Protein disulfide-isomerase

Overview
NameProtein disulfide-isomerase
Smed IDSMED30014062
Length (bp)1591
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein disulfide-isomerase (SMED30014062) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein disulfide-isomerase (SMED30014062) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein disulfide-isomerase (SMED30014062) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein disulfide-isomerase (SMED30014062) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014062

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30014062SMESG000078546.1 dd_Smed_v4_6303_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014062SMESG000078546.1 dd_Smed_v4_6303_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30014062SMESG000078546.1 dd_Smed_v4_6303_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30014062SMESG000078546.1 dd_Smed_v4_6303_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30014062SMESG000078546.1 dd_Smed_v6_6303_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30014062SMESG000078546.1 OX_Smed_1.0.01947ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein disulfide-isomerase vs. Ensembl Human
Match: P4HB (prolyl 4-hydroxylase subunit beta [Source:HGNC Symbol;Acc:HGNC:8548])

HSP 1 Score: 155.992 bits (393), Expect = 1.507e-50
Identity = 96/316 (30.38%), Postives = 165/316 (52.22%), Query Frame = 1
Query:  532 DDIKDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQYDFGIQHTVSGKLTRNIMNDFIIKHHVPIYSEFSDFIFSKSFVG----HYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENE--GFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNER-IKFHGERTIENLKKFIESNGQ 1458
            D  K F   A   DD+ F +  ++++  ++ L   +  +   ++D G ++   G++T+  + DFI  + +P+  EF++    K F G    H   F+P     +   L+  K      A+   GK +FI  D      QR LE   + + E    R++   E +  +KPE+   L    +  F  + ++G  +P LM+ E  E+W  +P+K L  K ++ V  D+ KNVFV  YAP C + +++  + DKLGE YKD EN+++AK+DS+ +E+  ++V S P +  +    +   I ++GERT++  KKF+ES GQ
Sbjct:  167 DSAKQFLQAAEAIDDIPFGITSNSDVFSKYQL-DKDGVVLFKKFDEG-RNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKT----AAESFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESE-ELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQ 475          

HSP 2 Score: 65.0846 bits (157), Expect = 1.507e-50
Identity = 41/126 (32.54%), Postives = 59/126 (46.83%), Query Frame = 2
Query:  113 EEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNK-TGVQYLRTQGKE--EVIQWLTDRVNYELKPISTLDDG 481
            EE+DH L+L   N+  A   ++Y+LV FY P C  C      +  AA   K     ++ A VDA  E  +A    +   P +KF+RN  T      T G+E  +++ WL  R        +TL DG
Sbjct:   21 EEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTG---PAATTLPDG 143          
BLAST of Protein disulfide-isomerase vs. Ensembl Human
Match: P4HB (prolyl 4-hydroxylase subunit beta [Source:HGNC Symbol;Acc:HGNC:8548])

HSP 1 Score: 155.606 bits (392), Expect = 3.636e-41
Identity = 96/316 (30.38%), Postives = 165/316 (52.22%), Query Frame = 1
Query:  532 DDIKDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQYDFGIQHTVSGKLTRNIMNDFIIKHHVPIYSEFSDFIFSKSFVG----HYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENE--GFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNER-IKFHGERTIENLKKFIESNGQ 1458
            D  K F   A   DD+ F +  ++++  ++ L   +  +   ++D G ++   G++T+  + DFI  + +P+  EF++    K F G    H   F+P     +   L+  K      A+   GK +FI  D      QR LE   + + E    R++   E +  +KPE+   L    +  F  + ++G  +P LM+ E  E+W  +P+K L  K ++ V  D+ KNVFV  YAP C + +++  + DKLGE YKD EN+++AK+DS+ +E+  ++V S P +  +    +   I ++GERT++  KKF+ES GQ
Sbjct:  123 DSAKQFLQAAEAIDDIPFGITSNSDVFSKYQL-DKDGVVLFKKFDEG-RNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKT----AAESFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESE-ELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQ 431          

HSP 2 Score: 56.6102 bits (135), Expect = 6.605e-8
Identity = 30/87 (34.48%), Postives = 43/87 (49.43%), Query Frame = 2
Query:  113 EEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRN 373
            EE+DH L+L   N+  A   ++Y+LV FY P C  C      +  AA   K     ++ A VDA  E  +A    +   P +KF+RN
Sbjct:   21 EEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRN 107          
BLAST of Protein disulfide-isomerase vs. Ensembl Human
Match: P4HB (prolyl 4-hydroxylase subunit beta [Source:HGNC Symbol;Acc:HGNC:8548])

HSP 1 Score: 137.887 bits (346), Expect = 2.135e-36
Identity = 81/259 (31.27%), Postives = 135/259 (52.12%), Query Frame = 1
Query:  691 GKLTRNIMNDFIIKHHVPIYSEFSDFIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENE--GFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNER-IKFHGERTIENLKKFIESNGQ 1458
            G++T+  + DFI  + +P+  EF++   S  + G    F                   +  A+   GK +FI  D      QR LE   + + E    R++   E +  +KPE+   L    +  F  + ++G  +P LM+ E  E+W  +P+K L  K ++ V  D+ KNVFV  YAP C + +++  + DKLGE YKD EN+++AK+DS+ +E+  ++V S P +  +    +   I ++GERT++  KKF+ES GQ
Sbjct:    4 GEVTKENLLDFIKHNQLPLVIEFTEQSVS-DYDGKLSNF-------------------KTAAESFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESE-ELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQ 241          
BLAST of Protein disulfide-isomerase vs. Ensembl Human
Match: PDIA2 (protein disulfide isomerase family A member 2 [Source:HGNC Symbol;Acc:HGNC:14180])

HSP 1 Score: 110.923 bits (276), Expect = 1.749e-31
Identity = 81/324 (25.00%), Postives = 153/324 (47.22%), Query Frame = 1
Query:  532 DDIKDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQ------YDFGIQHTVS---GKLTRNIMNDFIIKHHVPIYSEF----SDFIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENEG--FRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNER-IKFHGERTIENLKKFIESNG 1455
            +D+  F  +A    D+ F L     L Q+F L  T++++ +++       DF +   +    G L+R     F++ H + + +EF    S  IF+   + H   FV     +      E+ A   + A    G+ +F+  D++    +  L++  +        R+V + E    + P +   +    + +F   V++G  +P L++ E   +W   P+K L  K ++QV  D+TKNVFV  YAP C + +EM    + L E Y+D E++++A+LD++ +EL    V   P +  +      + I++   R +E   KF+++ G
Sbjct:  185 EDVATFLALAQDALDMTFGLTDRPRLFQQFGL--TKDTVVLFKKFDEGRADFPVDEELGLDLGDLSR-----FLVTHSMRLVTEFNSQTSAKIFAARILNHLLLFVNQTLAAH----RELLAGFGEAAPRFRGQVLFVVVDVAADN-EHVLQYFGLKAEAAPTLRLV-NLETTKKYAPVDGGPVTAASITAFCHAVLNGQVKPYLLSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTHCKEMAPAWEALAEKYQDHEDIIIAELDATANELDAFAVHGFPTLKYFPAGPGRKVIEYKSTRDLETFSKFLDNGG 495          

HSP 2 Score: 46.2098 bits (108), Expect = 1.749e-31
Identity = 37/137 (27.01%), Postives = 57/137 (41.61%), Query Frame = 2
Query:  122 DHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQC-TLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNKTGV---QYLRTQGKEEVIQWLTDRVNYELKPISTLDDGKNTLLNNLLVVFG 520
            D  L+L+      A + +  +LV FY P C  C  L+ E    AA  A E+   V  A VD   ++ +A    +   P +KF+RN       +Y   +  E + +WL  RV      +      +  +    LVV G
Sbjct:   42 DGILVLSRHTLGLALREHPALLVEFYAPWCGHCQALAPEYSKAAAVLAAES-MVVTLAKVDGPAQRELAEEFGVTEYPTLKFFRNGNRTHPEEYTGPRDAEGIAEWLRRRVGPSAMRLEDEAAAQALIGGRDLVVIG 177          
BLAST of Protein disulfide-isomerase vs. Ensembl Human
Match: PDIA2 (protein disulfide isomerase family A member 2 [Source:HGNC Symbol;Acc:HGNC:14180])

HSP 1 Score: 110.538 bits (275), Expect = 1.779e-31
Identity = 81/324 (25.00%), Postives = 153/324 (47.22%), Query Frame = 1
Query:  532 DDIKDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQ------YDFGIQHTVS---GKLTRNIMNDFIIKHHVPIYSEF----SDFIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENEG--FRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNER-IKFHGERTIENLKKFIESNG 1455
            +D+  F  +A    D+ F L     L Q+F L  T++++ +++       DF +   +    G L+R     F++ H + + +EF    S  IF+   + H   FV     +      E+ A   + A    G+ +F+  D++    +  L++  +        R+V + E    + P +   +    + +F   V++G  +P L++ E   +W   P+K L  K ++QV  D+TKNVFV  YAP C + +EM    + L E Y+D E++++A+LD++ +EL    V   P +  +      + I++   R +E   KF+++ G
Sbjct:  182 EDVATFLALAQDALDMTFGLTDRPRLFQQFGL--TKDTVVLFKKFDEGRADFPVDEELGLDLGDLSR-----FLVTHSMRLVTEFNSQTSAKIFAARILNHLLLFVNQTLAAH----RELLAGFGEAAPRFRGQVLFVVVDVAADN-EHVLQYFGLKAEAAPTLRLV-NLETTKKYAPVDGGPVTAASITAFCHAVLNGQVKPYLLSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTHCKEMAPAWEALAEKYQDHEDIIIAELDATANELDAFAVHGFPTLKYFPAGPGRKVIEYKSTRDLETFSKFLDNGG 492          

HSP 2 Score: 46.2098 bits (108), Expect = 1.779e-31
Identity = 37/137 (27.01%), Postives = 57/137 (41.61%), Query Frame = 2
Query:  122 DHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQC-TLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNKTGV---QYLRTQGKEEVIQWLTDRVNYELKPISTLDDGKNTLLNNLLVVFG 520
            D  L+L+      A + +  +LV FY P C  C  L+ E    AA  A E+   V  A VD   ++ +A    +   P +KF+RN       +Y   +  E + +WL  RV      +      +  +    LVV G
Sbjct:   42 DGILVLSRHTLGLALREHPALLVEFYAPWCGHCQALAPEYSKAAAVLAAES-MVVTLAKVDGPAQRELAEEFGVTEYPTLKFFRNGNRTHPEEYTGPRDAEGIAEWLRRRVGPSAMRLEDEAAAQALIGGRDLVVIG 177          
BLAST of Protein disulfide-isomerase vs. Ensembl Celegans
Match: pdi-2 (Protein disulfide-isomerase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q17770])

HSP 1 Score: 151.754 bits (382), Expect = 7.630e-51
Identity = 92/317 (29.02%), Postives = 168/317 (53.00%), Query Frame = 1
Query:  532 DDIKDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQYDFGIQHTVSGKLTRNIMNDFIIKHHVPIYSEF----SDFIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENE--GFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIKFHGERTIENLKKFIESNGQDG 1464
            DD K F  VA+  DDV F +  +  +     L   E  +   ++D G +     KLT++ +  +I  + + + SEF    +  IF      H   FV      F     +++ E +  AK+  GK +F++ +   ++  R +E   + ++E    R++   E +  FKP+    +    +  F +  +DG+ +P LM+ +  E+W   P+K L  K ++QV  D TKNV V  YAP C + +++    DKLGE + DDE++++AK+DS+++E+  ++++S P +  +   +N+ + + G+RTIE   KF+E+NG++G
Sbjct:  163 DDAKTFLEVAAGIDDVPFGISTEDAVKSEIELKG-EGIVLFKKFDDG-RVAFDEKLTQDGLKTWIQANRLALVSEFTQETASVIFGGEIKSHNLLFVSKESSEFA----KLEQEFKNAAKQFKGKVLFVYINTDVEENARIMEFFGLKKDELPAIRLISLEEDMTKFKPDFE-EITTENISKFTQNYLDGSVKPHLMSEDIPEDWDKNPVKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDESIVIAKMDSTLNEVEDVKIQSFPTIKFFPAGSNKVVDYTGDRTIEGFTKFLETNGKEG 472          

HSP 2 Score: 68.5514 bits (166), Expect = 7.630e-51
Identity = 41/151 (27.15%), Postives = 69/151 (45.70%), Query Frame = 2
Query:   68 LSLSFYCNGDEIPIIEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNKTGVQYLRTQGKEEVIQWLTDRVNYELKPISTLDDGKNTLLNNLLVVFG 520
            + L F   G    +IEE+++ ++LT  N+D      E+ILV FY P C  C      +  AA   KE    +K   +DA     +++  ++   P +K +RN    +Y   +  + +I WL  +     KP++  D  K    +  +VV G
Sbjct:    5 VGLFFLVLGASAAVIEEEENVIVLTKDNFDEVINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRGYPTLKLFRNGKPQEYNGGRDHDSIIAWLKKKTGPVAKPLADADAVKELQESADVVVIG 155          
BLAST of Protein disulfide-isomerase vs. Ensembl Celegans
Match: pdi-2 (Protein disulfide-isomerase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q17770])

HSP 1 Score: 151.754 bits (382), Expect = 7.630e-51
Identity = 92/317 (29.02%), Postives = 168/317 (53.00%), Query Frame = 1
Query:  532 DDIKDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQYDFGIQHTVSGKLTRNIMNDFIIKHHVPIYSEF----SDFIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENE--GFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIKFHGERTIENLKKFIESNGQDG 1464
            DD K F  VA+  DDV F +  +  +     L   E  +   ++D G +     KLT++ +  +I  + + + SEF    +  IF      H   FV      F     +++ E +  AK+  GK +F++ +   ++  R +E   + ++E    R++   E +  FKP+    +    +  F +  +DG+ +P LM+ +  E+W   P+K L  K ++QV  D TKNV V  YAP C + +++    DKLGE + DDE++++AK+DS+++E+  ++++S P +  +   +N+ + + G+RTIE   KF+E+NG++G
Sbjct:  163 DDAKTFLEVAAGIDDVPFGISTEDAVKSEIELKG-EGIVLFKKFDDG-RVAFDEKLTQDGLKTWIQANRLALVSEFTQETASVIFGGEIKSHNLLFVSKESSEFA----KLEQEFKNAAKQFKGKVLFVYINTDVEENARIMEFFGLKKDELPAIRLISLEEDMTKFKPDFE-EITTENISKFTQNYLDGSVKPHLMSEDIPEDWDKNPVKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDESIVIAKMDSTLNEVEDVKIQSFPTIKFFPAGSNKVVDYTGDRTIEGFTKFLETNGKEG 472          

HSP 2 Score: 68.5514 bits (166), Expect = 7.630e-51
Identity = 41/151 (27.15%), Postives = 69/151 (45.70%), Query Frame = 2
Query:   68 LSLSFYCNGDEIPIIEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNKTGVQYLRTQGKEEVIQWLTDRVNYELKPISTLDDGKNTLLNNLLVVFG 520
            + L F   G    +IEE+++ ++LT  N+D      E+ILV FY P C  C      +  AA   KE    +K   +DA     +++  ++   P +K +RN    +Y   +  + +I WL  +     KP++  D  K    +  +VV G
Sbjct:    5 VGLFFLVLGASAAVIEEEENVIVLTKDNFDEVINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRGYPTLKLFRNGKPQEYNGGRDHDSIIAWLKKKTGPVAKPLADADAVKELQESADVVVIG 155          
BLAST of Protein disulfide-isomerase vs. Ensembl Celegans
Match: pdi-2 (Protein disulfide-isomerase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q17770])

HSP 1 Score: 141.354 bits (355), Expect = 1.134e-36
Identity = 76/261 (29.12%), Postives = 142/261 (54.41%), Query Frame = 1
Query:  700 TRNIMNDFIIKHHVPIYSEF----SDFIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENE--GFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIKFHGERTIENLKKFIESNGQDG 1464
            T +    +I  + + + SEF    +  IF      H   FV      F     +++ E +  AK+  GK +F++ +   ++  R +E   + ++E    R++   E +  FKP+    +    +  F +  +DG+ +P LM+ +  E+W   P+K L  K ++QV  D TKNV V  YAP C + +++    DKLGE + DDE++++AK+DS+++E+  ++++S P +  +   +N+ + + G+RTIE   KF+E+NG++G
Sbjct:  161 TSDDAKTWIQANRLALVSEFTQETASVIFGGEIKSHNLLFVSKESSEFA----KLEQEFKNAAKQFKGKVLFVYINTDVEENARIMEFFGLKKDELPAIRLISLEEDMTKFKPDFE-EITTENISKFTQNYLDGSVKPHLMSEDIPEDWDKNPVKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDESIVIAKMDSTLNEVEDVKIQSFPTIKFFPAGSNKVVDYTGDRTIEGFTKFLETNGKEG 416          

HSP 2 Score: 71.2478 bits (173), Expect = 4.937e-13
Identity = 51/192 (26.56%), Postives = 86/192 (44.79%), Query Frame = 2
Query:   68 LSLSFYCNGDEIPIIEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNKTGVQYLRTQGKEEVIQWLTDRVNYELKPISTLDDGKNTLLNNLLVVFGCIL*MILRTLKSW-PVCMMMLNSDC*KTQNSASVLTFQQLK 640
            + L F   G    +IEE+++ ++LT  N+D      E+ILV FY P C  C      +  AA   KE    +K   +DA     +++  ++   P +K +RN    +Y   +  + +I WL  +     KP++  D  K    +  +VV G          K+W     + L S+   TQ +ASV+   ++K
Sbjct:    5 VGLFFLVLGASAAVIEEEENVIVLTKDNFDEVINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRGYPTLKLFRNGKPQEYNGGRDHDSIIAWLKKKTGPVAKPLADADAVKELQESADVVVIGYFKDTTSDDAKTWIQANRLALVSEF--TQETASVIFGGEIK 194          
BLAST of Protein disulfide-isomerase vs. Ensembl Celegans
Match: pdi-2 (Protein disulfide-isomerase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q17770])

HSP 1 Score: 141.354 bits (355), Expect = 1.134e-36
Identity = 76/261 (29.12%), Postives = 142/261 (54.41%), Query Frame = 1
Query:  700 TRNIMNDFIIKHHVPIYSEF----SDFIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENE--GFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIKFHGERTIENLKKFIESNGQDG 1464
            T +    +I  + + + SEF    +  IF      H   FV      F     +++ E +  AK+  GK +F++ +   ++  R +E   + ++E    R++   E +  FKP+    +    +  F +  +DG+ +P LM+ +  E+W   P+K L  K ++QV  D TKNV V  YAP C + +++    DKLGE + DDE++++AK+DS+++E+  ++++S P +  +   +N+ + + G+RTIE   KF+E+NG++G
Sbjct:  161 TSDDAKTWIQANRLALVSEFTQETASVIFGGEIKSHNLLFVSKESSEFA----KLEQEFKNAAKQFKGKVLFVYINTDVEENARIMEFFGLKKDELPAIRLISLEEDMTKFKPDFE-EITTENISKFTQNYLDGSVKPHLMSEDIPEDWDKNPVKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDESIVIAKMDSTLNEVEDVKIQSFPTIKFFPAGSNKVVDYTGDRTIEGFTKFLETNGKEG 416          

HSP 2 Score: 71.2478 bits (173), Expect = 4.937e-13
Identity = 51/192 (26.56%), Postives = 86/192 (44.79%), Query Frame = 2
Query:   68 LSLSFYCNGDEIPIIEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNKTGVQYLRTQGKEEVIQWLTDRVNYELKPISTLDDGKNTLLNNLLVVFGCIL*MILRTLKSW-PVCMMMLNSDC*KTQNSASVLTFQQLK 640
            + L F   G    +IEE+++ ++LT  N+D      E+ILV FY P C  C      +  AA   KE    +K   +DA     +++  ++   P +K +RN    +Y   +  + +I WL  +     KP++  D  K    +  +VV G          K+W     + L S+   TQ +ASV+   ++K
Sbjct:    5 VGLFFLVLGASAAVIEEEENVIVLTKDNFDEVINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRGYPTLKLFRNGKPQEYNGGRDHDSIIAWLKKKTGPVAKPLADADAVKELQESADVVVIGYFKDTTSDDAKTWIQANRLALVSEF--TQETASVIFGGEIK 194          
BLAST of Protein disulfide-isomerase vs. Ensembl Celegans
Match: pdi-1 (Protein disulfide-isomerase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q17967])

HSP 1 Score: 119.013 bits (297), Expect = 6.627e-36
Identity = 74/296 (25.00%), Postives = 146/296 (49.32%), Query Frame = 1
Query:  637 ENSIGIYQYDFGIQHTVSGKLTRNIMNDFIIKHHVPIY-----SEFSDFIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSI-----PENEGFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIKFHGERTIENLKKFIESNGQDGNEQQFLEIDH 1494
            E+ + + + D G     S      I N   +K  +  Y     +EF+     +   G    F  +I +      +E  A+  ++AK+   K +F+  D+  ++  R LE L +     P N   R+V  ++ +  FKP+      G    +F    ++G +  +L A +  E+W+  P+K L    ++++ +D+TK VFV  YAP C + ++++ + D+L E Y+ + NV++AKLD++++EL  ++V S P + L+   ++  + + G+R +E  ++F+       +E +    DH
Sbjct:  196 EDGVALIRTD-GDDSETSTIAEAEITNTIALKQWLHAYKLSAVTEFTHESAQEIVGGDLKKFHFLIIRKSDSSFDETIAKFTEVAKKFRAKIVFVLLDVDVEENARILEFLGVDAKNTPAN---RIVSLADQVEKFKPQE-----GEDFEAFTNSYLEGKSAQDLKAQDLPEDWNALPVKVLVASNFNEIALDETKTVFVKFYAPWCGHCKQLVPVWDELAEKYESNPNVVIAKLDATLNELADVKVNSFPTLKLWPAGSSTPVDYDGDRNLEKFEEFVNKYAGSASESETASQDH 482          

HSP 2 Score: 51.6026 bits (122), Expect = 6.627e-36
Identity = 28/138 (20.29%), Postives = 65/138 (47.10%), Query Frame = 2
Query:  107 IIEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNKTGVQYLRTQGKEEVIQWLTDRVNYELKPISTLDDGKNTLLNNLLVVFG 520
            ++ + ++ L+LT+ N++      E++LV FY P C  C      +  AA   KE    +K A VDA   + +A+  ++   P + ++++    +Y   +   +++ W+  +    +  + +++  +       +VV G
Sbjct:   18 VVADSENVLVLTESNFEETINGNEFVLVKFYAPWCVHCKSLAPKYDEAADLLKEEGSDIKLAKVDATENQALASKFEVRGYPTILYFKSGKPTKYTGGRATAQIVDWVKKKSGPTVTTVESVEQLEELKGKTRVVVLG 155          
BLAST of Protein disulfide-isomerase vs. Ensembl Fly
Match: Pdi (gene:FBgn0286818 transcript:FBtr0346644)

HSP 1 Score: 124.02 bits (310), Expect = 2.007e-41
Identity = 81/318 (25.47%), Postives = 165/318 (51.89%), Query Frame = 1
Query:  532 DDIKDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQYDFGIQHTVSGKLTRNIMNDFIIKHHVPIYSEF----SDFIFSKSFVGHYHYFVPII---FKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENE--GFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIKFHGERTIENLKKFIESNGQ 1458
            ++ K F  VA+  D   F +  +A++  ++     +N + +++     +    G+L    +  F     +P+  +F    +  IF  S   H  +FV       + +  PL E       IAK+     +F+     ++   R  E   + + E    R+++  E +  +KPE+  +L+   + +F+++ +DG  +  L++ E  E+W   P+K L    ++ V +DK+K+V V  YAP C + +++  + D+L E YKD+E++++AK+DS+ +EL  I++ S P +  + K+ N+ I F+ +RT+++  KF+++NG+
Sbjct:  167 EEAKTFTKVANALDSFVFGVSSNADVIAKYE--AKDNGVVLFKPFDDKKSVFEGELNEENLKKFAQVQSLPLIVDFNHESASKIFGGSIKSHLLFFVSREGGHIEKYVDPLKE-------IAKKYRDDILFVTISSDEEDHTRIFEFFGMNKEEVPTIRLIKLEEDMAKYKPESD-DLSAETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKDNEDIVIAKMDSTANELESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFLDANGE 474          

HSP 2 Score: 65.4698 bits (158), Expect = 2.007e-41
Identity = 42/155 (27.10%), Postives = 74/155 (47.74%), Query Frame = 2
Query:   56 ALFSLSLSFYCNGDEIPIIEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNKTGVQYLRTQGKEEVIQWLTDRVNYELKPISTLDDGKNTLLNNLLVVFG 520
            ALF L+ S+     E  +  E+   L+ T  N+       E++LV FY P C  C      +  AA+   E +  +K A VDA  E  +A    +   P +KF+R+ + V+Y   +   ++I W+T +     K ++++ D +  L +N + + G
Sbjct:    7 ALF-LAASYVAASAEAEVKVEE-GVLVATVDNFKQLIADNEFVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSGSPVEYSGGRQAADIIAWVTKKTGPPAKDLTSVADAEQFLKDNEIAIIG 159          
BLAST of Protein disulfide-isomerase vs. Ensembl Fly
Match: Pdi (gene:FBgn0286818 transcript:FBtr0075648)

HSP 1 Score: 124.02 bits (310), Expect = 2.007e-41
Identity = 81/318 (25.47%), Postives = 165/318 (51.89%), Query Frame = 1
Query:  532 DDIKDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQYDFGIQHTVSGKLTRNIMNDFIIKHHVPIYSEF----SDFIFSKSFVGHYHYFVPII---FKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENE--GFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIKFHGERTIENLKKFIESNGQ 1458
            ++ K F  VA+  D   F +  +A++  ++     +N + +++     +    G+L    +  F     +P+  +F    +  IF  S   H  +FV       + +  PL E       IAK+     +F+     ++   R  E   + + E    R+++  E +  +KPE+  +L+   + +F+++ +DG  +  L++ E  E+W   P+K L    ++ V +DK+K+V V  YAP C + +++  + D+L E YKD+E++++AK+DS+ +EL  I++ S P +  + K+ N+ I F+ +RT+++  KF+++NG+
Sbjct:  167 EEAKTFTKVANALDSFVFGVSSNADVIAKYE--AKDNGVVLFKPFDDKKSVFEGELNEENLKKFAQVQSLPLIVDFNHESASKIFGGSIKSHLLFFVSREGGHIEKYVDPLKE-------IAKKYRDDILFVTISSDEEDHTRIFEFFGMNKEEVPTIRLIKLEEDMAKYKPESD-DLSAETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKDNEDIVIAKMDSTANELESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFLDANGE 474          

HSP 2 Score: 65.4698 bits (158), Expect = 2.007e-41
Identity = 42/155 (27.10%), Postives = 74/155 (47.74%), Query Frame = 2
Query:   56 ALFSLSLSFYCNGDEIPIIEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNKTGVQYLRTQGKEEVIQWLTDRVNYELKPISTLDDGKNTLLNNLLVVFG 520
            ALF L+ S+     E  +  E+   L+ T  N+       E++LV FY P C  C      +  AA+   E +  +K A VDA  E  +A    +   P +KF+R+ + V+Y   +   ++I W+T +     K ++++ D +  L +N + + G
Sbjct:    7 ALF-LAASYVAASAEAEVKVEE-GVLVATVDNFKQLIADNEFVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSGSPVEYSGGRQAADIIAWVTKKTGPPAKDLTSVADAEQFLKDNEIAIIG 159          
BLAST of Protein disulfide-isomerase vs. Ensembl Fly
Match: ERp60 (gene:FBgn0033663 transcript:FBtr0088058)

HSP 1 Score: 63.1586 bits (152), Expect = 2.688e-10
Identity = 35/133 (26.32%), Postives = 74/133 (55.64%), Query Frame = 1
Query: 1051 MLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDEL-PRIRVRSTPMMFLYLKDT-NERIKFHGERTIENLKKFI 1443
            +  F+ +++    EP  + SEP    +  P+K    K +D +V++  K+  +  YAP C + +++  + ++L E  + DE+V + K+D++ +++ P   VR  P +F   KD  N+ + ++G R +++  K+I
Sbjct:  337 LQDFVEKLLANELEP-YIKSEPIPESNDAPVKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLSPIYEELAEKLQ-DEDVAIVKMDATANDVPPEFNVRGFPTLFWLPKDAKNKPVSYNGGREVDDFLKYI 467          
BLAST of Protein disulfide-isomerase vs. Ensembl Zebrafish
Match: p4hb (prolyl 4-hydroxylase, beta polypeptide [Source:ZFIN;Acc:ZDB-GENE-080610-1])

HSP 1 Score: 157.532 bits (397), Expect = 7.211e-49
Identity = 96/320 (30.00%), Postives = 174/320 (54.37%), Query Frame = 1
Query:  532 DDIKDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQ-YDFGIQHTVSGKLTRNIMNDFIIKHHVPIYSEFSDFIFSKSFVG----HYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENEG--FRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMM-FLYLKDTNERIKFHGERTIENLKKFIESNGQDGN 1467
            +D K F   A   DD+ F +  D  +  +F +   ++S+ +++ +D G ++T  G++++  + +FI  + +P+  EF++    K F G    H   FVP   K F   +++ K    K A+   GK +FI  D      QR LE   + + E    R++   E +  +KPE+   +    ++SF    ++GT +P LM+ +  E+W   P+K L  K +++V  +   NVFV  YAP C + +++  + D+LGE +KD+ N+++AK+DS+ +E+  ++V S P + F    D  + I ++GERT++   KF+ES G++G 
Sbjct:  165 EDSKAFIKTAEAVDDIPFGITSDDSVFAKFEV--AKDSVVLFKKFDEG-RNTFDGEVSKESLLNFIKANQLPLVIEFTEQTAPKIFGGDIKSHILMFVPKAAKDFQDKMDQFK----KAAEGFKGKILFIFIDSDVDDNQRILEFFGLKKEECPVIRLITLEEEMTKYKPESS-EITAENIISFCTSFVEGTLKPHLMSQDIPEDWDKNPVKVLVGKNFEEVAFNPANNVFVEFYAPWCGHCKQLAPIWDQLGEKFKDNANIVVAKMDSTANEIEAVKVHSFPTLKFFPAGDERKVIDYNGERTLDGFTKFLESGGKEGG 476          

HSP 2 Score: 57.3806 bits (137), Expect = 7.211e-49
Identity = 43/166 (25.90%), Postives = 73/166 (43.98%), Query Frame = 2
Query:   32 MSKSLITFALFSLSLSFYCNGDEIPIIEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRN---KTGVQYLRTQGKEEVIQWLTDRVNYELKPISTLDDGKNTLLNNLLVVFG 520
            M K LI  AL ++S +         I EE+D  L+L   N++ A K +  +LV FY P C  C      +  AA   K     ++ A VDA  E  +A    +   P +KF++        +Y   +  E+++ WL  R       ++ +   ++ + +N + V G
Sbjct:    1 MLKFLIVCALAAMSAA--------EIAEEED-VLVLKKSNFEEALKAHPNVLVEFYAPWCGHCKALAPEYSKAAGMLKAEGSDIRLAKVDATEESELAQEFGVRGYPTIKFFKGGEKGNPKEYSAGRQAEDIVSWLKKRTGPAATTLNDVMQAESIIADNEVAVIG 157          
BLAST of Protein disulfide-isomerase vs. Ensembl Zebrafish
Match: p4hb (prolyl 4-hydroxylase, beta polypeptide [Source:ZFIN;Acc:ZDB-GENE-080610-1])

HSP 1 Score: 157.532 bits (397), Expect = 7.211e-49
Identity = 96/320 (30.00%), Postives = 174/320 (54.37%), Query Frame = 1
Query:  532 DDIKDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQ-YDFGIQHTVSGKLTRNIMNDFIIKHHVPIYSEFSDFIFSKSFVG----HYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENEG--FRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMM-FLYLKDTNERIKFHGERTIENLKKFIESNGQDGN 1467
            +D K F   A   DD+ F +  D  +  +F +   ++S+ +++ +D G ++T  G++++  + +FI  + +P+  EF++    K F G    H   FVP   K F   +++ K    K A+   GK +FI  D      QR LE   + + E    R++   E +  +KPE+   +    ++SF    ++GT +P LM+ +  E+W   P+K L  K +++V  +   NVFV  YAP C + +++  + D+LGE +KD+ N+++AK+DS+ +E+  ++V S P + F    D  + I ++GERT++   KF+ES G++G 
Sbjct:  165 EDSKAFIKTAEAVDDIPFGITSDDSVFAKFEV--AKDSVVLFKKFDEG-RNTFDGEVSKESLLNFIKANQLPLVIEFTEQTAPKIFGGDIKSHILMFVPKAAKDFQDKMDQFK----KAAEGFKGKILFIFIDSDVDDNQRILEFFGLKKEECPVIRLITLEEEMTKYKPESS-EITAENIISFCTSFVEGTLKPHLMSQDIPEDWDKNPVKVLVGKNFEEVAFNPANNVFVEFYAPWCGHCKQLAPIWDQLGEKFKDNANIVVAKMDSTANEIEAVKVHSFPTLKFFPAGDERKVIDYNGERTLDGFTKFLESGGKEGG 476          

HSP 2 Score: 57.3806 bits (137), Expect = 7.211e-49
Identity = 43/166 (25.90%), Postives = 73/166 (43.98%), Query Frame = 2
Query:   32 MSKSLITFALFSLSLSFYCNGDEIPIIEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRN---KTGVQYLRTQGKEEVIQWLTDRVNYELKPISTLDDGKNTLLNNLLVVFG 520
            M K LI  AL ++S +         I EE+D  L+L   N++ A K +  +LV FY P C  C      +  AA   K     ++ A VDA  E  +A    +   P +KF++        +Y   +  E+++ WL  R       ++ +   ++ + +N + V G
Sbjct:    1 MLKFLIVCALAAMSAA--------EIAEEED-VLVLKKSNFEEALKAHPNVLVEFYAPWCGHCKALAPEYSKAAGMLKAEGSDIRLAKVDATEESELAQEFGVRGYPTIKFFKGGEKGNPKEYSAGRQAEDIVSWLKKRTGPAATTLNDVMQAESIIADNEVAVIG 157          
BLAST of Protein disulfide-isomerase vs. Ensembl Zebrafish
Match: pdia2 (protein disulfide isomerase family A, member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-705])

HSP 1 Score: 130.954 bits (328), Expect = 4.218e-32
Identity = 90/315 (28.57%), Postives = 167/315 (53.02%), Query Frame = 1
Query:  541 KDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQYD---FGIQHTVSGKLTRNIMNDFI----IKHHVPIYSEFSDFIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENE--GFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERI-KFHGERTIENLKKFIESNG 1455
            K F  V  +  DV F +  D EL +++ +  T++ +   ++D     +  +   KL +  M  FI    ++  VP   E ++ IF+     H   F+     S     N +  E R++A E   K IFI  D++ +KV   L++ SI E++    R++ ++E +V +  +    +N   + +F + V DGT +P L + E  E+W   P+K L  K +++V  D++KNVFV  YAP C + +++  + D+LGE YKD EN+++AK+D++ +++  + ++  P +  +   T ++I  + G R +E   KF+++ G
Sbjct:  202 KTFYDVTLIAVDVNFGITSDPELFKKYEV-KTDSLVLFKKFDERRADMPLSDETKLDKGEMISFIHSNSMRLVVPFNEENAEQIFNSKVRKHLLLFLNTTVDS----QNALVEEFREVASEFKEKVIFITVDVTAEKVNHVLKYFSISEDDVPTIRLI-NTEDVVTYAMDGS-TINKDTLRTFCQGVFDGTVKPYLKSQEIPEDWDKNPVKVLVGKNFNEVAFDESKNVFVEFYAPWCGHCQQLAPVWDELGEKYKDQENIIIAKMDATENDVEDLTIQGFPTIKYFPAGTEKKIVDYDGNRDLETFSKFLDNGG 509          

HSP 2 Score: 55.4546 bits (132), Expect = 1.228e-7
Identity = 30/87 (34.48%), Postives = 45/87 (51.72%), Query Frame = 2
Query:  110 IEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYR 370
            I ED   L+L   N+D A    +Y+LV FY P C  C   + I+   A   K     V+ A VDA  EK +A+   +++ P +KF++
Sbjct:   52 ITEDKDVLILHSVNFDRALSENKYLLVEFYAPWCGHCRSLEPIYAEVAGQLKNASSEVRLAKVDAIEEKELASEFSVDSFPTLKFFK 138          
BLAST of Protein disulfide-isomerase vs. Ensembl Zebrafish
Match: pdia2 (protein disulfide isomerase family A, member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-705])

HSP 1 Score: 130.954 bits (328), Expect = 4.443e-32
Identity = 91/316 (28.80%), Postives = 169/316 (53.48%), Query Frame = 1
Query:  541 KDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQ-YD---FGIQHTVSGKLTRNIMNDFI----IKHHVPIYSEFSDFIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENE--GFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERI-KFHGERTIENLKKFIESNG 1455
            K F  V  +  DV F +  D EL +++ + T  +S+ +++ +D     +  +   KL +  M  FI    ++  VP   E ++ IF+     H   F+     S     N +  E R++A E   K IFI  D++ +KV   L++ SI E++    R++ ++E +V +  +    +N   + +F + V DGT +P L + E  E+W   P+K L  K +++V  D++KNVFV  YAP C + +++  + D+LGE YKD EN+++AK+D++ +++  + ++  P +  +   T ++I  + G R +E   KF+++ G
Sbjct:  202 KTFYDVTLIAVDVNFGITSDPELFKKYEVKT--DSLVLFKKFDERRADMPLSDETKLDKGEMISFIHSNSMRLVVPFNEENAEQIFNSKVRKHLLLFLNTTVDS----QNALVEEFREVASEFKEKVIFITVDVTAEKVNHVLKYFSISEDDVPTIRLI-NTEDVVTYAMDGS-TINKDTLRTFCQGVFDGTVKPYLKSQEIPEDWDKNPVKVLVGKNFNEVAFDESKNVFVEFYAPWCGHCQQLAPVWDELGEKYKDQENIIIAKMDATENDVEDLTIQGFPTIKYFPAGTEKKIVDYDGNRDLETFSKFLDNGG 509          

HSP 2 Score: 55.0694 bits (131), Expect = 1.561e-7
Identity = 30/87 (34.48%), Postives = 45/87 (51.72%), Query Frame = 2
Query:  110 IEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYR 370
            I ED   L+L   N+D A    +Y+LV FY P C  C   + I+   A   K     V+ A VDA  EK +A+   +++ P +KF++
Sbjct:   52 ITEDKDVLILHSVNFDRALSENKYLLVEFYAPWCGHCRSLEPIYAEVAGQLKNASSEVRLAKVDAIEEKELASEFSVDSFPTLKFFK 138          
BLAST of Protein disulfide-isomerase vs. Ensembl Zebrafish
Match: pdia4 (protein disulfide isomerase family A, member 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5493])

HSP 1 Score: 74.3294 bits (181), Expect = 1.374e-13
Identity = 41/147 (27.89%), Postives = 81/147 (55.10%), Query Frame = 1
Query: 1027 PLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNER---IKFH-GERTIENLKKFIESNG 1455
            P   +   + SF+     G  +P ++ S+P    +  P+K +  KT+D++VMD  K+V +  YAP C + +++      LG+ YK+++N+++AK+D++ +++P    +      +Y   +N +   IKF  G+R +E   KF+E + 
Sbjct:  487 PEEFDSDVLRSFVMAFKKGKLKP-IVKSQPLPKNNKGPVKVVVGKTFDEIVMDSKKDVLIEFYAPWCGHCKKLEPDYISLGKKYKNEKNLVIAKMDATANDVPHDSYKVEGFPTIYFAPSNNKQNPIKFEGGKRDVEEFSKFVEKHA 632          

HSP 2 Score: 50.447 bits (119), Expect = 4.066e-6
Identity = 32/114 (28.07%), Postives = 49/114 (42.98%), Query Frame = 2
Query:  131 LLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNKTGVQYLRTQGKEEVIQWLTDRVNYELKPISTL 472
            L+LT  N+D      + ILV FY P C  C      +  AAK        +  A VDA  E  +AT   +   P +K +R      Y   + K  ++ +++D+     K + TL
Sbjct:  177 LVLTKDNFDDVVNNADIILVEFYAPWCGHCKRLAPEYEKAAKELSNRTPPIPLAKVDATAESDLATRFGVSGYPTLKIFRKGKAFDYNGPREKFGIVDYMSDQAGPPSKQVQTL 290          
BLAST of Protein disulfide-isomerase vs. Ensembl Xenopus
Match: p4hb (prolyl 4-hydroxylase subunit beta [Source:NCBI gene;Acc:395048])

HSP 1 Score: 150.984 bits (380), Expect = 6.276e-47
Identity = 95/335 (28.36%), Postives = 171/335 (51.04%), Query Frame = 1
Query:  556 VASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQ-YDFGIQHTVSGKLTRNIMNDFIIKHHVPIYSEFSD----FIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENE--GFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIK-FHGERTIENLKKFIESNGQDGNEQQFLE-IDHLQHARLTENGLVH 1533
             A   DD+ F +        ++ L   ++ I +++ +D G ++   G +T+  +  FI  + +P+  EF++     IF      H  +F+P     +   L + K    K A    GK +FI  D      QR LE   + + E    R++   E +  +KPE+  +L+   +  F    ++G  +P LM+ +  ++W   P+K L  K +++VV ++ KNVFV  YAP C + +++  + D+LGE YKD EN+++AK+DS+ +E+  +++ S P +  +     + +  ++GERT+E   KF+ES GQDG   + LE ++    + L E    H
Sbjct:  192 AAEAVDDIPFGITSSEAAFSKYEL--GKDGIVLFKKFDEG-RNAYEGDITKEEVLSFIKANRLPLVIEFTEQTAPMIFGGEIKTHILFFLPKSASDYKEKLEDFK----KAAASFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESA-DLSAEAIKEFCDSFLEGKVKPHLMSQDVSDDWDKNPVKILVGKNFEEVVFNEEKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHENIIIAKMDSTANEIEAVKIHSFPTLKFFPAGPGKNVADYNGERTLEGFSKFLESGGQDGAADEDLEDLEDADESDLEEGDEAH 518          

HSP 2 Score: 57.7658 bits (138), Expect = 6.276e-47
Identity = 44/159 (27.67%), Postives = 68/159 (42.77%), Query Frame = 2
Query:   11 VFHHNFIMSKSLITFALFSLSLSFYCNGDEIPIIEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNK---TGVQYLRTQGKEEVIQWLTDRVNYELKPISTLDD 478
            V +   IM ++++   LF  SL      +    I E+   L+L   N+D A K Y +ILV FY P C  C      +  AA   K     ++   VDA  E  +A    +   P +KF++N    +  +Y   +   +++ WL  R        STL D
Sbjct:   11 VLYTRLIMMRAVL---LFGCSLLIVARAN----IPEERDVLVLKKDNFDEALKQYPFILVEFYAPWCGHCKALAPEYEKAAGVLKSEGLPIRLGKVDATEESDLAQEFGVRGYPTIKFFKNGDKASPKEYSAGREAADIVNWLKKRTG---PAASTLGD 159          
BLAST of Protein disulfide-isomerase vs. Ensembl Xenopus
Match: p4hb (prolyl 4-hydroxylase subunit beta [Source:NCBI gene;Acc:395048])

HSP 1 Score: 151.369 bits (381), Expect = 1.248e-46
Identity = 95/335 (28.36%), Postives = 171/335 (51.04%), Query Frame = 1
Query:  556 VASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQ-YDFGIQHTVSGKLTRNIMNDFIIKHHVPIYSEFSD----FIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENE--GFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIK-FHGERTIENLKKFIESNGQDGNEQQFLE-IDHLQHARLTENGLVH 1533
             A   DD+ F +        ++ L   ++ I +++ +D G ++   G +T+  +  FI  + +P+  EF++     IF      H  +F+P     +   L + K    K A    GK +FI  D      QR LE   + + E    R++   E +  +KPE+  +L+   +  F    ++G  +P LM+ +  ++W   P+K L  K +++VV ++ KNVFV  YAP C + +++  + D+LGE YKD EN+++AK+DS+ +E+  +++ S P +  +     + +  ++GERT+E   KF+ES GQDG   + LE ++    + L E    H
Sbjct:  172 AAEAVDDIPFGITSSEAAFSKYEL--GKDGIVLFKKFDEG-RNAYEGDITKEEVLSFIKANRLPLVIEFTEQTAPMIFGGEIKTHILFFLPKSASDYKEKLEDFK----KAAASFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESA-DLSAEAIKEFCDSFLEGKVKPHLMSQDVSDDWDKNPVKILVGKNFEEVVFNEEKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHENIIIAKMDSTANEIEAVKIHSFPTLKFFPAGPGKNVADYNGERTLEGFSKFLESGGQDGAADEDLEDLEDADESDLEEGDEAH 498          

HSP 2 Score: 56.6102 bits (135), Expect = 1.248e-46
Identity = 42/145 (28.97%), Postives = 61/145 (42.07%), Query Frame = 2
Query:   53 FALFSLSLSFYCNGDEIPIIEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNK---TGVQYLRTQGKEEVIQWLTDRVNYELKPISTLDD 478
            F LF  SL      +    I E+   L+L   N+D A K Y +ILV FY P C  C      +  AA   K     ++   VDA  E  +A    +   P +KF++N    +  +Y   +   +++ WL  R        STL D
Sbjct:    2 FLLFGCSLLIVARAN----IPEERDVLVLKKDNFDEALKQYPFILVEFYAPWCGHCKALAPEYEKAAGVLKSEGLPIRLGKVDATEESDLAQEFGVRGYPTIKFFKNGDKASPKEYSAGREAADIVNWLKKRTG---PAASTLGD 139          
BLAST of Protein disulfide-isomerase vs. Ensembl Xenopus
Match: p4hb (prolyl 4-hydroxylase subunit beta [Source:NCBI gene;Acc:395048])

HSP 1 Score: 151.369 bits (381), Expect = 3.454e-46
Identity = 94/334 (28.14%), Postives = 168/334 (50.30%), Query Frame = 1
Query:  556 VASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQYDFGIQHTVSGKLTRNIMNDFIIKHHVPIYSEFSD----FIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENE--GFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIK-FHGERTIENLKKFIESNGQDGNEQQFLE-IDHLQHARLTENGLVH 1533
             A   DD+ F +        ++ L   +  +   ++D G ++   G +T+  +  FI  + +P+  EF++     IF      H  +F+P     +   L + K    K A    GK +FI  D      QR LE   + + E    R++   E +  +KPE+  +L+   +  F    ++G  +P LM+ +  ++W   P+K L  K +++VV ++ KNVFV  YAP C + +++  + D+LGE YKD EN+++AK+DS+ +E+  +++ S P +  +     + +  ++GERT+E   KF+ES GQDG   + LE ++    + L E    H
Sbjct:  165 AAEAVDDIPFGITSSEAAFSKYEL-GKDGIVLFKKFDEG-RNAYEGDITKEEVLSFIKANRLPLVIEFTEQTAPMIFGGEIKTHILFFLPKSASDYKEKLEDFK----KAAASFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPES-ADLSAEAIKEFCDSFLEGKVKPHLMSQDVSDDWDKNPVKILVGKNFEEVVFNEEKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHENIIIAKMDSTANEIEAVKIHSFPTLKFFPAGPGKNVADYNGERTLEGFSKFLESGGQDGAADEDLEDLEDADESDLEEGDEAH 491          

HSP 2 Score: 55.0694 bits (131), Expect = 3.454e-46
Identity = 37/126 (29.37%), Postives = 55/126 (43.65%), Query Frame = 2
Query:  110 IEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNK---TGVQYLRTQGKEEVIQWLTDRVNYELKPISTLDD 478
            I E+   L+L   N+D A K Y +ILV FY P C  C      +  AA   K     ++   VDA  E  +A    +   P +KF++N    +  +Y   +   +++ WL  R        STL D
Sbjct:   10 IPEERDVLVLKKDNFDEALKQYPFILVEFYAPWCGHCKALAPEYEKAAGVLKSEGLPIRLGKVDATEESDLAQEFGVRGYPTIKFFKNGDKASPKEYSAGREAADIVNWLKKRTG---PAASTLGD 132          
BLAST of Protein disulfide-isomerase vs. Ensembl Xenopus
Match: p4hb (prolyl 4-hydroxylase subunit beta [Source:NCBI gene;Acc:395048])

HSP 1 Score: 151.754 bits (382), Expect = 1.226e-39
Identity = 95/335 (28.36%), Postives = 171/335 (51.04%), Query Frame = 1
Query:  556 VASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQ-YDFGIQHTVSGKLTRNIMNDFIIKHHVPIYSEFSD----FIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENE--GFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIK-FHGERTIENLKKFIESNGQDGNEQQFLE-IDHLQHARLTENGLVH 1533
             A   DD+ F +        ++ L   ++ I +++ +D G ++   G +T+  +  FI  + +P+  EF++     IF      H  +F+P     +   L + K    K A    GK +FI  D      QR LE   + + E    R++   E +  +KPE+  +L+   +  F    ++G  +P LM+ +  ++W   P+K L  K +++VV ++ KNVFV  YAP C + +++  + D+LGE YKD EN+++AK+DS+ +E+  +++ S P +  +     + +  ++GERT+E   KF+ES GQDG   + LE ++    + L E    H
Sbjct:  144 AAEAVDDIPFGITSSEAAFSKYEL--GKDGIVLFKKFDEG-RNAYEGDITKEEVLSFIKANRLPLVIEFTEQTAPMIFGGEIKTHILFFLPKSASDYKEKLEDFK----KAAASFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPES-ADLSAEAIKEFCDSFLEGKVKPHLMSQDVSDDWDKNPVKILVGKNFEEVVFNEEKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHENIIIAKMDSTANEIEAVKIHSFPTLKFFPAGPGKNVADYNGERTLEGFSKFLESGGQDGAADEDLEDLEDADESDLEEGDEAH 470          
BLAST of Protein disulfide-isomerase vs. Ensembl Xenopus
Match: p4hb (prolyl 4-hydroxylase subunit beta [Source:NCBI gene;Acc:395048])

HSP 1 Score: 151.369 bits (381), Expect = 1.292e-39
Identity = 95/335 (28.36%), Postives = 171/335 (51.04%), Query Frame = 1
Query:  556 VASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQ-YDFGIQHTVSGKLTRNIMNDFIIKHHVPIYSEFSD----FIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENE--GFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIK-FHGERTIENLKKFIESNGQDGNEQQFLE-IDHLQHARLTENGLVH 1533
             A   DD+ F +        ++ L   ++ I +++ +D G ++   G +T+  +  FI  + +P+  EF++     IF      H  +F+P     +   L + K    K A    GK +FI  D      QR LE   + + E    R++   E +  +KPE+  +L+   +  F    ++G  +P LM+ +  ++W   P+K L  K +++VV ++ KNVFV  YAP C + +++  + D+LGE YKD EN+++AK+DS+ +E+  +++ S P +  +     + +  ++GERT+E   KF+ES GQDG   + LE ++    + L E    H
Sbjct:  138 AAEAVDDIPFGITSSEAAFSKYEL--GKDGIVLFKKFDEG-RNAYEGDITKEEVLSFIKANRLPLVIEFTEQTAPMIFGGEIKTHILFFLPKSASDYKEKLEDFK----KAAASFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPES-ADLSAEAIKEFCDSFLEGKVKPHLMSQDVSDDWDKNPVKILVGKNFEEVVFNEEKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHENIIIAKMDSTANEIEAVKIHSFPTLKFFPAGPGKNVADYNGERTLEGFSKFLESGGQDGAADEDLEDLEDADESDLEEGDEAH 464          
BLAST of Protein disulfide-isomerase vs. Ensembl Mouse
Match: P4hb (prolyl 4-hydroxylase, beta polypeptide [Source:MGI Symbol;Acc:MGI:97464])

HSP 1 Score: 161.384 bits (407), Expect = 3.595e-49
Identity = 97/318 (30.50%), Postives = 168/318 (52.83%), Query Frame = 1
Query:  532 DDIKDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQYDFGIQHTVSGKLTRNIMNDFIIKHHVPIYSEFSDFIFSKSFVG----HYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENE--GFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNER-IKFHGERTIENLKKFIESNGQDG 1464
            D  K F + A   DD+ F +  ++ +  ++ L   +  +   ++D G ++   G++T+  + DFI  + +P+  EF++    K F G    H   F+P     +   L+  K    + A+   GK +FI  D      QR LE   + + E    R++   E +  +KPE+   L    +  F  + ++G  +P LM+ E  E+W  +P+K L    +++V  D+ KNVFV  YAP C + +++  + DKLGE YKD EN+++AK+DS+ +E+  ++V S P +  +    +   I ++GERT++  KKF+ES GQDG
Sbjct:  169 DSAKQFLLAAEAIDDIPFGITSNSGVFSKYQL-DKDGVVLFKKFDEG-RNNFEGEITKEKLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSSFK----RAAEGFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESD-ELTAEKITEFCHRFLEGKIKPHLMSQEVPEDWDKQPVKVLVGANFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIIIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDG 479          

HSP 2 Score: 54.6842 bits (130), Expect = 3.595e-49
Identity = 38/140 (27.14%), Postives = 66/140 (47.14%), Query Frame = 2
Query:  110 IEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNK-TGVQYLRTQGKE--EVIQWLTDRVNYELKPISTLDDGKNTLLNNLLVVFG 520
            +EE+D+ L+L   N++ A   ++Y+LV FY P C  C      +  AA   K     ++ A VDA  E  +A    +   P +KF++N  T      T G+E  +++ WL  R       +S     ++ + ++ + V G
Sbjct:   22 LEEEDNVLVLKKSNFEEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAAKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLSDTAAAESLVDSSEVTVIG 161          
BLAST of Protein disulfide-isomerase vs. Ensembl Mouse
Match: Pdia2 (protein disulfide isomerase associated 2 [Source:MGI Symbol;Acc:MGI:1916441])

HSP 1 Score: 107.457 bits (267), Expect = 3.538e-29
Identity = 80/317 (25.24%), Postives = 145/317 (45.74%), Query Frame = 1
Query:  535 DIKDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQYDFGIQHTVSGKLTRNIMND---FIIKHHVPIYSEF----SDFIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENEG--FRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNER-IKFHGERTIENLKKFIESNG 1455
            D+  F  +A    D+ F      +L ++F L T +  +   ++D G       K T   + D   F++ H + + +EF    S  IF+   + H   FV            E+  + R+ A    G+ +F+  D++       L +  +   E    R++ + E    + P   + +    + +F + V+ G  +  L++ E   +W   P+K L  K ++QV  D+TKNVFV  YAP C + +EM    + L E YKD E++++A+LD++ +EL    V   P +  +    + + I +   R +E   KF++S G
Sbjct:  186 DMATFLALAKDALDMTFGFTDQPQLFEKFGL-TKDTVVLFKKFDEGRADFPVDKETGLDLGDLSRFLVIHSMHLVTEFNSQTSPKIFAAKILNHLLLFVNQTLAQH----RELLTDFREAAPPFRGQVLFVMVDVAADN-SHVLNYFGLKAEEAPTLRLI-NVETTKKYAPTGVIAITAASVAAFCQAVLHGEIKHYLLSQEIPPDWDQGPVKTLVSKNFEQVAFDETKNVFVKFYAPWCSHCKEMAPAWEALAEKYKDREDIVIAELDATANELEAFSVLGYPTLKFFPAGPDRKVIDYKSTRDLETFSKFLDSGG 495          

HSP 2 Score: 41.2022 bits (95), Expect = 3.538e-29
Identity = 30/121 (24.79%), Postives = 51/121 (42.15%), Query Frame = 2
Query:   92 GDEIPIIEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNKTGV---QYLRTQGKEEVIQWLTDRVN 445
            G+E+P   ++D  L+L  +    A + +  ++V FY P C  C      +  AA         V  A VD   E  +    ++   P +KF++N       +Y   +  E + +WL  RV 
Sbjct:   38 GEEVP---KEDGILVLNHRTLSLALQEHSALMVEFYAPWCGHCKELAPEYSKAAALLAAESAVVTLAKVDGPAEPELTKEFEVVGYPTLKFFQNGNRTNPEEYAGPKTAEGIAEWLRRRVG 155          
BLAST of Protein disulfide-isomerase vs. Ensembl Mouse
Match: Pdia2 (protein disulfide isomerase associated 2 [Source:MGI Symbol;Acc:MGI:1916441])

HSP 1 Score: 107.457 bits (267), Expect = 3.567e-29
Identity = 80/317 (25.24%), Postives = 145/317 (45.74%), Query Frame = 1
Query:  535 DIKDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQYDFGIQHTVSGKLTRNIMND---FIIKHHVPIYSEF----SDFIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENEG--FRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNER-IKFHGERTIENLKKFIESNG 1455
            D+  F  +A    D+ F      +L ++F L T +  +   ++D G       K T   + D   F++ H + + +EF    S  IF+   + H   FV            E+  + R+ A    G+ +F+  D++       L +  +   E    R++ + E    + P   + +    + +F + V+ G  +  L++ E   +W   P+K L  K ++QV  D+TKNVFV  YAP C + +EM    + L E YKD E++++A+LD++ +EL    V   P +  +    + + I +   R +E   KF++S G
Sbjct:  189 DMATFLALAKDALDMTFGFTDQPQLFEKFGL-TKDTVVLFKKFDEGRADFPVDKETGLDLGDLSRFLVIHSMHLVTEFNSQTSPKIFAAKILNHLLLFVNQTLAQH----RELLTDFREAAPPFRGQVLFVMVDVAADN-SHVLNYFGLKAEEAPTLRLI-NVETTKKYAPTGVIAITAASVAAFCQAVLHGEIKHYLLSQEIPPDWDQGPVKTLVSKNFEQVAFDETKNVFVKFYAPWCSHCKEMAPAWEALAEKYKDREDIVIAELDATANELEAFSVLGYPTLKFFPAGPDRKVIDYKSTRDLETFSKFLDSGG 498          

HSP 2 Score: 41.2022 bits (95), Expect = 3.567e-29
Identity = 30/121 (24.79%), Postives = 51/121 (42.15%), Query Frame = 2
Query:   92 GDEIPIIEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNKTGV---QYLRTQGKEEVIQWLTDRVN 445
            G+E+P   ++D  L+L  +    A + +  ++V FY P C  C      +  AA         V  A VD   E  +    ++   P +KF++N       +Y   +  E + +WL  RV 
Sbjct:   38 GEEVP---KEDGILVLNHRTLSLALQEHSALMVEFYAPWCGHCKELAPEYSKAAALLAAESAVVTLAKVDGPAEPELTKEFEVVGYPTLKFFQNGNRTNPEEYAGPKTAEGIAEWLRRRVG 155          
BLAST of Protein disulfide-isomerase vs. Ensembl Mouse
Match: Pdia2 (protein disulfide isomerase associated 2 [Source:MGI Symbol;Acc:MGI:1916441])

HSP 1 Score: 85.1149 bits (209), Expect = 5.121e-19
Identity = 40/112 (35.71%), Postives = 64/112 (57.14%), Query Frame = 1
Query: 1123 NWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNER-IKFHGERTIENLKKFIESNG 1455
            +W   P+K L  K ++QV  D+TKNVFV  YAP C + +EM    + L E YKD E++++A+LD++ +EL    V   P +  +    + + I +   R +E   KF++S G
Sbjct:   14 DWDQGPVKTLVSKNFEQVAFDETKNVFVKFYAPWCSHCKEMAPAWEALAEKYKDREDIVIAELDATANELEAFSVLGYPTLKFFPAGPDRKVIDYKSTRDLETFSKFLDSGG 125          
BLAST of Protein disulfide-isomerase vs. Ensembl Mouse
Match: Pdilt (protein disulfide isomerase-like, testis expressed [Source:MGI Symbol;Acc:MGI:1919080])

HSP 1 Score: 89.7373 bits (221), Expect = 1.985e-18
Identity = 66/237 (27.85%), Postives = 113/237 (47.68%), Query Frame = 1
Query:  754 EFSDFIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENEGFRVVESSEHLVNFKPENPL-----NLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIKFHGERTIENLKKFIES 1449
            E  D I+  + + H   F   I KS   P + +    R+IAKE   K +F+  +  + K +R  E+  I      RV   S  ++N   +        ++N   +  F    +  TA+    + E  + W   P+K L  K ++ VV+DK K+VFV+ YAP     R +L LL++LG  Y++   V++AK+D + +++        P   L+  D+ E + + GE T++    F+ES
Sbjct:  261 ENKDLIYELNILNHMLLF---ISKSSE-PYSTISRHYRQIAKEFQNKILFVLVNADEPKNKRIFEYFQIS-----RVNVPSVQILNLSSDGRYKMPTDDINFESLKKFCNSFLSKTAKKHKASEEIPKYWDQGPVKKLVGKNFNVVVLDKEKDVFVMFYAPWSEKCRVLLPLLEELGIKYQNHSTVIIAKIDITANDIQLANPEQYPFFRLFPTDSQEAVMYKGEHTMKGFCDFLES 488          
BLAST of Protein disulfide-isomerase vs. UniProt/SwissProt
Match: sp|P05307|PDIA1_BOVIN (Protein disulfide-isomerase OS=Bos taurus OX=9913 GN=P4HB PE=1 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 4.282e-51
Identity = 96/316 (30.38%), Postives = 169/316 (53.48%), Query Frame = 1
Query:  532 DDIKDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQYDFGIQHTVSGKLTRNIMNDFIIKHHVPIYSEFSDFIFSKSFVG----HYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENE--GFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNER-IKFHGERTIENLKKFIESNGQ 1458
            D  K F + A + DD+ F +  ++++  ++ L   +  +   ++D G ++   G++T+  + DFI  + +P+  EF++    K F G    H   F+P     +   L+  K    K A+   GK +FI  D      QR LE   + + E    R++   E +  +KPE+   L    +  F  + ++G  +P LM+ E  ++W  +P+K L  K +++V  D+ KNVFV  YAP C + +++  + DKLGE YKD EN+++AK+DS+ +E+  ++V S P +  +    +   I ++GERT++  KKF+ES GQ
Sbjct:  169 DSAKQFFLAAEVIDDIPFGITSNSDVFSKYQL-DKDGVVLFKKFDEG-RNNFEGEVTKEKLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYEGKLSNFK----KAAESFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESD-ELTAEKITEFCHRFLEGKIKPHLMSQELPDDWDKQPVKVLVGKNFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQ 477          

HSP 2 Score: 65.855 bits (159), Expect = 4.282e-51
Identity = 41/126 (32.54%), Postives = 60/126 (47.62%), Query Frame = 2
Query:  113 EEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNK-TGVQYLRTQGKE--EVIQWLTDRVNYELKPISTLDDG 481
            +E+DH L+L   N+D A   ++Y+LV FY P C  C      +  AA   K     ++ A VDA  E  +A    +   P +KF++N  T      T G+E  +++ WL  R        STL DG
Sbjct:   23 DEEDHVLVLHKGNFDEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTAGREADDIVNWLKKRTG---PAASTLSDG 145          
BLAST of Protein disulfide-isomerase vs. UniProt/SwissProt
Match: sp|P09102|PDIA1_CHICK (Protein disulfide-isomerase OS=Gallus gallus OX=9031 GN=P4HB PE=1 SV=3)

HSP 1 Score: 163.696 bits (413), Expect = 1.267e-50
Identity = 97/318 (30.50%), Postives = 170/318 (53.46%), Query Frame = 1
Query:  532 DDIKDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQYDFGIQHTVSGKLTRNIMNDFIIKHHVPIYSEFSDFIFSKSFVG----HYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENE--GFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNER-IKFHGERTIENLKKFIESNGQDG 1464
            D  K+F + A   DD+ F +   A++  ++ L + +  +   ++D G ++   G LT++ + +FI  + +P+  EF++    K F G    H   F+P     +   L+  K      A    GK +FI  D      QR LE   + + E    R++   E +  +KPE+  +L    +  F  + ++G  +P LM+ +  E+W  +P+K L  K +++V  D+ KNVFV  YAP C + +++  + DKLGE Y+D EN+++AK+DS+ +E+  +++ S P +  +   +    I ++GERT+E  KKF+ES GQDG
Sbjct:  172 DAAKEFLLAAESVDDIPFGISSSADVFSKYQL-SQDGVVLFKKFDEG-RNNFEGDLTKDNLLNFIKSNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYEGKLDNFKT----AAGNFKGKILFIFIDSDHSDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESD-DLTADKIKEFCNKFLEGKIKPHLMSQDLPEDWDKQPVKVLVGKNFEEVAFDENKNVFVEFYAPWCGHCKQLAPIWDKLGETYRDHENIVIAKMDSTANEVEAVKIHSFPTLKFFPAGSGRNVIDYNGERTLEGFKKFLESGGQDG 482          

HSP 2 Score: 59.6918 bits (143), Expect = 1.267e-50
Identity = 32/115 (27.83%), Postives = 53/115 (46.09%), Query Frame = 2
Query:  110 IEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNKTGV---QYLRTQGKEEVIQWLTDRVN 445
            +EE+D  L+L   N++ A   + ++LV FY P C  C      +  AA   K     ++ A VDA  E  +A    +   P +KF+RN       +Y   +  ++++ WL  R  
Sbjct:   25 LEEEDGVLVLRAANFEQALAAHRHLLVEFYAPWCGHCKALAPEYAKAAAQLKAEGSEIRLAKVDATEEAELAQQFGVRGYPTIKFFRNGDKAAPREYTAGREADDIVSWLKKRTG 139          
BLAST of Protein disulfide-isomerase vs. UniProt/SwissProt
Match: sp|Q2HWU2|PDIA1_MACFU (Protein disulfide-isomerase OS=Macaca fuscata fuscata OX=9543 GN=P4HB PE=2 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 3.177e-50
Identity = 97/316 (30.70%), Postives = 166/316 (52.53%), Query Frame = 1
Query:  532 DDIKDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQYDFGIQHTVSGKLTRNIMNDFIIKHHVPIYSEFSDFIFSKSFVG----HYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENE--GFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNER-IKFHGERTIENLKKFIESNGQ 1458
            D  K F   A   DD+ F +  ++++  ++ L   +  +   ++D G ++   G++T+  + DFI  + +P+  EF++    K F G    H   F+P     +   L+  K      A+   GK +FI  D      QR LE   + + E    R++   E +  +KPE+   L    +  F  + ++G  +P LM+ E  E+W  +P+K L  K +++V  D+ KNVFV  YAP C + +++  + DKLGE YKD EN+++AK+DS+ +E+  I+V S P +  +    +   I ++GERT++  KKF+ES GQ
Sbjct:  169 DSAKQFLQAAEAIDDIPFGITSNSDVFSKYQL-DKDGVVLFKKFDEG-RNNFEGEVTKENLLDFIKYNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKT----AAESFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESD-ELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEEVAFDENKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAIKVHSFPTLKFFPASVDRTVIDYNGERTLDGFKKFLESGGQ 477          

HSP 2 Score: 65.0846 bits (157), Expect = 3.177e-50
Identity = 41/126 (32.54%), Postives = 59/126 (46.83%), Query Frame = 2
Query:  113 EEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNK-TGVQYLRTQGKE--EVIQWLTDRVNYELKPISTLDDG 481
            EE+DH L+L   N+  A   ++Y+LV FY P C  C      +  AA   K     ++ A VDA  E  +A    +   P +KF+RN  T      T G+E  +++ WL  R        +TL DG
Sbjct:   23 EEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTG---PAATTLPDG 145          
BLAST of Protein disulfide-isomerase vs. UniProt/SwissProt
Match: sp|P07237|PDIA1_HUMAN (Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3)

HSP 1 Score: 155.992 bits (393), Expect = 6.585e-50
Identity = 96/316 (30.38%), Postives = 165/316 (52.22%), Query Frame = 1
Query:  532 DDIKDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQYDFGIQHTVSGKLTRNIMNDFIIKHHVPIYSEFSDFIFSKSFVG----HYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENE--GFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNER-IKFHGERTIENLKKFIESNGQ 1458
            D  K F   A   DD+ F +  ++++  ++ L   +  +   ++D G ++   G++T+  + DFI  + +P+  EF++    K F G    H   F+P     +   L+  K      A+   GK +FI  D      QR LE   + + E    R++   E +  +KPE+   L    +  F  + ++G  +P LM+ E  E+W  +P+K L  K ++ V  D+ KNVFV  YAP C + +++  + DKLGE YKD EN+++AK+DS+ +E+  ++V S P +  +    +   I ++GERT++  KKF+ES GQ
Sbjct:  167 DSAKQFLQAAEAIDDIPFGITSNSDVFSKYQL-DKDGVVLFKKFDEG-RNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKT----AAESFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESE-ELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQ 475          

HSP 2 Score: 65.0846 bits (157), Expect = 6.585e-50
Identity = 41/126 (32.54%), Postives = 59/126 (46.83%), Query Frame = 2
Query:  113 EEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNK-TGVQYLRTQGKE--EVIQWLTDRVNYELKPISTLDDG 481
            EE+DH L+L   N+  A   ++Y+LV FY P C  C      +  AA   K     ++ A VDA  E  +A    +   P +KF+RN  T      T G+E  +++ WL  R        +TL DG
Sbjct:   21 EEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTG---PAATTLPDG 143          
BLAST of Protein disulfide-isomerase vs. UniProt/SwissProt
Match: sp|Q17770|PDI2_CAEEL (Protein disulfide-isomerase 2 OS=Caenorhabditis elegans OX=6239 GN=pdi-2 PE=1 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 7.904e-50
Identity = 92/317 (29.02%), Postives = 168/317 (53.00%), Query Frame = 1
Query:  532 DDIKDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQYDFGIQHTVSGKLTRNIMNDFIIKHHVPIYSEF----SDFIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENE--GFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIKFHGERTIENLKKFIESNGQDG 1464
            DD K F  VA+  DDV F +  +  +     L   E  +   ++D G +     KLT++ +  +I  + + + SEF    +  IF      H   FV      F     +++ E +  AK+  GK +F++ +   ++  R +E   + ++E    R++   E +  FKP+    +    +  F +  +DG+ +P LM+ +  E+W   P+K L  K ++QV  D TKNV V  YAP C + +++    DKLGE + DDE++++AK+DS+++E+  ++++S P +  +   +N+ + + G+RTIE   KF+E+NG++G
Sbjct:  163 DDAKTFLEVAAGIDDVPFGISTEDAVKSEIELKG-EGIVLFKKFDDG-RVAFDEKLTQDGLKTWIQANRLALVSEFTQETASVIFGGEIKSHNLLFVSKESSEFA----KLEQEFKNAAKQFKGKVLFVYINTDVEENARIMEFFGLKKDELPAIRLISLEEDMTKFKPDFE-EITTENISKFTQNYLDGSVKPHLMSEDIPEDWDKNPVKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDESIVIAKMDSTLNEVEDVKIQSFPTIKFFPAGSNKVVDYTGDRTIEGFTKFLETNGKEG 472          

HSP 2 Score: 68.5514 bits (166), Expect = 7.904e-50
Identity = 41/151 (27.15%), Postives = 69/151 (45.70%), Query Frame = 2
Query:   68 LSLSFYCNGDEIPIIEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNKTGVQYLRTQGKEEVIQWLTDRVNYELKPISTLDDGKNTLLNNLLVVFG 520
            + L F   G    +IEE+++ ++LT  N+D      E+ILV FY P C  C      +  AA   KE    +K   +DA     +++  ++   P +K +RN    +Y   +  + +I WL  +     KP++  D  K    +  +VV G
Sbjct:    5 VGLFFLVLGASAAVIEEEENVIVLTKDNFDEVINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRGYPTLKLFRNGKPQEYNGGRDHDSIIAWLKKKTGPVAKPLADADAVKELQESADVVVIG 155          
BLAST of Protein disulfide-isomerase vs. TrEMBL
Match: A0A455LAR4 (Protein disulfide-isomerase OS=Habrobracon hebetor OX=69819 GN=PDI PE=2 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 4.628e-54
Identity = 91/302 (30.13%), Postives = 166/302 (54.97%), Query Frame = 1
Query:  571 DDVEFRLLKDAELCQRFNLPTTENSIGIYQ-YDFGIQHTVSGKLTRNIMNDFIIKHHVPIYSEFSDFIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENE--GFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIKFHGERTIENLKKFIESNGQDGN 1467
            DD  F ++ D  L   F     +  + +Y+ +D G ++   G+LT   + DF+    +P+  +F+     K F G     + +         ++    I++ AK+  G+ +F+  +  +   +R LE   + + +    R+++  + +  FKPENP +L+G  +L F+   +DG  +  LM+ +  E+W  EP+K L    + +V  DK+K+V V  YAP C + +++  + DKLGE +KD+ +V++AK+D++++E+   ++ S P + LY K+TNE + ++GERT+E L KFIES G  G 
Sbjct:  177 DDQVFGIVSDEALFSEFE--AEDGKVVLYKKFDEG-KNVFEGELTSKALTDFVAAFSLPLVVDFNQETAQKIFGGDIKSHLLLFLSKEAGHFDKYLEGIQEPAKKFRGQVLFVTINADENDHERILEFFGMKKEDVPAMRIIKLEQDMAKFKPENP-DLDGANVLEFVTAFVDGKLKRHLMSQDLPEDWDKEPVKVLVGTNFAEVAFDKSKHVLVEFYAPWCGHCKQLAPIYDKLGEKFKDNADVVIAKMDATINEVEEAKIDSFPTLILYKKETNEAVSYNGERTLEGLSKFIESGGVYGQ 474          

HSP 2 Score: 79.337 bits (194), Expect = 4.628e-54
Identity = 43/136 (31.62%), Postives = 68/136 (50.00%), Query Frame = 2
Query:  110 IEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNKTGVQYLRTQGKEEVIQWLTDRVNYELKPISTLDDGKN-TLLNNLLVV 514
            I+ +D  L++T  N++ A K +EYIL  FY P C  C      +  AAK   E    +K A VDA  E  +A    +   P +KFYR    + Y   +  +++I W+  +     KP++T ++ K  T  NN+ +V
Sbjct:   20 IKTEDEVLVITKDNFEEALKEHEYILFEFYAPWCGHCKALAPEYAKAAKRLVEQGSKIKLAKVDATQEGPLAEQHGVRGYPTLKFYRKGVAIDYTGGRQADDIITWVNKKTGPPAKPLATAEEVKEFTESNNVAIV 155          
BLAST of Protein disulfide-isomerase vs. TrEMBL
Match: R7VJ39 (Protein disulfide-isomerase OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_156715 PE=3 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 5.646e-54
Identity = 103/318 (32.39%), Postives = 169/318 (53.14%), Query Frame = 1
Query:  529 VDDIKDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQYDFGIQHTVSGKLTRNIMNDFIIKHHVPIYSEFSDFIFSKSFVG----HYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPEN--EGFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIKFHGERTIENLKKFIESNGQDG 1464
             D  K F  VAS +DDV F +  +AE     N    E  +   ++D G ++ ++  LT   + +FI  + +P   EF+     K F G    H  +F+      F   ++E K    K+A E  GK +FI+ DI  +   R LE   +  +     R +   + +  +KPE    L+   +  F+  V  GT +P LM+ +  E+W   P+K L  K +++V  DKTK V V  YAP C + +++  + ++LGE +KD++ V++AK+DS+ +EL  ++V+S P +  + KD+ E I ++GERT+E   KF+ES G+DG
Sbjct:  163 TDAAKAFLAVASQYDDVPFAIT-EAEDVFTDNKVEGEAVVLFKKFDEG-RNDLTADLTEANIKEFIGANQLPTVIEFTQEAAPKIFGGDAKNHLLFFISKTSDDFQAKMDEYK----KVAPEFKGKVLFIYIDIDDEDNLRILEFFGLSPDVCPAVRYITLGDEMTKYKPETDA-LDAESIKKFVTDVRAGTVKPHLMSEDVPEDWDATPVKTLVGKNFNEVAKDKTKGVLVEFYAPWCGHCKQLAPIWEELGEKFKDNDEVVIAKMDSTANELEDVKVQSFPTIKFFPKDSEEVIDYNGERTLEGFTKFLESGGKDG 473          

HSP 2 Score: 75.485 bits (184), Expect = 5.646e-54
Identity = 41/137 (29.93%), Postives = 69/137 (50.36%), Query Frame = 2
Query:  110 IEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNKTGVQYLRTQGKEEVIQWLTDRVNYELKPISTLDDGKNTLLNNLLVVFG 520
            I ED+  L+LT+ N+D A + ++ ILV FY P C  C      +  AAK   +   T+K   VDA  E  +AT   +   P +KF+RN   + Y   +  ++ I W+  +       ++T+D+ K  +  + +V+ G
Sbjct:   20 IAEDEGVLVLTEANFDAALEKHDAILVEFYAPWCGHCKALAPEYATAAKKLNDEGSTLKLGKVDATVETKLATKFSVRGYPTIKFFRNGNPIDYSAGRKADDFINWMKKKTGPPAVTVATVDEAKALIEKDDVVIVG 156          
BLAST of Protein disulfide-isomerase vs. TrEMBL
Match: A0A2I9LPF0 (Protein disulfide-isomerase OS=Centruroides hentzi OX=88313 PE=3 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 7.004e-54
Identity = 101/314 (32.17%), Postives = 173/314 (55.10%), Query Frame = 1
Query:  532 DDIKDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQ-YDFGIQHTVSGKLTRNIMNDFIIKHHVPIYSEFSDFIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENEG--FRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIKFHGERTIENLKKFIESNGQDG 1464
            D+ K +  VA   DD  F +    E+ + FN+   ++SI +++ +D G ++   G+LT   + DFI  + +P+  +F+     K F G       +         +E+    RK+AK+   K +F+  DI ++  +R +E   + + +    R+++  E +  FKP     LN   + +F++ V+DG  +  L++    ENW   P+K L    +D V +DKTK+V V  YAP C + +++  + +KLGE YKD  N+++AK+D++ +EL   ++ S P + L+ KDTNE + F+GERT+E L KFI+S G DG
Sbjct:  165 DEAKVYLDVALESDDYSFGITSQDEVFKEFNV--EKDSIVLFKKFDEG-RNDFDGELTEKALKDFINMNSLPLVVDFNQDTAQKVFGGDIKAHNLLFISKKSSEYSELVEVFRKVAKDFKKKVLFVTIDIDEEDHERIMEFFGLKKEDAPDMRLIQLEEEMTKFKPPTS-GLNEDNIRNFVQGVLDGKIKQHLLSESVPENWDKGPVKVLVGNNFDDVALDKTKDVLVEFYAPWCGHCKQLAPIYEKLGEKYKDKSNIVIAKMDATANELEHTKIHSFPTIKLFKKDTNEVVDFNGERTLEGLSKFIDSGGVDG 474          

HSP 2 Score: 71.2478 bits (173), Expect = 7.004e-54
Identity = 42/144 (29.17%), Postives = 68/144 (47.22%), Query Frame = 2
Query:   47 ITFALFSLSLSFYCNGDEIPIIEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNKTGVQYLRTQGKEEVIQWLTDRVNYELKPISTLDD 478
            I F L  L  +      +IP    +D  L+L   N+D A + +++ILV FY P C  C      +  AAK  KE    +K A +DA  E  +A    +   P +KF+R     +Y   +  E++++WL  ++     P  +LD+
Sbjct:    3 IPFVLSVLFFTIITASGDIPT---EDEVLVLNKDNFDKAVQEHKHILVEFYAPWCGHCKALAPEYAKAAKQLKEEASEIKLAKIDATQESDLAEQYDVRGYPTLKFFRGGKPSEYKGGRVAEDIVRWLKKKIG---PPAESLDN 140          
BLAST of Protein disulfide-isomerase vs. TrEMBL
Match: A0A1I8HRX2 (Protein disulfide-isomerase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011389g1 PE=3 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 2.752e-52
Identity = 91/313 (29.07%), Postives = 174/313 (55.59%), Query Frame = 1
Query:  532 DDIKDFEIVA-SMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQYDFGIQHTVSGKLTRNIMNDFIIKHHVPIYSEFSDFIFSKSFVGHYH-YFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENE--GFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIKFHGERTIENLKKFIESNGQ 1458
            D  K +E  A S  +D+   +   A++   F +   ++++ +++   G +   +G  T + +  F+  + +P+ +EF+       F G    + +  + KS     + +  +++  A++  GKA+FI+ DI  +  +R LE   + + +    R +   E +V +KPE   ++    +  F++ V+DG  +P LM+ E   +W  EP+K L  K +++V  DKTKNV V  YAP C + +++  + DKLGE YK+ EN+++AK+DS+ +E+  ++V+S P +  +  +++E I + G+RT+E  KKF+ES G+
Sbjct:  166 DSAKSYEDAAFSKLEDIPCGMADSADIMAEFKV--DQDTVMLFKKTDGARIPYTGPFTADEVAKFVKNNKLPLINEFTQETAGDIFGGDVKKHLLVFLKKSDEAQFSNIMDQLKAPAEQFKGKALFIYVDIGVEDNERILEFFGLKKEDCPAVRFIALDEDMVKYKPEF-TDITADNLAQFVQSVLDGKLKPHLMSQEVPADWDKEPVKVLVGKNFNEVARDKTKNVLVEFYAPWCGHCKQLAPIWDKLGEEYKNHENIVIAKMDSTANEVEDVKVQSFPTIKFFPANSDEIIDYEGDRTLEGFKKFLESGGK 475          

HSP 2 Score: 76.6406 bits (187), Expect = 2.752e-52
Identity = 46/159 (28.93%), Postives = 82/159 (51.57%), Query Frame = 2
Query:   44 LITFALFSLSLSFYCNGDEIPIIEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNKTGVQYLRTQGKEEVIQWLTDRVNYELKPISTLDDGKNTLLNNLLVVFG 520
            +   ALFSL ++     DE   I E++  L+LT++N+D A +  +YILV FY P C  C      +  AA+  KE    +K A VDA  E  +A    ++  P +KF++ +T ++Y   +  + +I WL  ++    + + ++D  +  + +  + V G
Sbjct:    3 MFKLALFSL-VACVAFADEA--ITEEEGVLVLTEKNFDSALQANKYILVEFYAPWCGHCKALAPEYAKAAQQLKEKNSEIKLAKVDATVEGKLAEKYGVQGYPTIKFFKEQTPIEYSGGRTADTIISWLEKKLGPPTQRLDSVDAAQKFINDKEITVIG 158          
BLAST of Protein disulfide-isomerase vs. TrEMBL
Match: A0A0K0FC49 (Protein disulfide-isomerase OS=Strongyloides venezuelensis OX=75913 PE=3 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 8.777e-52
Identity = 94/319 (29.47%), Postives = 169/319 (52.98%), Query Frame = 1
Query:  532 DDIKDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQYDFGIQHTVSGKLTRNIMNDFIIKHHVPIYSEFS----DFIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENE--GFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIKFHGERTIENLKKFIESNGQDGNE 1470
            D+ K F  VA   DDV F +  +A+  +   L   E  + + ++D G ++   GK+    +  FI  + + + +EFS      IF      H   F+P   + F    +++  E +  AKE  GK +F+H +       R +E   +  +E    R++   E +V FKP+   ++    +  F ++ +DG  +P LM+ E  E+W  +P+K L  K + +V  D  K+V V  YAP C + +++  + DKLGE +KD+E+V++AK+DS+++E+  +++ S P +  +   +++ I ++G+RT+E    FIES G+ G E
Sbjct:  169 DEAKAFLEVAGSMDDVPFAITSEADAAKAVEL-KDEGVVLLKKFDEG-RNEYEGKVEEAKLKTFIQANRLALVNEFSQETASVIFGGEIKSHNLLFIPKGSEDF----DKVYGEFQTAAKEYKGKLLFVHINTDDADNARIMEFFGLKNDELPAIRLISLEEDMVKFKPDF-TDITAENIKQFTQKYLDGKLKPHLMSEEVPEDWDAKPVKVLVGKNFAEVAKDPKKSVLVKFYAPWCGHCKQLAPIWDKLGEAFKDNEDVVIAKMDSTLNEVEDVKINSFPTIKFFPAGSDKVIDYNGDRTLEAFTSFIESGGKKGGE 480          

HSP 2 Score: 77.411 bits (189), Expect = 8.777e-52
Identity = 40/136 (29.41%), Postives = 70/136 (51.47%), Query Frame = 2
Query:  113 EEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNKTGVQYLRTQGKEEVIQWLTDRVNYELKPISTLDDGKNTLLNNLLVVFG 520
            EE++  ++LT +N+D     +E++LV FY P C  C      +  AA+  K+   TV+ A +DA     +AT  ++   P +KF++N    +Y   +    ++ WL  +     KP++T DD K+   +  +VV G
Sbjct:   26 EEEEDVIVLTKENFDGVIADHEFVLVEFYAPWCGHCKALAPNYAKAAQQLKKEGATVRLAKLDATVHSDVATKFEVRGYPTIKFFKNGKPTEYTGGRDATSIVSWLKKKTGPAAKPLTTADDAKDFQDSADVVVVG 161          
BLAST of Protein disulfide-isomerase vs. Ensembl Cavefish
Match: p4hb (prolyl 4-hydroxylase subunit beta [Source:NCBI gene;Acc:103023413])

HSP 1 Score: 160.999 bits (406), Expect = 1.057e-49
Identity = 100/320 (31.25%), Postives = 172/320 (53.75%), Query Frame = 1
Query:  532 DDIKDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQ-YDFGIQHTVSGKLTRNIMNDFIIKHHVPIYSEFSDFIFSKSFVG----HYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENE--GFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMM-FLYLKDTNERIKFHGERTIENLKKFIESNGQDGN 1467
            D  K F   A   DD+ F +  D  +  +F +  TE+S+ +++ +D G ++T  G+L++  +  FI  + +P+  EF++    K F G    H   FVP   K F   ++      RK A+   GK +FI  D      QR LE   + + E    R++   + +  +KPE    +    +++F     +G  +P LM+ +  E+W   P+K L  K +++VV D TKNVFV  YAP C + +++  + D+LGE YKD ++V++AK+DS+ +E+  ++V S P + F    + ++ I + GERT++   KF+ES G++G 
Sbjct:  165 DGAKAFIKAAEAVDDIPFGISSDDAVFSKFEV--TEDSVVLFKKFDEG-RNTFDGELSKEGLLSFIKANQLPLVIEFTEQTAPKIFGGEIKSHILLFVPKASKDFQDKMDNF----RKAAEGFKGKILFIFIDSDVDDNQRILEFFGLKKEECPALRLITLEDEMTKYKPEAS-EITAENIITFCTAFTEGKLKPHLMSQDIPEDWDKTPVKTLVGKNFEEVVFDPTKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDSKDVVIAKMDSTANEIEAVKVHSFPTLKFFPAGEEHKIIDYSGERTLDGFTKFLESGGKEGG 476          

HSP 2 Score: 56.225 bits (134), Expect = 1.057e-49
Identity = 32/140 (22.86%), Postives = 62/140 (44.29%), Query Frame = 2
Query:  110 IEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRN---KTGVQYLRTQGKEEVIQWLTDRVNYELKPISTLDDGKNTLLNNLLVVFG 520
            + E++  L+L   N++ A K +  ILV FY P C  C      +  AA   K     ++   VDA  E  +A    +   P +KF++     +  +Y   +  ++++ WL  R       ++ +   ++ + +N + V G
Sbjct:   18 LSEEEDVLVLNKSNFEEALKAHPNILVEFYAPWCGHCKALAPEYAKAAGMLKAEGSDIRLGKVDATEEADLAQEFGVRGYPTIKFFKGGEKSSPKEYSAGRQADDIVNWLKKRTGPAAAALTEVTQAESLIADNEVAVIG 157          
BLAST of Protein disulfide-isomerase vs. Ensembl Cavefish
Match: pdia2 (protein disulfide isomerase family A, member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-705])

HSP 1 Score: 119.783 bits (299), Expect = 2.212e-37
Identity = 90/330 (27.27%), Postives = 171/330 (51.82%), Query Frame = 1
Query:  514 VRMHFVDDI-----KDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQ-YD---FGIQHTVSGKLTRNIMNDFIIKHHVPIYSEFS----DFIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENEG--FRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERI-KFHGERTIENLKKFIESNG 1455
            V + F DD+     K F  VA     + F +    EL +++N+   ++S+ +++ +D     I     GKL ++ +  FI  + + +   FS    D IFS     H   F+    +S     N +  + R  A E  GK +FI  D++++ V   +++  I  ++    R + +++ +  +  E    +N   + +F + V+DG  +P LM+ E  E+W+  P+K L  K ++ +  D++KNVFV  YAP C + +E+  + +KLGE YKD E++++A +DS+ +E+  + V+  P +  +   T  +I  ++G+R +E   KF+++ G
Sbjct:  185 VVVGFFDDLNGEEAKVFYSVAVDMVSLNFGITSSPELFKKYNV--NKDSVVLFKKFDDKRADISLPEDGKLDKDNLVTFIQNNSLELIITFSEENADKIFSSKVHNHILLFINTTIESH----NALLDDYRAAAVEFKGKVLFIKIDVNEE-VSHVMKYFGISASDTPVLRFI-NTDTVKKYAMEEE-TINKDTLKTFCQGVLDGKIKPHLMSQEIPEDWNKNPVKVLVGKNFEHIAFDESKNVFVEFYAPWCGHCKELAPVWEKLGEKYKDHEDIIIANMDSTANEVEGVTVQGFPTLKFFPAGTERKIVDYNGKRDLETFSKFLDNGG 505          

HSP 2 Score: 56.6102 bits (135), Expect = 2.212e-37
Identity = 35/133 (26.32%), Postives = 61/133 (45.86%), Query Frame = 2
Query:  131 LLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFY---RNKTGVQYLRTQGKEEVIQWLTDRVNYELKPISTLDDGKNTLLNNLLVVFG 520
            L+L   N+D A    +Y+LV FY P C  C + + ++   A+  K     ++ A VDA  EK +A    I+  P +KF+   R +    +   + ++ +  WL  +V      +    D +  L  + +VV G
Sbjct:   56 LVLHSVNFDRALSESKYLLVEFYAPWCSHCRMLEPVYSQVARQLKNESSPIRLAKVDATEEKELAEEFGIDGFPTLKFFKEGRRQNATDFTGKRTEKGIKLWLQRQVEPPATVLKNTKDAQELLDAHDVVVVG 188          
BLAST of Protein disulfide-isomerase vs. Ensembl Cavefish
Match: zgc:136472 (protein disulfide-isomerase-like [Source:NCBI gene;Acc:103036532])

HSP 1 Score: 78.1814 bits (191), Expect = 9.884e-25
Identity = 70/316 (22.15%), Postives = 150/316 (47.47%), Query Frame = 1
Query:  538 IKDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQYDFGIQH-TVSGKLTRNIMNDFIIKHHVPIYSEF----SDFIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENEG--FRVVESSEHLVNFKPENPLNLNGTYMLS-FIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNER-IKFHGERTIENLKKFIESNGQ 1458
            +K F  VA+   D+ F +  + ++  ++    TENS+ + +     +H  ++ +  ++ +  FI  H +P+ +E+    S  I S     H   F+    K F       K+     AKE  GK +F+  D  + +  R +E+  + + +    R+V  ++   +F+ + P +L      + FI   + G A+ +L +    + W  +P+K L    +++V  +  KNV ++ Y+P    SR +  L + L E + D E+V++A++D + +++    +   P + ++     ER + + GE  +E + +F+ +  +
Sbjct:  175 VKVFYEVAADVPDLPFGVTGNEQVFSKYG--RTENSVLLLRKSKMAEHFEMTSETVKDDVILFIRIHEMPLVTEYNGKTSSKILSSVVQNHLILFMDKAGKGFKQTYRAFKS----TAKEFRGKVLFVLIDSGEPRNGRIMEYFRVRKEDAPLVRMVNLTD---SFQYQLPSDLMDIQTFTDFIESYLQGKAKLKLQSEPVPDGWDKQPVKELVGMNFERVAFNHEKNVLILFYSPWSSDSRALFPLWEDLAEHFSDSEDVVVARIDITANDVNIRMMDRYPCIKVFPAVYAERVVSYSGEAKLEPIVEFVNAESE 481          

HSP 2 Score: 55.0694 bits (131), Expect = 9.884e-25
Identity = 40/142 (28.17%), Postives = 63/142 (44.37%), Query Frame = 2
Query:  110 IEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNKTGVQYLRT-----QGKEEVIQWLTDRVNYELKPISTLDDGKNTLLNNLLVVFG 520
            I+ED   L+LT+ N++ A K++  +LV FY P   +   S   F  AA   KE    VK   +D + +K +A    + TVP ++ Y   +G +Y        +    +I WL  R       I  L   +     + LV+ G
Sbjct:   26 IQEDKDVLVLTESNFNRALKLHSQLLVHFYAPLSGESLGSILEFAQAASELKEANSDVKLGGLDVSKQKDLAKTLNVTTVPSVRLYL--SGDKYNPVYCPVLKSSASIISWLKRRKGPSADLIKDLSQLEKFTAEDDLVILG 165          
BLAST of Protein disulfide-isomerase vs. Ensembl Cavefish
Match: zgc:136472 (protein disulfide-isomerase-like [Source:NCBI gene;Acc:103036532])

HSP 1 Score: 78.1814 bits (191), Expect = 1.444e-24
Identity = 68/315 (21.59%), Postives = 147/315 (46.67%), Query Frame = 1
Query:  538 IKDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQYDFGIQH-TVSGKLTRNIMNDFIIKHHVPIYSEF----SDFIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENEG--FRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNER-IKFHGERTIENLKKFIESNGQ 1458
            +K F  VA+   D+ F +  + ++  ++    TENS+ + +     +H  ++ +  ++ +  FI  H +P+ +E+    S  I S     H   F+    K F       K+     AKE  GK +F+  D  + +  R +E+  + + +    R+V  ++      P + +++       FI   + G A+ +L +    + W  +P+K L    +++V  +  KNV ++ Y+P    SR +  L + L E + D E+V++A++D + +++    +   P + ++     ER + + GE  +E + +F+ +  +
Sbjct:  178 VKVFYEVAADVPDLPFGVTGNEQVFSKYG--RTENSVLLLRKSKMAEHFEMTSETVKDDVILFIRIHEMPLVTEYNGKTSSKILSSVVQNHLILFMDKAGKGFKQTYRAFKS----TAKEFRGKVLFVLIDSGEPRNGRIMEYFRVRKEDAPLVRMVNLTDSFQYQLPSDLMDIQT--FTDFIESYLQGKAKLKLQSEPVPDGWDKQPVKELVGMNFERVAFNHEKNVLILFYSPWSSDSRALFPLWEDLAEHFSDSEDVVVARIDITANDVNIRMMDRYPCIKVFPAVYAERVVSYSGEAKLEPIVEFVNAESE 484          

HSP 2 Score: 55.0694 bits (131), Expect = 1.444e-24
Identity = 40/142 (28.17%), Postives = 63/142 (44.37%), Query Frame = 2
Query:  110 IEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNKTGVQYLRT-----QGKEEVIQWLTDRVNYELKPISTLDDGKNTLLNNLLVVFG 520
            I+ED   L+LT+ N++ A K++  +LV FY P   +   S   F  AA   KE    VK   +D + +K +A    + TVP ++ Y   +G +Y        +    +I WL  R       I  L   +     + LV+ G
Sbjct:   29 IQEDKDVLVLTESNFNRALKLHSQLLVHFYAPLSGESLGSILEFAQAASELKEANSDVKLGGLDVSKQKDLAKTLNVTTVPSVRLYL--SGDKYNPVYCPVLKSSASIISWLKRRKGPSADLIKDLSQLEKFTAEDDLVILG 168          
BLAST of Protein disulfide-isomerase vs. Ensembl Cavefish
Match: zgc:136472 (protein disulfide-isomerase-like [Source:NCBI gene;Acc:103036532])

HSP 1 Score: 75.485 bits (184), Expect = 5.613e-24
Identity = 70/312 (22.44%), Postives = 147/312 (47.12%), Query Frame = 1
Query:  538 IKDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQYDFGIQH-TVSGKLTRNIMNDFIIKHHVPIYSEF----SDFIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENEG--FRVVESSEHLVNFKPENPLNLNGTYMLS-FIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIK--FHGERTIENLKKFI 1443
            +K F  VA+   D+ F +  + ++  ++    TENS+ + +     +H  ++ +  ++ +  FI  H +P+ +E+    S  I S     H   F+    K F     +     +  AKE  GK +F+  D  + +  R +E+  + + +    R+V  ++   +F+ + P +L      + FI   + G A+ +L +    + W  +P+K L    +++V  +  KNV ++ Y+P    SR +  L + L E + D E+V++A++D + +++    +   P + ++     ER++  +  + T   LK FI
Sbjct:  178 VKVFYEVAADVPDLPFGVTGNEQVFSKYG--RTENSVLLLRKSKMAEHFEMTSETVKDDVILFIRIHEMPLVTEYNGKTSSKILSSVVQNHLILFMDKAGKGF----KQTYRAFKSTAKEFRGKVLFVLIDSGEPRNGRIMEYFRVRKEDAPLVRMVNLTD---SFQYQLPSDLMDIQTFTDFIESYLQGKAKLKLQSEPVPDGWDKQPVKELVGMNFERVAFNHEKNVLILFYSPWSSDSRALFPLWEDLAEHFSDSEDVVVARIDITANDVNIRMMDRYPCIKVFPAVYAERVRSIWSSKLTFTYLKLFI 480          

HSP 2 Score: 55.4546 bits (132), Expect = 5.613e-24
Identity = 40/142 (28.17%), Postives = 63/142 (44.37%), Query Frame = 2
Query:  110 IEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNKTGVQYLRT-----QGKEEVIQWLTDRVNYELKPISTLDDGKNTLLNNLLVVFG 520
            I+ED   L+LT+ N++ A K++  +LV FY P   +   S   F  AA   KE    VK   +D + +K +A    + TVP ++ Y   +G +Y        +    +I WL  R       I  L   +     + LV+ G
Sbjct:   29 IQEDKDVLVLTESNFNRALKLHSQLLVHFYAPLSGESLGSILEFAQAASELKEANSDVKLGGLDVSKQKDLAKTLNVTTVPSVRLYL--SGDKYNPVYCPVLKSSASIISWLKRRKGPSADLIKDLSQLEKFTAEDDLVILG 168          
BLAST of Protein disulfide-isomerase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002052.1 (pep scaffold:Pmarinus_7.0:GL480798:2613:20969:-1 gene:ENSPMAG00000001848.1 transcript:ENSPMAT00000002052.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.9518 bits (193), Expect = 4.063e-16
Identity = 64/298 (21.48%), Postives = 136/298 (45.64%), Query Frame = 1
Query:  535 DIKDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQYDFGIQHTVSGKLT--RNIMNDFIIKHHVPIYSEFSDFIFSKSFVG----HYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENE---GFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIK 1401
            D+K F  +A  +D+V F +    E+  ++ + +T++ +   ++D G +      L     I +   + H        +   F   F G    H   F     + FP    E+  + +  A    GK +F+  + +  +    L+   + +       R+V+ ++ +V   P    +     + SF +  +D   +P   + E  ++W+  P+K L  K +D+ V D+TKNVFV  YA  C + +++  + ++LG  YKD +N+++AK+D+  +E+  + +   P +  +     ++++
Sbjct:  116 DLKTFLEIADTYDEVPFGVTSSEEVFAKYGV-STDSIVLFKKFDEGQKSFTPIDLNFRHGIKSHTAVVHGCECLCGCTVQTFPLLFSGLVNVHILLFANASSEGFP----ELFEQFKAAAPPFRGKILFVLLNSAVPENDNVLDLFELTDGARLPAIRLVKVNKDMVKHVPSFS-DFTTANITSFCQDYLDEHNKPFSKSQEIPKDWNKRPVKVLVGKNFDEFVFDETKNVFVEFYASWCDHCKKLAPVWEQLGVQYKDHDNIVIAKMDAEKNEVAAVHIPGYPKIKYFPAGPGKKVR 407          
BLAST of Protein disulfide-isomerase vs. Ensembl Sea Lamprey
Match: pdia4 (protein disulfide isomerase family A, member 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5493])

HSP 1 Score: 69.707 bits (169), Expect = 8.373e-13
Identity = 36/123 (29.27%), Postives = 72/123 (58.54%), Query Frame = 1
Query: 1099 LMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELP--RIRVRSTPMMFLYLKDTNER-IKFH-GERTIENLKKFIESNG 1455
            ++ S+P    +  P+K +  +T++Q+V+D +K+V +  YAP C + + +  +   LG+ YK  + +++AK+D++V+++P    +    P ++       +R IKF  G R +E+L KFIE + 
Sbjct:  508 VVKSQPLPKSNKGPVKVVVGRTFEQMVLDNSKDVLIEFYAPWCGHCKSLEPIYKDLGKKYKGHKGLVIAKMDATVNDIPHDSYKAEGFPTIYFSPSGAKDRPIKFADGSRDLESLSKFIEKHA 630          
BLAST of Protein disulfide-isomerase vs. Ensembl Sea Lamprey
Match: pdia3 (protein disulfide isomerase family A, member 3 [Source:ZFIN;Acc:ZDB-GENE-031002-9])

HSP 1 Score: 61.2326 bits (147), Expect = 2.874e-10
Identity = 39/142 (27.46%), Postives = 79/142 (55.63%), Query Frame = 1
Query: 1039 NGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREM----LELLDKLGEMYKDDENVLLAKLDSSVDELP-RIRVRSTPMMFLY-LKDTNERIKFHGERTIENLKKFIE 1446
            +G  + +F++   DG  +  L  SEP    +  P+K +  + +D++V D++K+V +  YAP C + + +    LEL DKL    K+D N+L+AK+D++ +++P +  VR  P ++   +   +   K+ G R + +   +++
Sbjct:  341 DGKSLENFLQDYFDGKLKKHLK-SEPIPEDNDGPVKVVVAEIFDELVNDESKDVLIEFYAPWCGHCKNLEPKYLELADKL----KNDPNILIAKMDATANDVPAQYDVRGFPTIYFSPMGSKDSPKKYEGGREVSDFISYLK 477          
BLAST of Protein disulfide-isomerase vs. Ensembl Yeast
Match: EUG1 (Protein disulfide isomerase of the endoplasmic reticulum lumen; EUG1 has a paralog, PDI1, that arose from the whole genome duplication; function overlaps with that of Pdi1p; may interact with nascent polypeptides in the ER [Source:SGD;Acc:S000002926])

HSP 1 Score: 48.1358 bits (113), Expect = 2.181e-6
Identity = 51/185 (27.57%), Postives = 94/185 (50.81%), Query Frame = 1
Query: 1015 KPENPLNLNGTYMLSFIRQVMDGTAEPELMASE-PRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENV----LLAKLDSSVDELPRIRVRSTPMMFLYLKDTNER-IKFHGERTIENLKKFIESNGQDGNEQQFLEIDHLQHARLTE---NGLVHEEL 1542
            K E P  L+   ++  ++   +GTA+P + + E P+E      +  +  KT+D +V D  K+V V  YA  C +S+    + +++  +   DE+V    L+A++DS  +++    V   P + LY    N + I F+  R +E++ +FI+ +G    + Q +  D L  A+ +E      VH+EL
Sbjct:  336 KLEKPQPLDRDMIVQLVKDYREGTAKPIVKSEEIPKE--QKSNVYKIVGKTHDDIVHDDDKDVLVKYYATWCIHSKRFAPIYEEIANVLASDESVRDKILIAEVDSGANDILSFPVTGYPTIALYPAGNNSKPIIFNKIRNLEDVFEFIKESGTHHIDGQAI-YDKLHQAKDSEVSTEDTVHDEL 517          
BLAST of Protein disulfide-isomerase vs. Ensembl Nematostella
Match: EDO36830 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHH5])

HSP 1 Score: 139.428 bits (350), Expect = 9.286e-49
Identity = 86/316 (27.22%), Postives = 162/316 (51.27%), Query Frame = 1
Query:  532 DDIKDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQYDFGIQHTVSGKLTRNIMNDFIIKHHVPIYSEFSDFIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENE--GFRVVE-SSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIKFHGERTIENLKKFIESNGQDGNE 1470
            D  K F   A   DDVEF ++ D  +     +   +  +   ++D G ++   G+     +  F+  + +P+ +EFSD    K F G   + + +                   AK+  GK +F++ +   +  QR +E   I  +E    R++  + + +  +KP     +    +  F++  +D   +P L+++E  E+W  +P+K L  K +D+V  +K KNVFV  YAP C + +++  + D+LGE YKD  ++++AK+DS+ +E+  ++V S P +  + K+  E + ++G RT+++  KF+ES G+ GNE
Sbjct:  163 DAAKAFLSAADGIDDVEFGIVSDKAIASEHKV-EGDKIVLFKKFDEG-RNDYDGEYDFEKIQQFVKANQLPLVTEFSDETAPKIFGGDVKHHILLFTNKTSDGFKATHEAFTGGAKDFKGKVLFVYVNTEVEDNQRIVEFFGIQSSELPTIRLINLADDDMTKYKP-TAAEITSENVKEFVQAFLDKKLKPHLLSAEIPEDWDSKPVKVLCGKNFDEVARNKDKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHADIVVAKMDSTANEVEGVKVHSFPTIKYFPKE-GEAVDYNGGRTLDDFVKFLESGGKAGNE 474          

HSP 2 Score: 73.1738 bits (178), Expect = 9.286e-49
Identity = 39/135 (28.89%), Postives = 68/135 (50.37%), Query Frame = 2
Query:  110 IEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNKTGVQYLRTQGKEEVIQWLTDRVNYELKPISTLDDGKNTLLNNLLVV 514
            I+E++  L+LT++N+D A    +++LV FY P C  C      +  AA   K  K  +K A VDA  E  +    Q++  P +KF+++    +Y   +   E++ WL  +     K ++T D  K+ +   + VV
Sbjct:   20 IKEEEDVLVLTEKNFDEAVAANKHVLVEFYAPWCGHCKALAPEYAKAAGQLKSEKSEIKLAKVDATAETKLGEKFQVQGYPTIKFFKDGKPSEYAGGRTAPEIVSWLNKKTGPPAKDLATADAMKDFITKEVAVV 154          
BLAST of Protein disulfide-isomerase vs. Ensembl Nematostella
Match: EDO33843 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR22])

HSP 1 Score: 77.7962 bits (190), Expect = 4.889e-17
Identity = 41/130 (31.54%), Postives = 76/130 (58.46%), Query Frame = 1
Query: 1063 IRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRI-RVRSTPMM-FLYLKDTNERIKFHGERTIENLKKFIE 1446
            I  +  G  +P ++ S+P    + EP+  +  KT+D++V D  K+V +  YAP C + + +     KLG+ +++D+N+++AK+D++ +++P    V   P + F   KD    IKF G R +++L KF+E
Sbjct:    4 ISALFSGNLKP-IVKSQPVPKSNKEPVTVVVGKTFDEIVNDPKKDVLIEFYAPWCGHCKALEPTFKKLGKHFRNDKNIVIAKIDATANDVPSTYAVEGFPTIYFATSKDKKNPIKFDGGRELKDLIKFVE 132          
BLAST of Protein disulfide-isomerase vs. Ensembl Nematostella
Match: EDO32930 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STM8])

HSP 1 Score: 77.411 bits (189), Expect = 4.349e-15
Identity = 41/137 (29.93%), Postives = 78/137 (56.93%), Query Frame = 1
Query: 1051 MLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRI-RVRSTPMM-FLYLKDTNERIKFHGERTIENLKKFIESNG 1455
            +  F+ +   G  +P ++ S+P    + EP+  +  KT+D++V D  K+V +  YAP C + + +     KLG+ +++D+N+++AK+D++ +++P    V   P + F   KD    IKF G R +++L KF+E   
Sbjct:  498 LREFVEEFKAGNLKP-IIKSQPVPKSNKEPVTVVVGKTFDEIVNDPKKDVLIEFYAPWCGHCKALEPTFKKLGKHFRNDKNIVIAKIDATANDVPSTYAVEGFPTIYFATSKDKKNPIKFDGGRELKDLIKFVEEKA 633          

HSP 2 Score: 53.1434 bits (126), Expect = 1.820e-7
Identity = 34/130 (26.15%), Postives = 61/130 (46.92%), Query Frame = 2
Query:   89 NGDEIPIIEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNKTGVQYLRTQGKEEVIQWLTDR--VNYELKPISTL 472
            + D+   ++E+D  L+L  +N+D   +    ILV FY P C  C      +  AAK  K     V FA +DA     IA    +   P +K +R  T  +Y   + +  +++++  +   N++  P++ L
Sbjct:   50 DADDSDEVKEEDDVLVLNSKNFDRVIEENNIILVEFYAPWCGHCKSLAPEYAKAAKKMKLNDPPVPFAKMDATVASDIAQRFDVSGYPTLKIFRKGTPYEYEGPREESGIVEYMKKQSDPNWKPPPVAAL 179          
BLAST of Protein disulfide-isomerase vs. Ensembl Nematostella
Match: EDO31634 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXD7])

HSP 1 Score: 58.9214 bits (141), Expect = 2.462e-9
Identity = 34/131 (25.95%), Postives = 69/131 (52.67%), Query Frame = 1
Query: 1060 FIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSV-DELPRIRVRSTPMMFLYLKDTNERI-KFHGERTIENLKKFIE 1446
            F+     G+ +P +  SEP    +  P+K +  + + ++V D TK+V +  YAP C + + +    ++LGE  +D +++++AK+D++  D  P   V+  P ++    +  E   K+ G R + +   FI+
Sbjct:  337 FLEDYFAGSLKPHI-KSEPLPESNDGPVKVVVGENFKEIVNDPTKDVLIEFYAPWCGHCKSLEPKYNELGEKLQDVKDIVIAKMDATANDAPPNFSVQGFPTIYWAPANNKENPEKYEGGREVSDFVDFIK 466          
BLAST of Protein disulfide-isomerase vs. Ensembl Nematostella
Match: EDO47340 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMG9])

HSP 1 Score: 53.5286 bits (127), Expect = 9.782e-8
Identity = 31/101 (30.69%), Postives = 54/101 (53.47%), Query Frame = 1
Query: 1150 LTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDE--LPRIRVRSTPMMFLYLKDTNERIKFHGERTIENLKKFIE 1446
            LT+  +D+VV +  K   V  YAP C + +++    ++LGE Y    +V++AK+D+  D     R  V+  P +  + K +    +++G R I +  KFIE
Sbjct:   27 LTKDNFDEVV-NGEKFALVEFYAPWCGHCKQLAPTYEQLGEAYTQSSDVIIAKVDADGDRDLGSRFDVKGFPTIKYFPKGSTTPEEYNGGRDINDFIKFIE 126          
BLAST of Protein disulfide-isomerase vs. Ensembl Medaka
Match: p4hb (prolyl 4-hydroxylase subunit beta [Source:NCBI gene;Acc:101155742])

HSP 1 Score: 152.14 bits (383), Expect = 4.941e-48
Identity = 89/306 (29.08%), Postives = 163/306 (53.27%), Query Frame = 1
Query:  571 DDVEFRLLKDAELCQRFNLPTTENSIGIYQYDFGIQHTVSGKLTRNIMNDFIIKHHVPIYSEFSDFIFSKSFVG----HYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENE--GFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMM-FLYLKDTNERIKFHGERTIENLKKFIESNGQDGN 1467
            DDV F +     +  +F + + +  +   ++D G ++T  G+LT++ +  F+  + +P+  EF++    K F G    H   F+P     F     E   + +K A    G+ +FI  D      QR LE   + + E    R++   + +  +KPE+  ++    +++F  Q ++G  +P LM+ +  E+W   P+K L  K +++V  D  KNVF+  YAP C + +++  + DKLGE YKD  ++++AK+DS+ +E+  ++V S P + F    +  + I ++GERT+E   KF+ES G++G 
Sbjct:  178 DDVPFAITSSDAVYSKFEV-SKDGVVLFKKFDEG-RNTFDGELTKDGLLAFVKANQLPLVIEFTEQTAPKIFGGDIKSHILMFLPKAASDF----QEKMEQFKKAAAGFKGQILFIFIDSDVDDNQRILEFFGLKKEECPAIRLITLEDEMTKYKPESK-DITAESIVAFCTQFVEGKLKPHLMSQDIPEDWDKNPVKVLVGKNFEEVAFDPKKNVFIEFYAPWCGHCKQLAPIWDKLGEKYKDSSDIVVAKMDSTANEIESVKVHSFPTLKFFPAGEERQVIDYNGERTLEGFTKFLESGGKEGG 476          

HSP 2 Score: 59.6918 bits (143), Expect = 4.941e-48
Identity = 34/140 (24.29%), Postives = 65/140 (46.43%), Query Frame = 2
Query:  110 IEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRN---KTGVQYLRTQGKEEVIQWLTDRVNYELKPISTLDDGKNTLLNNLLVVFG 520
            I E++  L+L   N+D A + +  ILV FY P C  C      +  AA   K     ++   VDA  E  +A    +   P +KF++    ++  +Y   +  ++++ WL  R    +  ++ + D ++ + +N + V G
Sbjct:   18 IAEEEDVLVLKKSNFDEALQAHPNILVEFYAPWCGHCKALAPEYAKAAGMLKAEGSQIRLGKVDATEETELAQEFGVRGYPTIKFFKGGDKESPKEYSAGRQADDMVNWLKKRTGPAVTSLTEVTDAESLIADNEVAVIG 157          
BLAST of Protein disulfide-isomerase vs. Ensembl Medaka
Match: pdia2 (protein disulfide-isomerase [Source:NCBI gene;Acc:101164281])

HSP 1 Score: 119.783 bits (299), Expect = 6.215e-38
Identity = 87/311 (27.97%), Postives = 155/311 (49.84%), Query Frame = 1
Query:  547 FEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQ-YDFG---IQHTVSGKLTRNIMNDFIIKHH----VPIYSEFSDFIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENEGFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIKFHGERTIENLKKFIESNG 1455
            F+ VA    DVEF +    E+ + + +  T N + +++ +D G    + +   KL ++ + +FI ++     VP   E SD IF+     H   F+    +S    L E K     +A+E  GK ++I  D++   V   L +  + E +   V      ++N   +    +          +V+D TAEP L + E  E+W   P+K L  K ++ V MD TKNVFV  YAP C + +E+  + ++LGE+Y D +++++AK+D++ +E+  + +   P +  +     E I + G R +E L KF+++ G
Sbjct:  217 FKEVAFDLTDVEFAVTASPEVFKEYEV--TANKVVLFKKFDDGRADFELSEEDKLDKHNLTNFIKENSLELIVPFNQETSDKIFTSRVRLHCLLFINSTVESQMSLLEESKT----VAREFKGKVLYILIDMTTA-VSHVLNYFGVLEKDSPTV-----RMINMDTQKKFKI----------EVVDDTAEPYLRSEEIPEDWDKGPVKVLVAKNFETVAMDPTKNVFVEFYAPWCGHCKELAPIWEQLGEIYADHDDIIIAKMDATANEVESVAIDGFPTLKYFPAGDKEVISYTGNRDLETLSKFLDNGG 505          

HSP 2 Score: 58.151 bits (139), Expect = 6.215e-38
Identity = 37/140 (26.43%), Postives = 65/140 (46.43%), Query Frame = 2
Query:  110 IEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRN---KTGVQYLRTQGKEEVIQWLTDRVNYELKPISTLDDGKNTLLNNLLVVFG 520
            IEE+   ++L   N+D A     +++V FY P C  C   + I+  AA   KE    ++ A VDA  EK +A    +++ P +K + N   K  ++Y   +    ++QWL  R       +++ D     +  + + V G
Sbjct:   65 IEEEQGIMVLHINNFDRALSETRHLMVEFYAPWCGYCRRFEPIYAEAAGMLKEEGSEMRLAKVDAIEEKELAEEFNVDSFPTVKLFMNGDRKEPIEYTGKRTPSGIVQWLKRRSGPGAADLNSADSAAEFINTHNVSVVG 204          
BLAST of Protein disulfide-isomerase vs. Ensembl Medaka
Match: pdia2 (protein disulfide-isomerase [Source:NCBI gene;Acc:101164281])

HSP 1 Score: 117.857 bits (294), Expect = 1.195e-37
Identity = 88/315 (27.94%), Postives = 157/315 (49.84%), Query Frame = 1
Query:  547 FEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQ-YDFG---IQHTVSGKLTRNIMNDFIIKHH----VPIYSEFSDFIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENEGFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQ----VMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIKFHGERTIENLKKFIESNG 1455
            F+ VA    DVEF +    E+ + + +  T N + +++ +D G    + +   KL ++ + +FI ++     VP   E SD IF+     H   F+    +S    L E K     +A+E  GK ++I  D++   V   L +  + E +   V      ++N   +    +     +  +RQ    V+D TAEP L + E  E+W   P+K L  K ++ V MD TKNVFV  YAP C + +E+  + ++LGE+Y D +++++AK+D++ +E+  + +   P +  +     E   + G R +E L KF+++ G
Sbjct:  213 FKEVAFDLTDVEFAVTASPEVFKEYEV--TANKVVLFKKFDDGRADFELSEEDKLDKHNLTNFIKENSLELIVPFNQETSDKIFTSRVRLHCLLFINSTVESQMSLLEESKT----VAREFKGKVLYILIDMTTA-VSHVLNYFGVLEKDSPTV-----RMINMDTQKKFKIASEMTIDSLRQLSQEVVDDTAEPYLRSEEIPEDWDKGPVKVLVAKNFETVAMDPTKNVFVEFYAPWCGHCKELAPIWEQLGEIYADHDDIIIAKMDATANEVESVAIDGFPTLKYFPAGDKEV--YTGNRDLETLSKFLDNGG 513          

HSP 2 Score: 58.9214 bits (141), Expect = 1.195e-37
Identity = 37/140 (26.43%), Postives = 65/140 (46.43%), Query Frame = 2
Query:  110 IEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRN---KTGVQYLRTQGKEEVIQWLTDRVNYELKPISTLDDGKNTLLNNLLVVFG 520
            IEE+   ++L   N+D A     +++V FY P C  C   + I+  AA   KE    ++ A VDA  EK +A    +++ P +K + N   K  ++Y   +    ++QWL  R       +++ D     +  + + V G
Sbjct:   61 IEEEQGIMVLHINNFDRALSETRHLMVEFYAPWCGYCRRFEPIYAEAAGMLKEEGSEMRLAKVDAIEEKELAEEFNVDSFPTVKLFMNGDRKEPIEYTGKRTPSGIVQWLKRRSGPGAADLNSADSAAEFINTHNVSVVG 200          
BLAST of Protein disulfide-isomerase vs. Ensembl Medaka
Match: pdia2 (protein disulfide-isomerase [Source:NCBI gene;Acc:101164281])

HSP 1 Score: 124.79 bits (312), Expect = 1.663e-30
Identity = 89/315 (28.25%), Postives = 158/315 (50.16%), Query Frame = 1
Query:  547 FEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQ-YDFG---IQHTVSGKLTRNIMNDFIIKHH----VPIYSEFSDFIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENEGFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQ----VMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIKFHGERTIENLKKFIESNG 1455
            F+ VA    DVEF +    E+ + + +  T N + +++ +D G    + +   KL ++ + +FI ++     VP   E SD IF+     H   F+    +S    L E K     +A+E  GK ++I  D++   V   L +  + E +   V      ++N   +    +     +  +RQ    V+D TAEP L + E  E+W   P+K L  K ++ V MD TKNVFV  YAP C + +E+  + ++LGE+Y D +++++AK+D++ +E+  + +   P +  +     E I + G R +E L KF+++ G
Sbjct:  104 FKEVAFDLTDVEFAVTASPEVFKEYEV--TANKVVLFKKFDDGRADFELSEEDKLDKHNLTNFIKENSLELIVPFNQETSDKIFTSRVRLHCLLFINSTVESQMSLLEESKT----VAREFKGKVLYILIDMTTA-VSHVLNYFGVLEKDSPTV-----RMINMDTQKKFKIASEMTIDSLRQLSQEVVDDTAEPYLRSEEIPEDWDKGPVKVLVAKNFETVAMDPTKNVFVEFYAPWCGHCKELAPIWEQLGEIYADHDDIIIAKMDATANEVESVAIDGFPTLKYFPAGDKEVISYTGNRDLETLSKFLDNGG 406          
BLAST of Protein disulfide-isomerase vs. Ensembl Medaka
Match: pdia2 (protein disulfide-isomerase [Source:NCBI gene;Acc:101164281])

HSP 1 Score: 107.842 bits (268), Expect = 1.313e-24
Identity = 65/232 (28.02%), Postives = 117/232 (50.43%), Query Frame = 1
Query:  760 SDFIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENEGFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIKFHGERTIENLKKFIESNG 1455
            +D IF+     H   F+    +S    L E K     +A+E  GK ++I  D++   V   L +  + E +   V      ++N   +    +     +  +RQ+   + EP L + E  E+W   P+K L  K ++ V MD TKNVFV  YAP C + +E+  + ++LGE+Y D +++++AK+D++ +E+  + +   P +  +     E I + G R +E L KF+++ G
Sbjct:  224 ADKIFTSRVRLHCLLFINSTVESQMSLLEESKT----VAREFKGKVLYILIDMTTA-VSHVLNYFGVLEKDSPTV-----RMINMDTQKKFKIASEMTIDSLRQL---SQEPYLRSEEIPEDWDKGPVKVLVAKNFETVAMDPTKNVFVEFYAPWCGHCKELAPIWEQLGEIYADHDDIIIAKMDATANEVESVAIDGFPTLKYFPAGDKEVISYTGNRDLETLSKFLDNGG 442          

HSP 2 Score: 50.0618 bits (118), Expect = 4.551e-6
Identity = 30/101 (29.70%), Postives = 49/101 (48.51%), Query Frame = 2
Query:  110 IEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNKTGVQYLRTQGKE 412
            IEE+   ++L   N+D A     +++V FY P C  C   + I+  AA   KE    ++ A VDA  EK +A    +++ P +K + N    + +   G E
Sbjct:   65 IEEEQGIMVLHINNFDRALSETRHLMVEFYAPWCGYCRRFEPIYAEAAGMLKEEGSEMRLAKVDAIEEKELAEEFNVDSFPTVKLFMNGDRKEPIEYTGNE 165          
BLAST of Protein disulfide-isomerase vs. Planmine SMEST
Match: SMESG000078546.1 (SMESG000078546.1)

HSP 1 Score: 696.427 bits (1796), Expect = 0.000e+0
Identity = 337/344 (97.97%), Postives = 340/344 (98.84%), Query Frame = 1
Query:  511 CVRMHFVDDIKDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQYDFGIQHTVSGKLTRNIMNDFIIKHHVPIYSEFSDFIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENEGFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIKFHGERTIENLKKFIESNGQDGNEQQFLEIDHLQHARLTENGLVHEEL 1542
            C+  + V+DIKDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQYDFGIQHTVSGKLTR IMNDFIIKHHVPIYSEFSDFIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENEGFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIKFHGERTIENLKKFIESNGQDGNEQQFLEIDHLQHARLTENGLVHEEL
Sbjct:  164 CILSNSVEDIKDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQYDFGIQHTVSGKLTRKIMNDFIIKHHVPIYSEFSDFIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENEGFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIKFHGERTIENLKKFIESNGQDGNEQQFLEIDHLQHARLTENGLVHEEL 507          

HSP 2 Score: 350.132 bits (897), Expect = 6.127e-115
Identity = 168/182 (92.31%), Postives = 172/182 (94.51%), Query Frame = 2
Query:   32 MSKSLITFALFSLSLSFYCNGDEIPIIEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNKTGVQYLRTQGKEEVIQWLTDRVNYELKPISTLDDGKNTLLNNLLVVFGCIL*MILRTLKSWPVCMMM 577
            MSKSLITFALFSLSLSFYCNGDEIPIIEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNKTGVQYLRTQGKEEVIQWLTDRVNYELKPISTLDDGKNTLLNNLLVVFGCIL   +  +K + +   M
Sbjct:    1 MSKSLITFALFSLSLSFYCNGDEIPIIEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNKTGVQYLRTQGKEEVIQWLTDRVNYELKPISTLDDGKNTLLNNLLVVFGCILSNSVEDIKDFEIVASM 182          
BLAST of Protein disulfide-isomerase vs. Planmine SMEST
Match: SMESG000023147.1 (SMESG000023147.1)

HSP 1 Score: 166.392 bits (420), Expect = 8.018e-56
Identity = 93/306 (30.39%), Postives = 166/306 (54.25%), Query Frame = 1
Query:  541 KDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQYDFGIQHTVSGKLTRNIMNDFIIKHHVPIYSEFSDFIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENE--GFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIKFHGERTIENLKKFIESN 1452
            K FE VA   DDV F +     +   F + + ++ +   ++D G ++  +G      +  FI K+ +PI  EF+     K F G     V            E+K +    AK+  G+ +F+  +  ++   R LE   + + +   FR+++  + +V FKP++   ++   +  F++ V+DG  +P +M  E  E+W   P+K L  K +D V  DK+K VFV  YAP C + +++  + D+LGE YKD+ ++++AK+DS+ +E+  +R++S P +  + KD++E + F G+RT+E  KKFI+SN
Sbjct:  167 KAFESVADSKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEG-RNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDA-TISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRTLETFKKFIDSN 470          

HSP 2 Score: 70.8626 bits (172), Expect = 8.018e-56
Identity = 43/158 (27.22%), Postives = 80/158 (50.63%), Query Frame = 2
Query:   47 ITFALFSLSLSFYCNGDEIPIIEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNKTGVQYLRTQGKEEVIQWLTDRVNYELKPISTLDDGKNTLLNNLLVVFG 520
            ++  LF  +L+  CN D    I E++  L+LT+ N++   +  +Y+LV FY P C  C      +  AA+  KE    +K A VDA  E  +A+  +I+  P +KF+++   + Y   +  + +I WL  +       + ++++ K  + +  +VV G
Sbjct:    4 LSIVLFCFALA-QCNAD----ITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVG 156          
BLAST of Protein disulfide-isomerase vs. Planmine SMEST
Match: SMESG000009885.1 (SMESG000009885.1)

HSP 1 Score: 102.064 bits (253), Expect = 2.991e-27
Identity = 81/323 (25.08%), Postives = 158/323 (48.92%), Query Frame = 1
Query:  541 KDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQYD-----FGIQHTVSGKLTRNIMNDFIIKHHVPIYSEFSDF------IFSKSFVGHYHYFVPII---FKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPENE--GFRVVE--SSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIKFHGERTIENLKKFIESNG 1455
            K F+ VA   + + + ++ +  L   +++   ++ +   Q+D     F ++ T      +N+  +FIIK+  P+ SEF +       IF  + +   +Y V II    K F +     K  ++K AK   GK  F++  +       FL  L + + +   +R +E       V ++P +   +    +++F++ V+DG   P   + +  + W+  P+K L    Y++VV ++ ++VFV++ A  C    ++  +   L   ++D   V +A +D   +++   RV   P  FLY K + + I+F GERT+ +LK+F++SNG
Sbjct:  165 KTFQKVAKSTEKLPWIIVTNETLFNVYSIRLDDSIVMFRQFDDPRIDFAVEFT-----EKNV-KEFIIKYSSPLLSEFHNRKRKIPEIFDTAIL---NYLVSIIDEKHKKFTL----HKMMLQKSAKLFLGKVKFVYVKLDNPATHYFLTVLRLNKEDIPTYRFMELFPDYRTVIYRPVDE-KMTAKRIVTFVQNVLDGNLSPYYRSEKLHQRWNKYPVKMLVGSNYEEVVKNENRSVFVLLCAEKCKQCSKLRHMWHNLAIQFQDQPEVWIATIDVDKNDIRNARVEKFPTFFLYPKGSQKAIEFDGERTLNDLKQFVDSNG 473          

HSP 2 Score: 39.2762 bits (90), Expect = 2.991e-27
Identity = 33/159 (20.75%), Postives = 60/159 (37.74%), Query Frame = 2
Query:   44 LITFALFSLSLSFYCNGDEIPIIEEDDHCLLLTDQNWDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVDAANEKTIATLEQIETVPVMKFYRNKTGVQYLRTQGKEEVIQWLTDRVNYELKPISTLDDGKNTLLNNLLVVFG 520
            +I F +F +S+          I E   H   L   N      + +++LV FY   C+QC   +  F   AK   + +  V    ++      I     I  +P +K ++      Y   +      QW+ +R++ E   +  L+  K  +   L +  G
Sbjct:    1 MINFWIFGISVGLVHT-----IYENFPHVKPLDSVNLKKRILLEKFVLVNFYATKCEQCVEFESTFSLVAKMLTDIRPDVYIGSLNCFENTQIMREYDIPNIPSVKLFQKTRSFDYRAVESTLRFAQWVFERMDEEFIIVDRLEILKELVETELFMAVG 154          
BLAST of Protein disulfide-isomerase vs. Planmine SMEST
Match: SMESG000069732.1 (SMESG000069732.1)

HSP 1 Score: 102.449 bits (254), Expect = 4.426e-23
Identity = 77/303 (25.41%), Postives = 146/303 (48.18%), Query Frame = 1
Query:  556 VASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQYDFGIQHTVSGKLTRNIMNDFIIKHHVPIYSEFSDFIFSKSFVGHYHYFVPIIFKSFPIPLNEMKAEIRKIAKELDGKAI------FIHFDISKKKVQRFLEHLSIP-ENEGFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIKFHGERTIENLKKFI 1443
             A + DDV+F  ++       F+      +I I + D  +     G++ +  +  F+  + +P    +S  I  K F   + +   ++F         M  +  +  KEL+  AI      F+  D++       ++H ++   N    V+  ++H   F P     +NG  +  F+  V +G     L +    ENW+ EP+K L  K +++V ++K K VFV  YAP C Y +++  + ++L +   D  ++++AKLD + +++    ++S P + L+LKD+NE + + G RT E LK+F+
Sbjct:  169 AAELIDDVQFATMEKHLFHSLFSNTDQTKAILIRKIDNNLIPFGKGEINQEDVIKFVRSNEIPSVVRYSFDIGGKVFQNSHRFMHFMVF---------MDDKFEEAHKELEEAAINHPEITFVMTDVTDNTTSSLIKHFNVDLSNLPHLVLSDAKHKRLFLPGFN-EINGKRIDQFLMDVKNGKIGQFLKSQNIPENWNSEPVKILVGKNFEEVALNKQKTVFVEFYAPWCNYCKQLEPIWERLAKELLDVPDLIIAKLDKTENDIKNFEIKSFPTLKLFLKDSNEVVDYSGPRTRERLKEFL 461          
BLAST of Protein disulfide-isomerase vs. Planmine SMEST
Match: SMESG000074835.1 (SMESG000074835.1)

HSP 1 Score: 88.1965 bits (217), Expect = 1.645e-18
Identity = 53/197 (26.90%), Postives = 101/197 (51.27%), Query Frame = 1
Query:  877 KELDGKAIFIHFDI-SKKKVQRFLE--HLSIPENEGFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIKFHGERTIENLKKFIESNGQ 1458
            K + GKAI I FDI +   +   L    L+I +   F  V+  +      P    ++   ++L    ++ +G+  P   +     NW+   +  L  + Y  V  +K   V V  Y+P C +S  + ++ ++LGE YK+  +++++K++S+++E+    + STP +FLY K     ++F  ER + N  +FIE++G+
Sbjct:  181 KTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSITSEHILKLFEKIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNFTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSVFLYRKTNKIPLRFENERNLNNFIEFIENDGK 377          
The following BLAST results are available for this feature:
BLAST of Protein disulfide-isomerase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
P4HB1.507e-5030.38prolyl 4-hydroxylase subunit beta [Source:HGNC Sym... [more]
P4HB3.636e-4130.38prolyl 4-hydroxylase subunit beta [Source:HGNC Sym... [more]
P4HB2.135e-3631.27prolyl 4-hydroxylase subunit beta [Source:HGNC Sym... [more]
PDIA21.749e-3125.00protein disulfide isomerase family A member 2 [Sou... [more]
PDIA21.779e-3125.00protein disulfide isomerase family A member 2 [Sou... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdi-27.630e-5129.02Protein disulfide-isomerase 2 [Source:UniProtKB/S... [more]
pdi-27.630e-5129.02Protein disulfide-isomerase 2 [Source:UniProtKB/S... [more]
pdi-21.134e-3629.12Protein disulfide-isomerase 2 [Source:UniProtKB/S... [more]
pdi-21.134e-3629.12Protein disulfide-isomerase 2 [Source:UniProtKB/S... [more]
pdi-16.627e-3625.00Protein disulfide-isomerase 1 [Source:UniProtKB/S... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Pdi2.007e-4125.47gene:FBgn0286818 transcript:FBtr0346644[more]
Pdi2.007e-4125.47gene:FBgn0286818 transcript:FBtr0075648[more]
ERp602.688e-1026.32gene:FBgn0033663 transcript:FBtr0088058[more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p4hb7.211e-4930.00prolyl 4-hydroxylase, beta polypeptide [Source:ZFI... [more]
p4hb7.211e-4930.00prolyl 4-hydroxylase, beta polypeptide [Source:ZFI... [more]
pdia24.218e-3228.57protein disulfide isomerase family A, member 2 [So... [more]
pdia24.443e-3228.80protein disulfide isomerase family A, member 2 [So... [more]
pdia41.374e-1327.89protein disulfide isomerase family A, member 4 [So... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p4hb6.276e-4728.36prolyl 4-hydroxylase subunit beta [Source:NCBI gen... [more]
p4hb1.248e-4628.36prolyl 4-hydroxylase subunit beta [Source:NCBI gen... [more]
p4hb3.454e-4628.14prolyl 4-hydroxylase subunit beta [Source:NCBI gen... [more]
p4hb1.226e-3928.36prolyl 4-hydroxylase subunit beta [Source:NCBI gen... [more]
p4hb1.292e-3928.36prolyl 4-hydroxylase subunit beta [Source:NCBI gen... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
P4hb3.595e-4930.50prolyl 4-hydroxylase, beta polypeptide [Source:MGI... [more]
Pdia23.538e-2925.24protein disulfide isomerase associated 2 [Source:M... [more]
Pdia23.567e-2925.24protein disulfide isomerase associated 2 [Source:M... [more]
Pdia25.121e-1935.71protein disulfide isomerase associated 2 [Source:M... [more]
Pdilt1.985e-1827.85protein disulfide isomerase-like, testis expressed... [more]
back to top
BLAST of Protein disulfide-isomerase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P05307|PDIA1_BOVIN4.282e-5130.38Protein disulfide-isomerase OS=Bos taurus OX=9913 ... [more]
sp|P09102|PDIA1_CHICK1.267e-5030.50Protein disulfide-isomerase OS=Gallus gallus OX=90... [more]
sp|Q2HWU2|PDIA1_MACFU3.177e-5030.70Protein disulfide-isomerase OS=Macaca fuscata fusc... [more]
sp|P07237|PDIA1_HUMAN6.585e-5030.38Protein disulfide-isomerase OS=Homo sapiens OX=960... [more]
sp|Q17770|PDI2_CAEEL7.904e-5029.02Protein disulfide-isomerase 2 OS=Caenorhabditis el... [more]
back to top
BLAST of Protein disulfide-isomerase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A455LAR44.628e-5430.13Protein disulfide-isomerase OS=Habrobracon hebetor... [more]
R7VJ395.646e-5432.39Protein disulfide-isomerase OS=Capitella teleta OX... [more]
A0A2I9LPF07.004e-5432.17Protein disulfide-isomerase OS=Centruroides hentzi... [more]
A0A1I8HRX22.752e-5229.07Protein disulfide-isomerase OS=Macrostomum lignano... [more]
A0A0K0FC498.777e-5229.47Protein disulfide-isomerase OS=Strongyloides venez... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p4hb1.057e-4931.25prolyl 4-hydroxylase subunit beta [Source:NCBI gen... [more]
pdia22.212e-3727.27protein disulfide isomerase family A, member 2 [So... [more]
zgc:1364729.884e-2522.15protein disulfide-isomerase-like [Source:NCBI gene... [more]
zgc:1364721.444e-2421.59protein disulfide-isomerase-like [Source:NCBI gene... [more]
zgc:1364725.613e-2422.44protein disulfide-isomerase-like [Source:NCBI gene... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000002052.14.063e-1621.48pep scaffold:Pmarinus_7.0:GL480798:2613:20969:-1 g... [more]
pdia48.373e-1329.27protein disulfide isomerase family A, member 4 [So... [more]
pdia32.874e-1027.46protein disulfide isomerase family A, member 3 [So... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
EUG12.181e-627.57Protein disulfide isomerase of the endoplasmic ret... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO368309.286e-4927.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO338434.889e-1731.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329304.349e-1529.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316342.462e-925.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473409.782e-830.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p4hb4.941e-4829.08prolyl 4-hydroxylase subunit beta [Source:NCBI gen... [more]
pdia26.215e-3827.97protein disulfide-isomerase [Source:NCBI gene;Acc:... [more]
pdia21.195e-3727.94protein disulfide-isomerase [Source:NCBI gene;Acc:... [more]
pdia21.663e-3028.25protein disulfide-isomerase [Source:NCBI gene;Acc:... [more]
pdia21.313e-2428.02protein disulfide-isomerase [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078546.16.127e-11597.97SMESG000078546.1[more]
SMESG000023147.18.018e-5630.39SMESG000023147.1[more]
SMESG000009885.12.991e-2725.08SMESG000009885.1[more]
SMESG000069732.14.426e-2325.41SMESG000069732.1[more]
SMESG000074835.11.645e-1826.90SMESG000074835.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014062 ID=SMED30014062|Name=Protein disulfide-isomerase|organism=Schmidtea mediterranea sexual|type=transcript|length=1591bp
CTTGATTTTTGTTTTTCACCACAATTTCATTATGTCAAAATCTCTCATTA
CTTTTGCATTATTTAGTCTAAGTCTCTCATTTTATTGTAATGGAGACGAA
ATTCCTATTATTGAAGAAGATGATCACTGTCTCCTTTTAACTGATCAAAA
CTGGGATTATGCTCATAAAATTTATGAATATATATTGGTATTTTTCTACA
AACCAGATTGCGATCAGTGTACACTTTCAGACGAAATATTTGTTTACGCA
GCCAAGCATGCAAAAGAAACAAAACATACCGTAAAATTTGCATTTGTAGA
TGCTGCTAACGAAAAAACAATAGCGACATTGGAACAGATTGAAACTGTGC
CGGTTATGAAATTTTATCGAAACAAGACGGGAGTCCAATATTTACGTACA
CAGGGAAAAGAAGAAGTAATTCAATGGCTGACGGATCGCGTGAATTATGA
ACTGAAACCAATAAGTACGCTTGATGACGGAAAAAACACATTGTTAAATA
ATCTACTTGTTGTGTTCGGATGCATTTTGTAGATGATATTAAGGACTTTG
AAATCGTGGCCAGTATGCATGATGATGTTGAATTCAGACTGTTGAAAGAC
GCAGAACTCTGCCAGCGTTTTAACCTTCCAACAACTGAAAATTCAATTGG
GATTTACCAATACGATTTCGGCATCCAGCATACGGTGTCAGGCAAGCTAA
CGAGAAACATAATGAATGATTTCATTATCAAACATCATGTTCCTATTTAT
TCCGAATTTTCTGATTTCATCTTCAGCAAATCTTTTGTCGGCCATTATCA
TTATTTTGTTCCAATCATTTTCAAATCGTTTCCCATTCCTCTGAATGAAA
TGAAAGCAGAAATACGAAAAATTGCTAAAGAATTGGACGGAAAAGCTATT
TTCATTCATTTTGACATTAGTAAAAAGAAAGTACAAAGATTTCTTGAACA
TTTGAGTATTCCAGAAAACGAAGGTTTCCGAGTAGTGGAAAGCAGTGAAC
ATCTAGTTAATTTTAAACCGGAAAATCCATTGAATTTGAATGGAACGTAT
ATGCTTTCATTTATTAGACAGGTTATGGATGGAACCGCAGAGCCTGAACT
AATGGCATCTGAACCCAGAGAAAATTGGCACTTAGAACCTATTAAGCATC
TCACTCGAAAAACTTATGATCAAGTTGTTATGGACAAAACAAAAAATGTT
TTTGTTATTATTTACGCACCAGACTGCCCTTACAGTAGAGAAATGCTAGA
GCTTTTAGATAAACTTGGAGAAATGTATAAAGATGACGAAAACGTATTAT
TAGCCAAACTAGATTCGTCTGTTGACGAACTACCTAGAATAAGAGTGCGG
AGTACACCAATGATGTTTCTTTATCTTAAAGATACAAATGAAAGAATAAA
ATTTCATGGAGAAAGAACGATAGAAAATTTAAAGAAATTCATAGAAAGTA
ATGGACAAGATGGAAATGAACAACAATTCTTGGAGATAGACCACTTGCAG
CATGCTCGACTGACAGAAAATGGTTTAGTTCACGAGGAATTGTAATGAAA
TTCTCTTGGAATATTAATAAAATTGAACTGTTGCTGAGTCA
back to top

protein sequence of SMED30014062-orf-1

>SMED30014062-orf-1 ID=SMED30014062-orf-1|Name=SMED30014062-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=177bp
LIFVFHHNFIMSKSLITFALFSLSLSFYCNGDEIPIIEEDDHCLLLTDQN
WDYAHKIYEYILVFFYKPDCDQCTLSDEIFVYAAKHAKETKHTVKFAFVD
AANEKTIATLEQIETVPVMKFYRNKTGVQYLRTQGKEEVIQWLTDRVNYE
LKPISTLDDGKNTLLNNLLVVFGCIL*
back to top

protein sequence of SMED30014062-orf-2

>SMED30014062-orf-2 ID=SMED30014062-orf-2|Name=SMED30014062-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=342bp
MHFVDDIKDFEIVASMHDDVEFRLLKDAELCQRFNLPTTENSIGIYQYDF
GIQHTVSGKLTRNIMNDFIIKHHVPIYSEFSDFIFSKSFVGHYHYFVPII
FKSFPIPLNEMKAEIRKIAKELDGKAIFIHFDISKKKVQRFLEHLSIPEN
EGFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPR
ENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLG
EMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIKFHGERT
IENLKKFIESNGQDGNEQQFLEIDHLQHARLTENGLVHEEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR036249Thioredoxin-like_sf
IPR012336Thioredoxin-like_fold
IPR013766Thioredoxin_domain
Vocabulary: biological process
TermDefinition
GO:0045454cell redox homeostasis
GO:0006457protein folding
GO:0018401peptidyl-proline hydroxylation to 4-hydroxy-L-proline
GO:0034976response to endoplasmic reticulum stress
GO:1902175regulation of oxidative stress-induced intrinsic apoptotic signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0003756protein disulfide isomerase activity
GO:0004656procollagen-proline 4-dioxygenase activity
GO:0016853isomerase activity
GO:0046982protein heterodimerization activity
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005788endoplasmic reticulum lumen
GO:0005886plasma membrane
GO:0016020membrane
GO:0042470melanosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF13848Thioredoxin_6coord: 7..170
e-value: 2.7E-12
score: 47.0
NoneNo IPR availablePANTHERPTHR18929PROTEIN DISULFIDE ISOMERASEcoord: 5..324
NoneNo IPR availablePANTHERPTHR18929:SF101PROTEIN DISULFIDE-ISOMERASEcoord: 5..324
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 3..78
e-value: 3.5E-6
score: 29.2
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 79..200
e-value: 1.9E-10
score: 43.2
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 201..317
e-value: 3.0E-24
score: 87.2
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 207..312
IPR013766Thioredoxin domainPFAMPF00085Thioredoxincoord: 208..309
e-value: 4.6E-11
score: 42.6
IPR013766Thioredoxin domainPROSITEPS51352THIOREDOXIN_2coord: 185..313
score: 10.662