W     ILG++YF+VC  AA FF+KN DLKE+SS GK     Q  I+   IPL+I WF DR++TSVVTYG+LLNLT + Y+ H  L+ SSI T++FASGEA TYLIG++I AITKD FKE+LRY+LLVTS +M   LI++ +     ++ R L F AGFSLGPSITFLFPAGEE TRLPGH+AYP SLGGMGFGM+ISPLLTAKIIEL +++ FF VQG  I  K  CLL+ +IIL F+  KI+   +              LTDDE   ++K
Sbjct:    6 LYRLPCYRASVLPWIILAFAAINVIFLGGKRRAFGSFVAQFHKEYPNISLTELNWIGDSYSAIGYMSTSLSISIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVTLFSKLIEHYGWRKTFIILGIIYFVVCSLAAFFFKKNKDLKEISSKGKMLCQGQWNIKSIQIPLIIFWFTDRIMTSVVTYGLLLNLTDYVYQGHKDLMKSSILTIIFASGEAVTYLIGSVITAITKDFFKEKLRYILLVTSLSMSICLIILEYTSHIVSIRRLLCFFAGFSLGPSITFLFPAGEEFTRLPGHLAYPVSLGGMGFGMIISPLLTAKIIELLDYRWFFFVQGCFILFKSSCLLVNIIILHFFIQKIEEPPQ--------------LTDDEKSPLVK 436          
BLAST of slc16a-1 vs. Planmine SMEST
Match: SMESG000026519.1 (SMESG000026519.1)

HSP 1 Score: 531.561 bits (1368), Expect = 0.000e+0
Identity = 268/418 (64.11%), Postives = 332/418 (79.43%), Query Frame = 2
Query:   95 MVEFLSKLPCYKPSILMWLILGFAAVNVIFLGGKRRAFGSFIAQFHKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKNLDLKEVSSTGKSKYSCQTYIRWKNIPLLILWFVDRVLTSVVTYGILLNLTTHSYEKHYSLVDSSISTVLFASGEASTYLIGAIIMAITKDLFKERLRYVLLVTSFTMCASLILIYFFEANKTVLRSLLFVAGFSLGPSITFLFPAGEELTRLPGHVAYPFSLGGMGFGMMISPLLTAKIIELYNFQMFFLVQGGLIGIKFVCXXXXXXXXFFWQNK 1348
            M   +SKLP  + S+L W+IL FAA+NVIFLGGKRRAFGSF+A+  ++YPNI+LTELNWIGDSY+A GYM++ +++ II++F RRYG+FQF+GA+WVL+SC+TSSFVPNPHWLFLTHTLFHGIGSSLIIST GLVVN++FD KH YHILATTLVSGGSVASI+FV LF+ LIQ Y W  A  ILG LYFIV   AA+FFRK+ +  E ++       C+ +I+  +IPLL LWF+DRV+TSVVTYG+LLNLT + Y    +LV S+  T LFASGEA TYLIGA I AIT+D FK++LRY+LL TSF M   LI + +F+   +V   L F+AGF+LGPSITFLFPAGEELTRLPGH+AYP SL GMGFGM++SPLLTAKI E++ ++ FF VQG LI IK   +L I++IL F+ +K
Sbjct:    1 MTNLVSKLPWNRASVLPWVILFFAALNVIFLGGKRRAFGSFVAEMRRDYPNITLTELNWIGDSYAAVGYMTSGISIAIILFFKRRYGMFQFMGAIWVLVSCVTSSFVPNPHWLFLTHTLFHGIGSSLIISTVGLVVNDHFDSKHPYHILATTLVSGGSVASIIFVTLFASLIQSYGWRYAFIILGCLYFIVNASAALFFRKSNNQVEDTNKKTVSCRCEGHIKIIHIPLLCLWFIDRVMTSVVTYGLLLNLTDYMYRTEKNLVRSTTLTTLFASGEAITYLIGATITAITRDFFKDKLRYILLGTSFAMSICLIALEYFKGIISVCYILCFLAGFTLGPSITFLFPAGEELTRLPGHMAYPISLAGMGFGMLVSPLLTAKIAEIFLYKWFFFVQGCLILIKVASILAIILILHFYDDK 418          
BLAST of slc16a-1 vs. Planmine SMEST
Match: SMESG000026692.1 (SMESG000026692.1)

HSP 1 Score: 449.129 bits (1154), Expect = 2.452e-154
Identity = 227/389 (58.35%), Postives = 289/389 (74.29%), Query Frame = 2
Query:  146 WLILGFAAVNVIFLGGKRRAFGSFIAQFHK-EYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAA-IFFRKNLDLKEVSSTGKSKYSCQTYIRWKNIPLLILWFVDRVLTSVVTYGILLNLTTHSYEKHYSLVDSSISTVLFASGEASTYLIGAIIMAITKDLFKERLRYVLLVTSFTMCASLILIYFFEANKTVLRSLLFVAGFSLGPSITFLFPAGEELTRLPGHVAYPFSLGGMGFGMMISPLLTAKIIELYNFQMFFLVQGGLIGIKFVC 1306
            +L+LGF+A+NVIFLGGKRRAFG F+A  H  E+ + SL ELNWIGDSY+A GY+ST+L+  +I+  NRRY LFQF+GA  +L++C+TS+ VPN HWLFLTHT+ HG GSSLI+ST GL+VNEYFDK H  HILATTLVSGGSVASI+FV  +++LI  Y W  A  ILG++YF+V   A  +F RK  +  E   + KS  +    I+   IPLLI W +DR++TS+VTYG+LLNL  +       L +S+  TVLFA+GEASTYLIG II  +TK  F  RL+Y+LLV++F M  SL+   F  +NK + R L FV+GF LGPSITFLFPAGEE+T LPGH+AYPFSL GMG GM +SP+LTA I +++++  FFL+QGGLI IKF C
Sbjct:   18 YLVLGFSALNVIFLGGKRRAFGIFVADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNKSEEGLSKKSSVNVCRDIKSSQIPLLIFWTIDRIMTSIVTYGMLLNLADYMRRSESKLTNSTSLTVLFAAGEASTYLIGTIITGLTKKFFHNRLKYILLVSTFLMAVSLVYWEFVSSNKHLSRLLAFVSGFCLGPSITFLFPAGEEMTTLPGHMAYPFSLFGMGIGMAVSPILTALIAQIFDYNWFFLIQGGLIFIKFGC 406          
BLAST of slc16a-1 vs. Planmine SMEST
Match: SMESG000070297.1 (SMESG000070297.1)

HSP 1 Score: 441.425 bits (1134), Expect = 1.910e-151
Identity = 225/388 (57.99%), Postives = 295/388 (76.03%), Query Frame = 2
Query:  128 KPSILMWLILGFAAVNVIFLGGKRRAFGSFIAQFHK-EYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKNLDLKEVSSTGKSKYSCQTYIRWKNIPLLILWFVDRVLTSVVTYGILLNLTTHSYEKHYSLVDSSISTVLFASGEASTYLIGAIIMAITKDLFKERLRYVLLVTSFTMCASLILIYFFEANKTVLRSLLFVAGFSLGPSITFLFPAGEELTRLPGHVAYPFSLGGMGFGMMISPLLTAKIIELYNFQMFFLVQGGLI 1288
            K   L W+IL FAA+NVIFLGGKRRAFG F+A+FH  E+ NISL ELNWIGDSY+A GY++T+++ T+I+  +RR+ LFQF+GA +VL++CITS+ V N HWLFLTHT+FHGIGSSLI+ST GLVVNE+F K H+YH+LATTLVSGGS+ASI+FV  ++FLI+ + W  A  ILGV+YFI+    +  F++N+D+       +   +   +I  K+ PLLI W +DR++T++VTYG+LLNL  +     ++L  S+  TVLFASGEASTYLIGA+I A+TKD FK RL+Y+LLV +  M  SLI+  FF  NK++   L F +GF LGPSITFLFPAGEE+T LPGH+AYPFSLGGMG GM++SP L+A I   + ++ FFL+QG LI
Sbjct:   12 KTKFLSWIILFFAAINVIFLGGKRRAFGIFVAEFHHGEFRNISLAELNWIGDSYAALGYLTTTISTTLILNCDRRFKLFQFIGACFVLLACITSAMVTNAHWLFLTHTVFHGIGSSLILSTIGLVVNEHFGKTHKYHLLATTLVSGGSIASIVFVQFYAFLIEHFGWRTAFIILGVIYFIINCSGSCIFQRNMDISTSYKPNRCSLNWDEHITKKHFPLLIFWTLDRIITTIVTYGMLLNLADYLRRSEHTLTSSTSLTVLFASGEASTYLIGAVITAVTKDFFKNRLKYILLVCTGFMSFSLIVWEFFVLNKSLTHFLAFSSGFFLGPSITFLFPAGEEMTLLPGHLAYPFSLGGMGIGMLLSPTLSAVIASAFEYRGFFLIQGCLI 399          
The following BLAST results are available for this feature:
BLAST of slc16a-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SLC16A121.593e-824.63solute carrier family 16 member 12 [Source:HGNC Sy... [more]
SLC16A43.559e-728.65solute carrier family 16 member 4 [Source:HGNC Sym... [more]
SLC16A41.515e-627.44solute carrier family 16 member 4 [Source:HGNC Sym... [more]
back to top
BLAST of slc16a-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Sln3.794e-626.50gene:FBgn0033657 transcript:FBtr0088032[more]
back to top
BLAST of slc16a-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc16a131.268e-725.16solute carrier family 16 member 13 [Source:ZFIN;Ac... [more]
CR352261.21.800e-725.63solute carrier family 16 member 13 [Source:NCBI ge... [more]
back to top
BLAST of slc16a-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc16a121.267e-625.58solute carrier family 16 member 12 [Source:NCBI ge... [more]
back to top
BLAST of slc16a-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Slc16a42.362e-728.02solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a42.414e-728.02solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a128.906e-622.50solute carrier family 16 (monocarboxylic acid tran... [more]
back to top
BLAST of slc16a-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6ZSM3|MOT12_HUMAN7.648e-824.63Monocarboxylate transporter 12 OS=Homo sapiens OX=... [more]
sp|Q8R0M8|MOT5_MOUSE1.652e-628.02Monocarboxylate transporter 5 OS=Mus musculus OX=1... [more]
sp|O15374|MOT5_HUMAN1.709e-628.65Monocarboxylate transporter 5 OS=Homo sapiens OX=9... [more]
sp|Q90632|MOT3_CHICK7.491e-624.19Monocarboxylate transporter 3 OS=Gallus gallus OX=... [more]
sp|Q6GM59|MOT12_XENLA9.070e-625.58Monocarboxylate transporter 12 OS=Xenopus laevis O... [more]
back to top
BLAST of slc16a-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YIZ40.000e+096.90Slc16a-1 (Fragment) OS=Schmidtea mediterranea OX=7... [more]
A0A0H3YF920.000e+064.11Slc16a-2 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A3S5B7D02.266e-15859.17MFS domain-containing protein (Fragment) OS=Protop... [more]
A0A267GLF38.630e-15357.68MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A5J4NSI41.348e-15257.88MFS domain-containing protein OS=Paragonimus weste... [more]
back to top
BLAST of slc16a-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1140412.402e-725.32monocarboxylate transporter 13-like [Source:NCBI g... [more]
zgc:1140412.402e-725.32monocarboxylate transporter 13-like [Source:NCBI g... [more]
zgc:1140412.402e-725.32monocarboxylate transporter 13-like [Source:NCBI g... [more]
si:dkey-246g23.43.589e-725.00monocarboxylate transporter 2-like [Source:NCBI ge... [more]
si:dkey-246g23.43.809e-725.00monocarboxylate transporter 2-like [Source:NCBI ge... [more]
back to top
BLAST of slc16a-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000001631.15.817e-929.21pep scaffold:Pmarinus_7.0:GL477961:12469:26731:1 g... [more]
SLC16A121.387e-627.16solute carrier family 16 member 12 [Source:HGNC Sy... [more]
SLC16A121.808e-635.71solute carrier family 16 member 12 [Source:HGNC Sy... [more]
back to top
BLAST of slc16a-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO462071.990e-825.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467099.115e-823.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466661.544e-725.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486153.394e-722.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405853.426e-730.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc16a-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-246g23.41.009e-724.77monocarboxylate transporter 2 [Source:NCBI gene;Ac... [more]
zgc:1140413.113e-736.00monocarboxylate transporter 13 [Source:NCBI gene;A... [more]
slc16a133.806e-727.59solute carrier family 16 member 13 [Source:NCBI ge... [more]
slc16a133.806e-727.59solute carrier family 16 member 13 [Source:NCBI ge... [more]
slc16a34.171e-724.61solute carrier family 16 member 3 [Source:NCBI gen... [more]
back to top
BLAST of slc16a-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026518.10.000e+098.90SMESG000026518.1[more]
SMESG000026516.10.000e+069.21SMESG000026516.1[more]
SMESG000026519.10.000e+064.11SMESG000026519.1[more]
SMESG000026692.12.452e-15458.35SMESG000026692.1[more]
SMESG000070297.11.910e-15157.99SMESG000070297.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30014065
GenBankAKN21496.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014065 ID=SMED30014065|Name=slc16a-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1570bp
TTAAAACTGATAAACCACTGATTGGGTCATAAGTACGAGTGTAATTAATT
ATTATTTATTAATAATTATTGCACAAATTTGACAACCGTTCAACATGGTG
GAATTTCTATCAAAATTACCTTGCTACAAACCGTCAATTTTGATGTGGTT
AATTCTTGGATTCGCTGCAGTAAATGTCATTTTCCTCGGCGGAAAACGGA
GAGCATTCGGAAGTTTCATTGCGCAGTTTCATAAAGAATATCCGAATATT
TCATTAACAGAATTGAACTGGATCGGCGATTCTTATTCTGCGTTTGGCTA
TATGAGCACCAGCTTGACAGTAACTATCATTATATACTTCAATCGCCGAT
ATGGCTTATTTCAATTTCTTGGAGCGCTTTGGGTTTTGATTTCCTGCATT
ACTAGCTCGTTTGTTCCCAATCCTCATTGGTTGTTCCTAACGCATACTTT
GTTCCATGGAATCGGGTCGAGTTTGATCATCAGTACCGCAGGGTTAGTGG
TGAATGAATATTTCGACAAGAAACATCGCTATCATATATTGGCAACGACG
CTCGTGTCTGGCGGATCGGTGGCATCTATATTATTTGTAATGCTATTCAG
CTTCCTAATACAGAAATACACTTGGGAAGGAGCATTGCAAATCCTAGGCG
TGTTATATTTCATTGTATGCGGTTGTGCAGCAATTTTCTTTCGAAAGAAT
CTAGATTTGAAAGAGGTCTCAAGTACAGGAAAATCGAAATATTCATGCCA
GACCTACATCAGGTGGAAGAACATACCTCTACTGATTCTCTGGTTTGTTG
ATCGTGTCTTGACGAGTGTGGTCACATACGGAATATTGCTAAATCTAACG
ACGCATTCATATGAAAAGCATTACAGTTTAGTTGATAGTTCTATTAGTAC
AGTTTTATTTGCGTCTGGTGAGGCATCTACGTATCTAATTGGAGCCATAA
TAATGGCTATTACAAAGGACTTATTTAAGGAAAGATTAAGATACGTTCTT
CTCGTAACATCTTTTACTATGTGTGCTTCATTAATTTTAATCTATTTCTT
TGAAGCAAACAAAACTGTGTTGCGAAGTTTATTATTTGTCGCAGGATTTA
GTCTAGGTCCATCTATAACATTTCTTTTTCCCGCTGGAGAGGAATTGACG
AGGCTCCCAGGTCACGTAGCATACCCTTTCAGTCTGGGAGGAATGGGATT
CGGAATGATGATCTCACCATTACTAACTGCAAAAATCATTGAGTTATATA
ATTTTCAAATGTTCTTCCTAGTGCAGGGCGGTTTGATAGGCATTAAATTT
GTATGCCTTCTTCTAATTTTGATTATTTTATTCTTCTGGCAGAATAAAAT
TGACCTGTTAAACAGATCCATCAGTATTTCTAATAGTAAAAACTACCTAG
AAAACGGACTGACGGATGATGAAACCGTATCAATTTTGAAGAGATCTATA
AATGGAAGCTATTGAAACTATATATACATGAAACTTCGGATTTAAACATT
TTTTCGTATTACAGTTAATTTTATTATCATGAGGCATTATTATTATTAAT
ATTAGTGTTACTGAAAAAAA
back to top

protein sequence of SMED30014065-orf-1

>SMED30014065-orf-1 ID=SMED30014065-orf-1|Name=SMED30014065-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=457bp
MVEFLSKLPCYKPSILMWLILGFAAVNVIFLGGKRRAFGSFIAQFHKEYP
NISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLIS
CITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILA
TTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFR
KNLDLKEVSSTGKSKYSCQTYIRWKNIPLLILWFVDRVLTSVVTYGILLN
LTTHSYEKHYSLVDSSISTVLFASGEASTYLIGAIIMAITKDLFKERLRY
VLLVTSFTMCASLILIYFFEANKTVLRSLLFVAGFSLGPSITFLFPAGEE
LTRLPGHVAYPFSLGGMGFGMMISPLLTAKIIELYNFQMFFLVQGGLIGI
KFVCLLLILIILFFWQNKIDLLNRSISISNSKNYLENGLTDDETVSILKR
SINGSY*
back to top
Aliases
The feature 'slc16a-1' has the following synonyms
Synonym
slc16a-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 14..211
e-value: 7.7E-13
score: 50.2
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 224..414
e-value: 3.2E-6
score: 28.5
NoneNo IPR availablePANTHERPTHR11360MONOCARBOXYLATE TRANSPORTERcoord: 18..409
NoneNo IPR availableCDDcd17352MFS_MCT_SLC16coord: 18..404
e-value: 1.50097E-14
score: 72.5852
NoneNo IPR availableTMHMMTMhelixcoord: 266..288
NoneNo IPR availableTMHMMTMhelixcoord: 329..348
NoneNo IPR availableTMHMMTMhelixcoord: 15..32
NoneNo IPR availableTMHMMTMhelixcoord: 393..415
NoneNo IPR availableTMHMMTMhelixcoord: 361..383
NoneNo IPR availableTMHMMTMhelixcoord: 148..170
NoneNo IPR availableTMHMMTMhelixcoord: 300..319
NoneNo IPR availableTMHMMTMhelixcoord: 86..108
NoneNo IPR availableTMHMMTMhelixcoord: 229..251
NoneNo IPR availableTMHMMTMhelixcoord: 180..199
NoneNo IPR availableTMHMMTMhelixcoord: 113..135
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 34..344
e-value: 1.5E-17
score: 63.6
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 20..419
score: 10.484
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 11..409