Cationic amino acid transporter 4

Overview
NameCationic amino acid transporter 4
Smed IDSMED30014053
Length (bp)1940
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cationic amino acid transporter 4 (SMED30014053) t-SNE clustered cells

Violin plots show distribution of expression levels for Cationic amino acid transporter 4 (SMED30014053) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cationic amino acid transporter 4 (SMED30014053) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cationic amino acid transporter 4 (SMED30014053) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014053

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30014053SMESG000081300.1 dd_Smed_v4_11305_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30014053SMESG000081300.1 dd_Smed_v4_11305_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30014053SMESG000081298.1 SMESG000023765.1 SMESG000016276.1 SMESG000004841.1 dd_Smed_v4_8652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014053SMESG000081298.1 SMESG000023765.1 SMESG000016276.1 SMESG000004841.1 dd_Smed_v4_8652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014053SMESG000081298.1 SMESG000023765.1 SMESG000016276.1 SMESG000004841.1 dd_Smed_v4_8652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30014053SMESG000081298.1 SMESG000023765.1 SMESG000016276.1 SMESG000004841.1 dd_Smed_v4_8652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014053SMESG000081298.1 SMESG000023765.1 SMESG000016276.1 SMESG000004841.1 dd_Smed_v4_8652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30014053SMESG000001671.1 SMESG000001665.1 SMESG000001662.1 SMESG000001654.1 SMESG000001642.1 Contig4458GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30014053SMESG000081298.1 Contig4458GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30014053SMESG000081300.1 dd_Smed_v4_11305_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30014053SMESG000081300.1 dd_Smed_v4_11305_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cationic amino acid transporter 4 vs. Ensembl Human
Match: SLC7A1 (solute carrier family 7 member 1 [Source:HGNC Symbol;Acc:HGNC:11057])

HSP 1 Score: 235.343 bits (599), Expect = 4.519e-68
Identity = 138/430 (32.09%), Postives = 233/430 (54.19%), Query Frame = 2
Query:  137 VLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY------FAD------------------GGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            VL +    + RR+    S+  ET+L+RCL+T  L+  G+   +GAG+YVL G + ++  G A  +SFL + L S+  GLCY EF   +PK GS Y Y+Y+ +GEL AFI GW +I+   I  SS+A+ +S   + L    +  F+  ++ L     + +   D+ A++++  L  L   G   S  +N +   + ++ L  I++S FV G+ +N+      F +                  GG++PFG + +  GA    YA+ GF+C++ + EE K P+K+IP  +  SL I  + Y   S  L+ M+P   ++ N+P   AF        K+   + +L A  AS L +++ +PR+IYAMAEDGLLF+FL  VN+ +K P  A +     + ++A    ++ L ++ S+G ++++ +V   +++LRY
Sbjct:    5 VLLNIGQQMLRRKVVDCSRE-ETRLSRCLNTFDLVALGVGSTLGAGVYVLAGAVARENAGPAIVISFLIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILSYIIGTSSVARAWSATFDELIGRPIGEFSRTHMTLNAPGVLAENP-DIFAVIIILILTGLLTLGVKESAMVNKIFTCINVLVLGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLNNDTKEGKPGVGGFMPFGFSGVLSGAATCFYAFVGFDCIATTGEEVKNPQKAIPVGIVASLLICFIAYFGVSAALTLMMPYFCLDNNSPLPDAFKHVGWEGAKYAVAVGSLCALSASLLGSMFPMPRVIYAMAEDGLLFKFLANVNDRTKTPIIATLASGAVAAVMAFLFDLKDLVDLMSIGTLLAYSLVAACVLVLRY 432          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Human
Match: SLC7A3 (solute carrier family 7 member 3 [Source:HGNC Symbol;Acc:HGNC:11061])

HSP 1 Score: 233.032 bits (593), Expect = 2.419e-67
Identity = 139/427 (32.55%), Postives = 228/427 (53.40%), Query Frame = 2
Query:  143 HSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAV-NLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY----------------------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
              F   + RRR+  +S   ET+L RCLST  L+  G+   +GAG+YVL G + KD+ G +  + FL + L S+  GLCY EF   +P++GS Y Y+Y+ +GEL AF  GW +I+   I  +S+A+ +S A  NL+ N+  K          P   +     D  AL L+  L  L   GA+ S  +  V   + L+ L  ++IS FV G+  N+                         GG++PFG   I +GA    YA+ GF+C++ + EE + P++SIP  + +SL +  + Y   S+ L+ M+P  Q+   +P   AF        +++  + +L A   S L +++ +PR+IYAMAEDGLLFR L +++  ++ P  A VV  + +  +A   ++  L ++ S+G ++++ +V + ++ILRY
Sbjct:    7 RRFGQKLVRRRTL-ESGMAETRLARCLSTLDLVALGVGSTLGAGVYVLAGEVAKDKAGPSIVICFLVAALSSVLAGLCYAEFGARVPRSGSAYLYSYVTVGELWAFTTGWNLILSYVIGTASVARAWSSAFDNLIGNHISKTLQGSIALHVP--HVLAEYPDFFALGLVLLLTGLLALGASESALVTKVFTGVNLLVLGFVMISGFVKGDVHNWKLTEEDYELAMAELNDTYSLGPLGSGGFVPFGFEGILRGAATCFYAFVGFDCIATTGEEAQNPQRSIPMGIVISLSVCFLAYFAVSSALTLMMPYYQLQPESPLPEAFLYIGWAPARYVVAVGSLCALSTSLLGSMFPMPRVIYAMAEDGLLFRVLARIHTGTRTPIIATVVSGIIAAFMAFLFKLTDLVDLMSIGTLLAYSLVSICVLILRY 430          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Human
Match: SLC7A3 (solute carrier family 7 member 3 [Source:HGNC Symbol;Acc:HGNC:11061])

HSP 1 Score: 233.032 bits (593), Expect = 2.419e-67
Identity = 139/427 (32.55%), Postives = 228/427 (53.40%), Query Frame = 2
Query:  143 HSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAV-NLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY----------------------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
              F   + RRR+  +S   ET+L RCLST  L+  G+   +GAG+YVL G + KD+ G +  + FL + L S+  GLCY EF   +P++GS Y Y+Y+ +GEL AF  GW +I+   I  +S+A+ +S A  NL+ N+  K          P   +     D  AL L+  L  L   GA+ S  +  V   + L+ L  ++IS FV G+  N+                         GG++PFG   I +GA    YA+ GF+C++ + EE + P++SIP  + +SL +  + Y   S+ L+ M+P  Q+   +P   AF        +++  + +L A   S L +++ +PR+IYAMAEDGLLFR L +++  ++ P  A VV  + +  +A   ++  L ++ S+G ++++ +V + ++ILRY
Sbjct:    7 RRFGQKLVRRRTL-ESGMAETRLARCLSTLDLVALGVGSTLGAGVYVLAGEVAKDKAGPSIVICFLVAALSSVLAGLCYAEFGARVPRSGSAYLYSYVTVGELWAFTTGWNLILSYVIGTASVARAWSSAFDNLIGNHISKTLQGSIALHVP--HVLAEYPDFFALGLVLLLTGLLALGASESALVTKVFTGVNLLVLGFVMISGFVKGDVHNWKLTEEDYELAMAELNDTYSLGPLGSGGFVPFGFEGILRGAATCFYAFVGFDCIATTGEEAQNPQRSIPMGIVISLSVCFLAYFAVSSALTLMMPYYQLQPESPLPEAFLYIGWAPARYVVAVGSLCALSTSLLGSMFPMPRVIYAMAEDGLLFRVLARIHTGTRTPIIATVVSGIIAAFMAFLFKLTDLVDLMSIGTLLAYSLVSICVLILRY 430          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Human
Match: SLC7A2 (solute carrier family 7 member 2 [Source:HGNC Symbol;Acc:HGNC:11060])

HSP 1 Score: 226.483 bits (576), Expect = 1.612e-64
Identity = 139/430 (32.33%), Postives = 223/430 (51.86%), Query Frame = 2
Query:  146 SFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPL--TPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY-------------------------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            +F   + RR+  +     +TKL RCLST  LI  G+   +GAG+YVL G + K   G +  +SFL + L S+  GLCY EF   +PK GS Y YTY+ +GEL AFI GW +I+   I  SS+A+ +SG  + L +  +  F   Y  +  T  +E      D  A+ L+  L  L   G   S  +N V  A+ ++ L  ++++ FV GN  N+                         +  GG++P+G      GA    YA+ GF+C++ + EE + P+K+IP  +  SL +  + Y   S  L+ M+P   ++E +P   AF        K++    +L A   S L +I+ +PR+IYAMAEDGLLF+ L ++N  +K P  A +     + ++A    ++ L ++ S+G ++++ +V   ++ILRY
Sbjct:    9 TFARCLIRRKIVTLDSLEDTKLCRCLSTMDLIALGVGSTLGAGVYVLAGEVAKADSGPSIVVSFLIAALASVMAGLCYAEFGARVPKTGSAYLYTYVTVGELWAFITGWNLILSYVIGTSSVARAWSGTFDELLSKQIGQFLRTYFRMNYTGLAEY----PDFFAVCLILLLAGLLSFGVKESAWVNKVFTAVNILVLLFVMVAGFVKGNVANWKISEEFLKNISASAREPPSENGTSIYGAGGFMPYGFTGTLAGAATCFYAFVGFDCIATTGEEVRNPQKAIPIGIVTSLLVCFMAYFGVSAALTLMMPYYLLDEKSPLPVAFEYVGWGPAKYVVAAGSLCALSTSLLGSIFPMPRVIYAMAEDGLLFKCLAQINSKTKTPIIATLSSGAVAALMAFLFDLKALVDMMSIGTLMAYSLVAACVLILRY 434          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Human
Match: SLC7A2 (solute carrier family 7 member 2 [Source:HGNC Symbol;Acc:HGNC:11060])

HSP 1 Score: 226.483 bits (576), Expect = 1.612e-64
Identity = 139/430 (32.33%), Postives = 223/430 (51.86%), Query Frame = 2
Query:  146 SFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPL--TPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY-------------------------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            +F   + RR+  +     +TKL RCLST  LI  G+   +GAG+YVL G + K   G +  +SFL + L S+  GLCY EF   +PK GS Y YTY+ +GEL AFI GW +I+   I  SS+A+ +SG  + L +  +  F   Y  +  T  +E      D  A+ L+  L  L   G   S  +N V  A+ ++ L  ++++ FV GN  N+                         +  GG++P+G      GA    YA+ GF+C++ + EE + P+K+IP  +  SL +  + Y   S  L+ M+P   ++E +P   AF        K++    +L A   S L +I+ +PR+IYAMAEDGLLF+ L ++N  +K P  A +     + ++A    ++ L ++ S+G ++++ +V   ++ILRY
Sbjct:    9 TFARCLIRRKIVTLDSLEDTKLCRCLSTMDLIALGVGSTLGAGVYVLAGEVAKADSGPSIVVSFLIAALASVMAGLCYAEFGARVPKTGSAYLYTYVTVGELWAFITGWNLILSYVIGTSSVARAWSGTFDELLSKQIGQFLRTYFRMNYTGLAEY----PDFFAVCLILLLAGLLSFGVKESAWVNKVFTAVNILVLLFVMVAGFVKGNVANWKISEEFLKNISASAREPPSENGTSIYGAGGFMPYGFTGTLAGAATCFYAFVGFDCIATTGEEVRNPQKAIPIGIVTSLLVCFMAYFGVSAALTLMMPYYLLDEKSPLPVAFEYVGWGPAKYVVAAGSLCALSTSLLGSIFPMPRVIYAMAEDGLLFKCLAQINSKTKTPIIATLSSGAVAALMAFLFDLKALVDMMSIGTLMAYSLVAACVLILRY 434          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Celegans
Match: B0454.6 (pep chromosome:WBcel235:II:3032780:3036122:1 gene:WBGene00015197.1 transcript:B0454.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:B0454.6)

HSP 1 Score: 248.44 bits (633), Expect = 1.050e-73
Identity = 135/406 (33.25%), Postives = 235/406 (57.88%), Query Frame = 2
Query:  155 HSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFT-DRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNYF---ADGG--YLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
             +ITR++ F     L++ L RCL    + F  +  M+GAGIYVLTG +++++ G +   SF  +G+ ++ +   Y EF    P+AGS YTYTY+  GEL AFI+GWT+ ++  I  +++A+ +S   + + +N +KN T      L+     + T  D+++ LL+     +   G  +S N+N+    L ++ +  +I+S   Y +  N+    +DG   + PFG+     GA    ++Y GFE L+ + EE K P ++IP A F+S+G+++ LY+L S+ L+ MVP  Q++  APF  AF+ +    + ++  I  L+    + +  ++ +PR +YAMA+DGL+F++L  V  S+KVP NA+V+  L + I+A+   I+ L E  S+G + ++  V   +++LRY
Sbjct:    7 QAITRKKRFEGDSHLDSNLRRCLGLMDITFLALGQMMGAGIYVLTGTVVRNQAGPSIIFSFALAGIAALLSAFSYAEFGARFPRAGSAYTYTYIGFGELWAFIVGWTIPLEYMIGNAAVARSWSAYFDNMLDNYIKNTTIGALGELSEPGGFFSTYPDILSFLLICLCACVIAVGPKVSANVNSSFVVLNIVVIFIVIVSGICYADFNNWTGTTSDGRSMFFPFGLTGTLTGAATCFFSYIGFEVLATAGEEVKSPHRTIPVATFLSIGVIMTLYILVSSTLTLMVPYDQVHTTAPFAEAFSARGCTTVMYIISIGALIGLTNNLVTGVFALPRAVYAMADDGLIFKWLAHVTSSTKVPLNAIVIFTLLNAIIALIFDIEALVEFLSIGTLFAYSFVSGSVLVLRY 412          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Celegans
Match: C50D2.2 (pep chromosome:WBcel235:II:109165:111429:1 gene:WBGene00016806.1 transcript:C50D2.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C50D2.2)

HSP 1 Score: 248.054 bits (632), Expect = 1.385e-73
Identity = 145/409 (35.45%), Postives = 226/409 (55.26%), Query Frame = 2
Query:  158 SITRRRSFS----QSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFT-DRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQL-----IFLTTIIISCFVYGNSQNYFADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            S  R R F      +  + T L RCLST  +   G+ HMIGAGIYVLTG ++++  G +  LSFL +G  S+ + LCY EF    PKAGS YTYTY+ +GEL AF+IGW +I++  +  +++A+ +SG ++ L  N + N T  R   L   S  +    DL+A LL+  +      G+ +S N N+ L  L +     +    I  + F   +  +   +  + P+GV+ +F GA    +AY GF+ L+ + EE K+P +SIP A F S+ IV + YVL S  L+ M+P   ++  A F  AFT +      +   +  L     S +  ++ +PR +++MA+DGLLF  L  VN  ++VPT AL++    + I+A+   I  L E  S+G ++++ IV   +I+LRY
Sbjct:    4 SALRERVFRLKNLPAGEIATPLRRCLSTFDITLLGVGHMIGAGIYVLTGSVVRNTAGPSIILSFLLAGFASLLSALCYAEFGARFPKAGSAYTYTYVGVGELWAFVIGWNIILEHMLGAAAVARSWSGYLDSLLGNVISNSTIARTGHLHEASSFFGDYPDLLAFLLIVLVAFFVALGSKVSTNFNSFLTILNIGIVVIVVFYGITFADFSLWSGVDEKGNSRFFPYGVSGMFAGAASCFFAYIGFDGLATAGEEAKDPARSIPIATFSSMTIVTLSYVLMSASLTLMIPYNMVHPTAAFSDAFTMRGAEFASYAVSVGALFGMTTSLVGGMFALPRCVFSMADDGLLFSSLASVNPKTQVPTQALLIFGFLTAIIALLFDITTLVEFLSIGTLLAYSIVSACVIVLRY 412          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Celegans
Match: F23F1.6 (pep chromosome:WBcel235:II:35202:37313:-1 gene:WBGene00017747.1 transcript:F23F1.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F23F1.6)

HSP 1 Score: 231.876 bits (590), Expect = 1.227e-67
Identity = 138/411 (33.58%), Postives = 230/411 (55.96%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFT-DRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY---FADG--GYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            +H     + R+++F     LE+++ RCL+   ++F  I HMIGAGIYVLTG +++++ G A  LSF+FSG  ++ +   Y EF    P+AGS YTY+Y+ MGE+ AFI+GWT+ ++  I  +++A+ +S   + L + +V N+T D    L+     +    D +A  LLF + +    G+  S N+N     L L  L  +II    Y +   +   + DG   + P+G+     GA    +A+ GFE L+ + EE K P ++IP A F SL I+ V+YVL    L+ M+P   ++ +A F +AF  K     K +  +  L     + +   + +PR +YAMA+DGL+F +   +N  +K P NA +V  + + ILA+   +Q L +  S+G ++++ +V + +IILR+
Sbjct:    3 VHQIADVLFRKKTFDGGSHLESQMKRCLTILDVMFIAIGHMIGAGIYVLTGSVVRNQAGPAIILSFIFSGFAALLSAFSYAEFGARFPRAGSAYTYSYVGMGEIWAFIVGWTVPLEYMIGNAAVARSWSAYFDNLVSKSVSNWTLDTVGRLSDGKGFFALYPDFLAFFLLFLVAVAVAMGSKFSANVNTSFVFLNLAVLAFVIICGLTYADFSLWSGTYQDGRSKFFPYGIQGAISGASTCFFAFIGFEALATAGEEAKNPHRTIPLATFTSLAIISVIYVLMGASLTLMIPYDLVDPDAAFAAAFEMKGATVAKIIMSVGALAGMLNNLVTGSFALPRAVYAMADDGLIFGWFGVINSKTKTPLNATIVFTIINAILALVFDLQALVDFLSIGTLLAYSMVSICVIILRH 413          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Celegans
Match: Y53F4B.12 (pep chromosome:WBcel235:II:15019223:15025768:1 gene:WBGene00013159.1 transcript:Y53F4B.12a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y53F4B.12)

HSP 1 Score: 78.5666 bits (192), Expect = 6.571e-15
Identity = 88/383 (22.98%), Postives = 160/383 (41.78%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNN-AVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNYFADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTAL-FVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQIL 1282
            + S L  + R R   +     ++  R L    ++       I   ++++    +    G +T L+ +F+ LI  F+     E S  +PK    Y + Y ++GELPAF+I W  ++D         K ++   NLL      K+ T  +   + DS +    VDL+ +L       L L    +   I   L A+ L+   +  +  F + + +N+     +  FG   +          Y+G E  S   EETK PRK I   L F+ L +  + +VL+ T  S       ++E       F+  ++   K++  + ++ A     LA+     R+I A+  D L+    D    S+K P  A+++  +   + +M  +  +L
Sbjct:    1 MSSLLQKMLRTRRVDEQFLRHSEWARRLGVPLMVALAGIKSISMMLFIILPFSLTQVAGPSTVLAPIFAFLIIFFSAAHLSELSCTMPKNCVQYHFAYAVIGELPAFVIAWISLVDYVAQAGLFCKAWADHFNLLFRGLPAKSLT--FDVFSTDSMLLSPQVDLLTVLSAIITLCLLLCSLRVVGTICVSLLAVTLLIAASCTMVAFFHSDPENWI-KAEFFHFGYQGVLYAICALCACYTGIESTSCLLEETKNPRKRISGVLSFLVLVLTTIFFVLSIT-FSLSTNVTALSEGIMIPEVFSVINIPAAKYMLSVCSVCALSGGVLASFLPATRVIAALCHDRLIPYAKDT---STKSPYFAVLLCTVLVALCSMIQKTMLL 376          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Celegans
Match: Y53F4B.12 (pep chromosome:WBcel235:II:15019223:15025768:1 gene:WBGene00013159.1 transcript:Y53F4B.12b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y53F4B.12)

HSP 1 Score: 71.633 bits (174), Expect = 1.062e-12
Identity = 73/285 (25.61%), Postives = 122/285 (42.81%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNN-AVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNYFADGGYLPFGVASIFQGAGIGIYA----YSGFECLSNSAEETKEPRKSIPTAL-FVSLGIVIVLYVLTST 976
            + S L  + R R   +     ++  R L    ++       I   ++++    +    G +T L+ +F+ LI  F+     E S  +PK    Y + Y ++GELPAF+I W  ++D         K ++   NLL      K+ T  +   + DS +    VDL+ +L       L L    +   I   L A+ L+   +  +  F + + +N+     +  FG    +QG    I A    Y+G E  S   EETK PRK I   L F+ L +  + +VL+ T
Sbjct:    1 MSSLLQKMLRTRRVDEQFLRHSEWARRLGVPLMVALAGIKSISMMLFIILPFSLTQVAGPSTVLAPIFAFLIIFFSAAHLSELSCTMPKNCVQYHFAYAVIGELPAFVIAWISLVDYVAQAGLFCKAWADHFNLLFRGLPAKSLT--FDVFSTDSMLLSPQVDLLTVLSAIITLCLLLCSLRVVGTICVSLLAVTLLIAASCTMVAFFHSDPENWI-KAEFFHFG----YQGVLYAICALCACYTGIESTSCLLEETKNPRKRISGVLSFLVLVLTTIFFVLSIT 278          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Fly
Match: CG13248 (gene:FBgn0036984 transcript:FBtr0078234)

HSP 1 Score: 254.988 bits (650), Expect = 2.604e-75
Identity = 147/410 (35.85%), Postives = 227/410 (55.37%), Query Frame = 2
Query:  128 MSYVLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNYF-ADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            + ++L      + R +S   +  +ET LNRCL+T  +   GI HM+GAGIYVLTG + K+  G    LSF+ +G IS+   LCY EF T +PKAGS Y YTY+ MGE  AF+IGW ++++  +  +S+A+ +SG V+ +    + N T        +  +     D++A L+          G   +   N++L  + +  +  +I   F Y + +N+  A+GG+LP+GV  +  GA    YA+ GF+ ++ S EE K P  SIP A  +SL +V V Y+L S  L+ M+P  +IN  A    AF   +L   K+L  I  L     + L +++ +PR +YAMA DGLLF    K+N +++VP   LVV  + S  LA+   +  L E  S+G ++++ IV   +IILRY
Sbjct:    9 LRHILSGICTKMNRTKSV-PTDVMETPLNRCLNTFDIALLGIGHMVGAGIYVLTGTVAKEMAGPGIILSFILAGFISMLAALCYAEFGTRVPKAGSAYVYTYISMGEFWAFVIGWNILLEHMLGAASVARAWSGYVDSMLGGWIGNTTLELTGGIHEPGLAQYP-DVLAFLVCIVYAAALAGGVKATAVFNSLLTLVNIAVMVLVISVGFWYADGKNWSEAEGGFLPYGVGGVIAGAATCFYAFVGFDSIATSGEEAKNPSVSIPVATVISLFVVTVGYILVSAALTLMIPISEINPAASLPEAFGQLNLSWAKYLISIGALCGMTTTLLGSLFALPRCMYAMASDGLLFSCFGKINPTTQVPLLNLVVSGVMSACLALVFDLAKLVEFMSIGTLLAYTIVSASVIILRY 416          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Fly
Match: CG5535 (gene:FBgn0036764 transcript:FBtr0075159)

HSP 1 Score: 242.662 bits (618), Expect = 3.723e-71
Identity = 138/418 (33.01%), Postives = 230/418 (55.02%), Query Frame = 2
Query:  131 SYVLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY----------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            S+ + +    +TR++    S   E+KL + LS   L   GI   +G G+YVL G + K   G A  +SFL + + SIF GLCY EF   +PKAGS Y Y+Y+ +GE  AF+IGW +I++ +I  +S+ KG S  ++ L  N + +F   ++PL  + E      DL A ++     L    GA  S  +N V   L L  +  +II+     +S N+          + DGG++P+GV+ I +GA +  Y + GF+C++ + EE K P+KSIP A+ VSL ++ + Y   ST L+ M+P  + +E AP    F     H  +++  I  +    +S + A++ +PR+++AM+ DGLLF+FL  ++E  K P    ++  + + ILA    +  L  + S+G ++++ +V   +++LRY
Sbjct:    3 SWSVTNAFRVLTRKKPLEDSN--ESKLAKVLSAFDLTALGIGSTLGVGVYVLAGEVSKQYAGPAVVVSFLIAAIASIFAGLCYAEFGARVPKAGSAYIYSYVTIGEFIAFLIGWNLILEYAIGSASVVKGLSTYLDQLCGNPMSSFLGTHMPL--NIEGMGAYPDLFAFVVTILFSLAIAVGAKESTRVNNVFTMLNLGVVLFVIIAGLFKVSSSNWSIPKSQVPEGYGDGGFMPYGVSGIIKGAAVCFYGFIGFDCIATAGEEAKNPKKSIPFAVIVSLAMIFLAYFGVSTVLTMMLPYFEQDEKAPLPHVFRINGWHVAEYVVSIGAMFGLCSSMMGAMFPLPRIVFAMSNDGLLFKFLGDISEKYKTPFKGTMITGMLTGILAAVFNLSQLVNMMSIGTLLAYSMVASCVLMLRY 416          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Fly
Match: CG5535 (gene:FBgn0036764 transcript:FBtr0273277)

HSP 1 Score: 242.662 bits (618), Expect = 4.532e-71
Identity = 138/418 (33.01%), Postives = 230/418 (55.02%), Query Frame = 2
Query:  131 SYVLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY----------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            S+ + +    +TR++    S   E+KL + LS   L   GI   +G G+YVL G + K   G A  +SFL + + SIF GLCY EF   +PKAGS Y Y+Y+ +GE  AF+IGW +I++ +I  +S+ KG S  ++ L  N + +F   ++PL  + E      DL A ++     L    GA  S  +N V   L L  +  +II+     +S N+          + DGG++P+GV+ I +GA +  Y + GF+C++ + EE K P+KSIP A+ VSL ++ + Y   ST L+ M+P  + +E AP    F     H  +++  I  +    +S + A++ +PR+++AM+ DGLLF+FL  ++E  K P    ++  + + ILA    +  L  + S+G ++++ +V   +++LRY
Sbjct:   12 SWSVTNAFRVLTRKKPLEDSN--ESKLAKVLSAFDLTALGIGSTLGVGVYVLAGEVSKQYAGPAVVVSFLIAAIASIFAGLCYAEFGARVPKAGSAYIYSYVTIGEFIAFLIGWNLILEYAIGSASVVKGLSTYLDQLCGNPMSSFLGTHMPL--NIEGMGAYPDLFAFVVTILFSLAIAVGAKESTRVNNVFTMLNLGVVLFVIIAGLFKVSSSNWSIPKSQVPEGYGDGGFMPYGVSGIIKGAAVCFYGFIGFDCIATAGEEAKNPKKSIPFAVIVSLAMIFLAYFGVSTVLTMMLPYFEQDEKAPLPHVFRINGWHVAEYVVSIGAMFGLCSSMMGAMFPLPRIVFAMSNDGLLFKFLGDISEKYKTPFKGTMITGMLTGILAAVFNLSQLVNMMSIGTLLAYSMVASCVLMLRY 425          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Fly
Match: slif (gene:FBgn0037203 transcript:FBtr0078555)

HSP 1 Score: 238.81 bits (608), Expect = 6.989e-70
Identity = 130/415 (31.33%), Postives = 235/415 (56.63%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY----------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            + +   ++TRR++   ++  E++L R L+   L   G+   +G G+YVL G +  +  G A  +SFL + + S F G+CY EF+  +PKAGS Y Y+Y+ +GE  AF IGW +I++  I  +S+A+G SG  + L NN +    +  + +  D +      D ++  ++  L  +   GA  S  +N +   + L+ +  ++++  +  N  N+          F  GG++PFG+A +  GA    Y + GF+C++ + EE   P+++IP ++ VSL I+ + Y   ST L+ M+P  + +++APF  AF     + +KW+  I  + A   S L A++ +PR++YAM +DG+LF+ L  VN  +K P  A +V  +F++I+AM   +  L ++ S+G ++++ IV + +++LRY
Sbjct:    1 MTNLWKALTRRKTEDVNEG-ESQLARVLNLFDLTALGVGSTLGLGVYVLAGQVAFNIAGPAVTISFLIAAIASAFAGICYAEFAARVPKAGSAYVYSYVTIGEFVAFTIGWNLILEYVIGTASVARGLSGYFDSLINNNMSKALNESMHI--DVDFLGDYPDFLSFGMVLLLAAILAFGAKESSFLNNIFTTVNLVTIAIVLVAGAMNANVDNWRIPKKDVPEGFGTGGFMPFGIAGVMAGAAKCFYGFVGFDCIATTGEEAINPKRNIPLSIVVSLIIIFLSYFGVSTVLTMMLPYYKQDKDAPFPHAFDSVEWYTIKWIVTIGAVFALCTSLLGAMFPLPRILYAMGKDGILFKRLSTVNSYTKTPLLATIVSGIFASIMAMLFNLDQLVDMMSIGTLLAYTIVAICVLVLRY 412          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Fly
Match: slif (gene:FBgn0037203 transcript:FBtr0078556)

HSP 1 Score: 238.81 bits (608), Expect = 6.989e-70
Identity = 130/415 (31.33%), Postives = 235/415 (56.63%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY----------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            + +   ++TRR++   ++  E++L R L+   L   G+   +G G+YVL G +  +  G A  +SFL + + S F G+CY EF+  +PKAGS Y Y+Y+ +GE  AF IGW +I++  I  +S+A+G SG  + L NN +    +  + +  D +      D ++  ++  L  +   GA  S  +N +   + L+ +  ++++  +  N  N+          F  GG++PFG+A +  GA    Y + GF+C++ + EE   P+++IP ++ VSL I+ + Y   ST L+ M+P  + +++APF  AF     + +KW+  I  + A   S L A++ +PR++YAM +DG+LF+ L  VN  +K P  A +V  +F++I+AM   +  L ++ S+G ++++ IV + +++LRY
Sbjct:    1 MTNLWKALTRRKTEDVNEG-ESQLARVLNLFDLTALGVGSTLGLGVYVLAGQVAFNIAGPAVTISFLIAAIASAFAGICYAEFAARVPKAGSAYVYSYVTIGEFVAFTIGWNLILEYVIGTASVARGLSGYFDSLINNNMSKALNESMHI--DVDFLGDYPDFLSFGMVLLLAAILAFGAKESSFLNNIFTTVNLVTIAIVLVAGAMNANVDNWRIPKKDVPEGFGTGGFMPFGIAGVMAGAAKCFYGFVGFDCIATTGEEAINPKRNIPLSIVVSLIIIFLSYFGVSTVLTMMLPYYKQDKDAPFPHAFDSVEWYTIKWIVTIGAVFALCTSLLGAMFPLPRILYAMGKDGILFKRLSTVNSYTKTPLLATIVSGIFASIMAMLFNLDQLVDMMSIGTLLAYTIVAICVLVLRY 412          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Zebrafish
Match: slc7a3a (solute carrier family 7 member 3a [Source:ZFIN;Acc:ZDB-GENE-041114-206])

HSP 1 Score: 248.44 bits (633), Expect = 5.081e-73
Identity = 146/427 (34.19%), Postives = 231/427 (54.10%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY----------------------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            + SF H + RRR+   S   ET+  RCLST  L+  G+   +GAG+YVL G + +++ G A  L FL + L S+  GLCY EF   +PK GS Y Y+Y+ +GE+ AFI GW +I+   I  +S+A+ +S   + L    + NF    + +    ++     DL AL+L+  L  L   G + S  +N +   + LI L  IIIS FV GN+ N+                      F  GG+ PFG+  I  GA    YA+ GF+C++ ++EE K P +SIP  +  SL I    Y   S  L+ M+P  ++N  +P   AF+       +++  + +L A   S L +++ +PR+IYAMAEDGLLFR L ++N+ +K P  A +   + + ++A    +  L ++ S+G ++++ +V V ++ILRY
Sbjct:    5 MASFGHILLRRRALDFSGE-ETRFARCLSTLDLVALGVGSTLGAGVYVLAGEVAREKAGPAIVLCFLVAALSSMLAGLCYAEFGARVPKTGSAYLYSYVTVGEIWAFITGWNLILSYVIGTASVARAWSSTFDNLIEQKISNFFRASMAMKVPGKVLAEYPDLFALILILLLTGLLAFGVSESALVNKIFTGINLIVLGFIIISGFVKGNTANWNLTYEYFINDTNITEPERIESTFGSGGFAPFGLGGILSGAATCFYAFVGFDCIATTSEEAKNPMRSIPVGIVASLLICFFAYFGVSAALTLMMPYYKLNTQSPLPEAFSYVGWAPARYIVAVGSLCALSTSLLGSMFPMPRVIYAMAEDGLLFRSLSRMNKRTKTPLLATIASGIVAALMAFLFDLAALVDLMSIGTLLAYSLVAVCVLILRY 430          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Zebrafish
Match: slc7a3b (solute carrier family 7 member 3b [Source:ZFIN;Acc:ZDB-GENE-120813-6])

HSP 1 Score: 247.284 bits (630), Expect = 1.326e-72
Identity = 141/427 (33.02%), Postives = 231/427 (54.10%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY----------------------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            L SF   + RRR    S  +E+   RCL+T  LI  G+   +GAG+YVL G + +++ G A  LSFL + L S+  GLCY EF   +PK GS Y Y+Y+ +GE+ AFI GW +I+   I  +S+A+ +S   + L    +  F   ++       +     D+ AL+L+  L  L   G + S  +N +   + L+ LT +IIS FV G++ N+                      F  GG+ PFG+  +  GA    YA+ GF+C++ ++EE K P +SIP  +  SL I    Y   S  L+ M+P   +++++P   AF        +++  + +L A   S L +++ +PR+IYAMAEDGLLFRFL ++++ +K P  A +V  + + ++A    +  L ++ S+G ++++ +V V ++ILRY
Sbjct:    6 LASFGKMLLRRRVLDDSP-VESHFARCLTTLDLIALGVGATLGAGVYVLAGEVAREKAGPAIVLSFLIAALSSVLAGLCYAEFGARVPKTGSAYVYSYVTVGEIWAFITGWNLILSYVIGTASVARAWSATFDSLLAQKISTFFKAFMSFPDTQNVLAKYPDVFALILVMLLTGLLAFGVSESALVNKIFTGINLVVLTFVIISGFVKGDTANWNLTVEDYINRTNITGAQKIEKEFGSGGFAPFGLNGVLSGAATCFYAFVGFDCIATTSEEAKNPMRSIPIGIVASLLICFFAYFGVSAALTLMMPYYMLDKHSPLPQAFDYVGWGPARYIVSVGSLCALSTSLLGSMFPMPRVIYAMAEDGLLFRFLSRMHKKTKTPALATLVSGIVAALMAFLFDLDALVDLMSIGTLLAYTLVAVCVLILRY 431          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Zebrafish
Match: slc7a3b (solute carrier family 7 member 3b [Source:ZFIN;Acc:ZDB-GENE-120813-6])

HSP 1 Score: 247.669 bits (631), Expect = 3.343e-72
Identity = 141/427 (33.02%), Postives = 231/427 (54.10%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY----------------------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            L SF   + RRR    S  +E+   RCL+T  LI  G+   +GAG+YVL G + +++ G A  LSFL + L S+  GLCY EF   +PK GS Y Y+Y+ +GE+ AFI GW +I+   I  +S+A+ +S   + L    +  F   ++       +     D+ AL+L+  L  L   G + S  +N +   + L+ LT +IIS FV G++ N+                      F  GG+ PFG+  +  GA    YA+ GF+C++ ++EE K P +SIP  +  SL I    Y   S  L+ M+P   +++++P   AF        +++  + +L A   S L +++ +PR+IYAMAEDGLLFRFL ++++ +K P  A +V  + + ++A    +  L ++ S+G ++++ +V V ++ILRY
Sbjct:   58 LASFGKMLLRRRVLDDSP-VESHFARCLTTLDLIALGVGATLGAGVYVLAGEVAREKAGPAIVLSFLIAALSSVLAGLCYAEFGARVPKTGSAYVYSYVTVGEIWAFITGWNLILSYVIGTASVARAWSATFDSLLAQKISTFFKAFMSFPDTQNVLAKYPDVFALILVMLLTGLLAFGVSESALVNKIFTGINLVVLTFVIISGFVKGDTANWNLTVEDYINRTNITGAQKIEKEFGSGGFAPFGLNGVLSGAATCFYAFVGFDCIATTSEEAKNPMRSIPIGIVASLLICFFAYFGVSAALTLMMPYYMLDKHSPLPQAFDYVGWGPARYIVSVGSLCALSTSLLGSMFPMPRVIYAMAEDGLLFRFLSRMHKKTKTPALATLVSGIVAALMAFLFDLDALVDLMSIGTLLAYTLVAVCVLILRY 483          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Zebrafish
Match: slc7a4 (solute carrier family 7 member 4 [Source:ZFIN;Acc:ZDB-GENE-030919-2])

HSP 1 Score: 236.498 bits (602), Expect = 2.432e-68
Identity = 131/403 (32.51%), Postives = 230/403 (57.07%), Query Frame = 2
Query:  149 FLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNYFA-DGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            F   + R ++      + T L RCL+T  L   G+  M+G+G+YVLTG + KD  G A  +SFL +G+ S+   LCY EF   +PK GS Y +TY+ +GE+ AF+IGW +I++  I  +++A+ +SG ++ + N+ ++NFT+ +V +  +        DL+A  +L         G  +S  +N + +A+ ++ +  I++  F+  +  N+ A +GG+ PFG++ I  G     YA+ GF+ ++ S+EE   P+++IP A  +SLG+    YVL ST L+ MVP   ++ N+    AF  +      ++  + ++ A     L+ ++ +PR++YAMAEDGL F    +VN  +KVP  A++V      ILA+   ++ L +  S+G ++++  V   +I+LR+
Sbjct:   14 FCQKLNRLKTLDD-DVMATSLKRCLNTVDLALLGVGGMVGSGLYVLTGTVAKDTAGPAVVISFLIAGVASLMAALCYAEFGARVPKTGSAYMFTYVSVGEIWAFLIGWNVILEYMIGGAAVARAWSGYLDSIFNHRIQNFTESHV-MRWEVPFLAHYPDLLAAAILLVASFFISFGVRVSSWLNHIFSAISMVVIVFILVFGFILADPVNWSAREGGFAPFGLSGIMAGTATCFYAFVGFDVIAASSEEASNPQRAIPAATAISLGLAATAYVLVSTVLTLMVPWHTLDPNSALSDAFFRRGYSWAGFIVAVGSICAMNTVLLSNLFSLPRIVYAMAEDGLFFSVFSRVNPVTKVPVIAILVFGSLMAILALIFDLEALVQFLSIGTLLAYTFVAASVIVLRF 414          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Zebrafish
Match: slc7a4 (solute carrier family 7 member 4 [Source:ZFIN;Acc:ZDB-GENE-030919-2])

HSP 1 Score: 236.498 bits (602), Expect = 2.432e-68
Identity = 131/403 (32.51%), Postives = 230/403 (57.07%), Query Frame = 2
Query:  149 FLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNYFA-DGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            F   + R ++      + T L RCL+T  L   G+  M+G+G+YVLTG + KD  G A  +SFL +G+ S+   LCY EF   +PK GS Y +TY+ +GE+ AF+IGW +I++  I  +++A+ +SG ++ + N+ ++NFT+ +V +  +        DL+A  +L         G  +S  +N + +A+ ++ +  I++  F+  +  N+ A +GG+ PFG++ I  G     YA+ GF+ ++ S+EE   P+++IP A  +SLG+    YVL ST L+ MVP   ++ N+    AF  +      ++  + ++ A     L+ ++ +PR++YAMAEDGL F    +VN  +KVP  A++V      ILA+   ++ L +  S+G ++++  V   +I+LR+
Sbjct:   14 FCQKLNRLKTLDD-DVMATSLKRCLNTVDLALLGVGGMVGSGLYVLTGTVAKDTAGPAVVISFLIAGVASLMAALCYAEFGARVPKTGSAYMFTYVSVGEIWAFLIGWNVILEYMIGGAAVARAWSGYLDSIFNHRIQNFTESHV-MRWEVPFLAHYPDLLAAAILLVASFFISFGVRVSSWLNHIFSAISMVVIVFILVFGFILADPVNWSAREGGFAPFGLSGIMAGTATCFYAFVGFDVIAASSEEASNPQRAIPAATAISLGLAATAYVLVSTVLTLMVPWHTLDPNSALSDAFFRRGYSWAGFIVAVGSICAMNTVLLSNLFSLPRIVYAMAEDGLFFSVFSRVNPVTKVPVIAILVFGSLMAILALIFDLEALVQFLSIGTLLAYTFVAASVIVLRF 414          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Xenopus
Match: hipk1 (homeodomain interacting protein kinase 1 [Source:Xenbase;Acc:XB-GENE-987412])

HSP 1 Score: 236.884 bits (603), Expect = 1.873e-68
Identity = 130/403 (32.26%), Postives = 229/403 (56.82%), Query Frame = 2
Query:  149 FLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNYFAD-GGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            F   + R ++  +   +ET L RCLST  L   G+  M+G+G+YVLTG + K+  G A  +SFL +G+ S+   LCY EF   +PK GS Y +TY+ +GE+ AF+IGW +I++  I  +++A+ +SG ++ + ++ +KN+T+ +V  + + +      D +A  +L         G  +S  +N + A + +  +  I+I  F+    +N+  + GG+ PFG + I  G     YA+ GF+ ++ S+EE K P+K++P A  VSLG+    Y L ST L+ MVP   +  ++    AF  +      ++    ++ A     L+ ++ +PR++YAMAEDGL F+F  KVN ++KVP   ++V  +   +LA+   ++ L +  S+G ++++  V   +I+LR+
Sbjct:   14 FCQKLNRVKTL-EDDLMETSLKRCLSTIDLTLLGVGGMVGSGLYVLTGTVAKEIAGPAVIISFLIAGVASLLAALCYAEFGARVPKTGSAYMFTYVSVGEIWAFLIGWNVILEYMIGGAAVARAWSGYLDSMFDHKIKNYTETHVG-SWNVQFLAHYPDFLAAGILLVATAFISFGVRVSSWLNHIFAGISMGIILFILIFGFILAEPKNWGPENGGFAPFGFSGIMSGTATCFYAFVGFDVIAASSEEAKNPQKAVPIATAVSLGLATAAYFLVSTVLTLMVPWNTLVPDSALSDAFYRRGYSWAGFIVAAGSICAMNTVLLSNLFSLPRIVYAMAEDGLFFQFFSKVNPTTKVPLIGIIVFGILMALLALVFDLEALVQFLSIGTLLAYTFVAASIIVLRF 414          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Xenopus
Match: SLC7A2 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 2, gene 1 [Source:NCBI gene;Acc:100485546])

HSP 1 Score: 234.187 bits (596), Expect = 1.445e-67
Identity = 139/425 (32.71%), Postives = 229/425 (53.88%), Query Frame = 2
Query:  134 YVLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY------------------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            Y+  +F   I RR+  +     ++KL RCLST  L+  G+   +GAG+YVL G + K   G +  +SFL + L S+  GLCY EF   +PK GS Y YTY+ +GEL AFI GW +I+   I  SS+A+ +SG  + L    +  F   Y  +  +S       D+ A+ L+  L  L   G   S  +N V  A+ ++ L  ++I+ FV G+ QN+                  +  GG++P+G+  +  GA    YA+ GF+C++ + EE + P+++IP  +  SL I  + Y   S  L+ M+P  +++E +P   AF        K++  + +L A   S L +I+ +PR+IYAMAEDGLLF+ L K++  +K P  A +     + ++A    ++ L ++ S+G ++++ +V   ++ILRY
Sbjct:    5 YLSLTFARCILRRKIVTLDSLEDSKLCRCLSTLDLVALGVGSTLGAGVYVLAGEVAKANSGPSIVVSFLIAALASVMAGLCYAEFGARVPKTGSAYLYTYVTVGELWAFITGWNLILSYVIGTSSVARAWSGTFDELLGKRIGQFFSTYFRM--NSPGLAEYPDIFAVFLILLLSGLLSFGVKESAWVNKVFTAVNVLVLLFVMIAGFVKGDLQNWKITESFLNSVSYDNVTSLYGAGGFMPYGLTGMLAGAATCFYAFVGFDCIATTGEEVRNPQRAIPIGIVASLLICFMAYFGVSAALTLMMPYFKLDEKSPLPVAFEYVGWGPAKYVVAVGSLCALSTSLLGSIFPMPRVIYAMAEDGLLFKSLAKISPRTKTPVIATLSSGAVAAVMAFLFDLKALVDMMSIGTLLAYSLVAACVLILRY 427          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Xenopus
Match: SLC7A1 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 [Source:NCBI gene;Acc:100492323])

HSP 1 Score: 232.261 bits (591), Expect = 5.930e-67
Identity = 133/404 (32.92%), Postives = 225/404 (55.69%), Query Frame = 2
Query:  170 RRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLT-PDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQN--------YFADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            RR    S S E++L+RCL+T  L+  G+   +GAG+YVL G + ++  G A  L FL + L S+  GLCY EF   +PK GS Y Y+Y+ +GE  AF+ GW +I+   I  SS+A+ +S   + L    ++ +   ++ +  P   +     D+ ++L++  L  L   G   S  +N V   + ++ L  +IIS FV G+ +N         +  GG++PFG A +  GA    YA+ GF+C++ + EE K P+K+IP  +  SL I  V Y   S  L+ M+P   +N+ +P   AF        ++   + +L A   S L +++ +PR+I+AMA+DGLLF+FL KV+E +K P  A +     + ++A+   ++ L ++ S+G ++++ +V   +++LRY
Sbjct:   11 RRKVVGSDSKESRLSRCLNTFDLVALGVGSTLGAGVYVLAGAVARENAGPAIVLCFLIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGEFLAFVTGWNLILSYVIGTSSVARAWSATFDDLIGKRIEEYCLAHISMNFPG--VLARYPDIFSVLIILVLTGLLSFGVKESALVNKVFTCINVLVLGFVIISGFVKGSVKNCGTKEQDLNYGAGGFMPFGFAGVLSGAATCFYAFVGFDCIATTGEEVKNPQKAIPIGIVASLLICFVAYFGVSAALTLMMPYYLLNKESPLPVAFNYVGWDGARYAVAVGSLCALSTSLLGSMFPMPRVIFAMADDGLLFKFLAKVSEKTKTPVIATLTSGSVAALMALLFDLKDLVDLMSIGTLLAYSLVAACVLVLRY 412          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Xenopus
Match: SLC7A1 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 [Source:NCBI gene;Acc:100492323])

HSP 1 Score: 232.261 bits (591), Expect = 7.989e-67
Identity = 135/422 (31.99%), Postives = 232/422 (54.98%), Query Frame = 2
Query:  134 YVLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLT-PDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY--------------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            Y+  + L  + RR+    S S E++L+RCL+T  L+  G+   +GAG+YVL G + ++  G A  L FL + L S+  GLCY EF   +PK GS Y Y+Y+ +GE  AF+ GW +I+   I  SS+A+ +S   + L    ++ +   ++ +  P   +     D+ ++L++  L  L   G   S  +N V   + ++ L  +IIS FV G+ +N+              +  GG++PFG A +  GA    YA+ GF+C++ + EE K P+K+IP  +  SL I  V Y   S  L+ M+P   +N+ +P   AF        ++   + +L A   S L +++ +PR+I+AMA+DGLLF+FL KV+E +K P  A +     + ++A+   ++ L ++ S+G ++++ +V   +++LRY
Sbjct:    2 YLERTMLKQLFRRKVVG-SDSKESRLSRCLNTFDLVALGVGSTLGAGVYVLAGAVARENAGPAIVLCFLIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGEFLAFVTGWNLILSYVIGTSSVARAWSATFDDLIGKRIEEYCLAHISMNFPG--VLARYPDIFSVLIILVLTGLLSFGVKESALVNKVFTCINVLVLGFVIISGFVKGSVKNWQLSENDFNVTNDLNYGAGGFMPFGFAGVLSGAATCFYAFVGFDCIATTGEEVKNPQKAIPIGIVASLLICFVAYFGVSAALTLMMPYYLLNKESPLPVAFNYVGWDGARYAVAVGSLCALSTSLLGSMFPMPRVIFAMADDGLLFKFLAKVSEKTKTPVIATLTSGSVAALMALLFDLKDLVDLMSIGTLLAYSLVAACVLVLRY 420          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Xenopus
Match: SLC7A2 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 2, gene 1 [Source:NCBI gene;Acc:100485546])

HSP 1 Score: 230.72 bits (587), Expect = 4.191e-66
Identity = 138/429 (32.17%), Postives = 227/429 (52.91%), Query Frame = 2
Query:  146 SFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY--------------------------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            +F   I RR+  +     ++KL RCLST  L+  G+   +GAG+YVL G + K   G +  +SFL + L S+  GLCY EF   +PK GS Y YTY+ +GEL AFI GW +I+   I  SS+A+ +SG  + L    +  F   Y  +  +S       D+ A+ L+  L  L   G   S  +N V  A+ ++ L  ++I+ FV G+ QN+                          +  GG++P+G+  +  GA    YA+ GF+C++ + EE + P+++IP  +  SL I  + Y   S  L+ M+P  +++E +P   AF        K++  + +L A   S L +I+ +PR+IYAMAEDGLLF+ L K++  +K P  A +     + ++A    ++ L ++ S+G ++++ +V   ++ILRY
Sbjct:    9 TFARCILRRKIVTLDSLEDSKLCRCLSTLDLVALGVGSTLGAGVYVLAGEVAKANSGPSIVVSFLIAALASVMAGLCYAEFGARVPKTGSAYLYTYVTVGELWAFITGWNLILSYVIGTSSVARAWSGTFDELLGKRIGQFFSTYFRM--NSPGLAEYPDIFAVFLILLLSGLLSFGVKESAWVNKVFTAVNVLVLLFVMIAGFVKGDLQNWKITESFLQNISATDGNSVSYDNVTSLYGAGGFMPYGLTGMLAGAATCFYAFVGFDCIATTGEEVRNPQRAIPIGIVASLLICFMAYFGVSAALTLMMPYFKLDEKSPLPVAFEYVGWGPAKYVVAVGSLCALSTSLLGSIFPMPRVIYAMAEDGLLFKSLAKISPRTKTPVIATLSSGAVAAVMAFLFDLKALVDMMSIGTLLAYSLVAACVLILRY 435          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Mouse
Match: Slc7a1 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 [Source:MGI Symbol;Acc:MGI:88117])

HSP 1 Score: 246.514 bits (628), Expect = 3.316e-73
Identity = 136/417 (32.61%), Postives = 232/417 (55.64%), Query Frame = 2
Query:  155 HSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY-----------------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
              + RR+    S+  E++L+RCL+T  L+  G+   +GAG+YVL G + ++  G A  +SFL + L S+  GLCY EF   +PK GS Y Y+Y+ +GEL AFI GW +I+   I  SS+A+ +S   + L    +  F+ +++ L     +  T  D+ A++++  L  L   G   S  +N +   + ++ L  I++S FV G+ +N+                 + +GG++PFG + +  GA    YA+ GF+C++ + EE K P+K+IP  +  SL I  + Y   S  L+ M+P   ++ ++P   AF  +   E K+   I +L A   S L +++ +PR+IYAMAEDGLLF+FL K+N  +K P  A V     + ++A    ++ L ++ S+G ++++ +V   +++LRY
Sbjct:   11 QQMLRRKVVDCSRE-ESRLSRCLNTYDLVALGVGSTLGAGVYVLAGAVARENAGPAIVISFLIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILSYIIGTSSVARAWSATFDELIGKPIGEFSRQHMALNAPGVLAQTP-DIFAVIIIIILTGLLTLGVKESAMVNKIFTCINVLVLCFIVVSGFVKGSIKNWQLTEKNFSCNNNDTNVKYGEGGFMPFGFSGVLSGAATCFYAFVGFDCIATTGEEVKNPQKAIPVGIVASLLICFIAYFGVSAALTLMMPYFCLDIDSPLPGAFKHQGWEEAKYAVAIGSLCALSTSLLGSMFPMPRVIYAMAEDGLLFKFLAKINNRTKTPVIATVTSGAIAAVMAFLFELKDLVDLMSIGTLLAYSLVAACVLVLRY 425          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Mouse
Match: Slc7a1 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 [Source:MGI Symbol;Acc:MGI:88117])

HSP 1 Score: 246.128 bits (627), Expect = 2.595e-72
Identity = 136/417 (32.61%), Postives = 232/417 (55.64%), Query Frame = 2
Query:  155 HSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY-----------------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
              + RR+    S+  E++L+RCL+T  L+  G+   +GAG+YVL G + ++  G A  +SFL + L S+  GLCY EF   +PK GS Y Y+Y+ +GEL AFI GW +I+   I  SS+A+ +S   + L    +  F+ +++ L     +  T  D+ A++++  L  L   G   S  +N +   + ++ L  I++S FV G+ +N+                 + +GG++PFG + +  GA    YA+ GF+C++ + EE K P+K+IP  +  SL I  + Y   S  L+ M+P   ++ ++P   AF  +   E K+   I +L A   S L +++ +PR+IYAMAEDGLLF+FL K+N  +K P  A V     + ++A    ++ L ++ S+G ++++ +V   +++LRY
Sbjct:   11 QQMLRRKVVDCSRE-ESRLSRCLNTYDLVALGVGSTLGAGVYVLAGAVARENAGPAIVISFLIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILSYIIGTSSVARAWSATFDELIGKPIGEFSRQHMALNAPGVLAQTP-DIFAVIIIIILTGLLTLGVKESAMVNKIFTCINVLVLCFIVVSGFVKGSIKNWQLTEKNFSCNNNDTNVKYGEGGFMPFGFSGVLSGAATCFYAFVGFDCIATTGEEVKNPQKAIPVGIVASLLICFIAYFGVSAALTLMMPYFCLDIDSPLPGAFKHQGWEEAKYAVAIGSLCALSTSLLGSMFPMPRVIYAMAEDGLLFKFLAKINNRTKTPVIATVTSGAIAAVMAFLFELKDLVDLMSIGTLLAYSLVAACVLVLRY 425          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Mouse
Match: AU018091 (expressed sequence AU018091 [Source:MGI Symbol;Acc:MGI:2142124])

HSP 1 Score: 231.491 bits (589), Expect = 2.608e-66
Identity = 133/427 (31.15%), Postives = 228/427 (53.40%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY----------------------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            LH F   + RRR  + ++  E+ L+RCL+T  L+  G+   +GAG+YVL G + +++ G +  + FL + L S+ +GLCY EF   +P +GS Y Y+Y+ +G+L AFI GW +I++  I  +S+A+ +S A + L  N +        P+   S +     D  AL L+  L  +   GA  S  +  V   + L+ L  + +S  + G   N+                         GG++PFG+  I +G     +A+ GF+C++++ EE + P++SIP  +  SL I  ++Y   S  L+ M+P  QIN N+P   AF        ++   + TL A  +S + +I+ +PR++Y+MAEDGLLFR L  V+  +  P  A V+  + +  +A  V +  L +++S+G ++++ +V   ++ILRY
Sbjct:   55 LHQFGQKLVRRRPLAANEQSESSLSRCLTTLDLVSLGVGSTLGAGVYVLAGEVAREKAGPSIIICFLIAALSSVMSGLCYAEFGARVPCSGSAYLYSYVTVGQLLAFITGWNLILNYVIGAASVARAWSAAFDGLIGNHISQAMQTTFPIQVPSFLAKYP-DFFALGLVIVLTGILALGARESALVTRVFTGVNLLVLCFVSLSGLINGKLHNWQLTEDDYKLALLESNNTDSLGPMGSGGFMPFGLKGILRGTATCFFAFIGFDCIASTGEEARCPQRSIPLGIVTSLFICFLMYFGVSGALTLMIPYYQININSPLPQAFIHVGWGPARYAVAVGTLCALSSSLIGSIFPVPRVVYSMAEDGLLFRKLAYVHPRTHTPVLATVLCGIIAAFMAFLVELSDLVDLSSIGTLLAYTLVTFSVLILRY 480          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Mouse
Match: AU018091 (expressed sequence AU018091 [Source:MGI Symbol;Acc:MGI:2142124])

HSP 1 Score: 231.491 bits (589), Expect = 2.608e-66
Identity = 133/427 (31.15%), Postives = 228/427 (53.40%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY----------------------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            LH F   + RRR  + ++  E+ L+RCL+T  L+  G+   +GAG+YVL G + +++ G +  + FL + L S+ +GLCY EF   +P +GS Y Y+Y+ +G+L AFI GW +I++  I  +S+A+ +S A + L  N +        P+   S +     D  AL L+  L  +   GA  S  +  V   + L+ L  + +S  + G   N+                         GG++PFG+  I +G     +A+ GF+C++++ EE + P++SIP  +  SL I  ++Y   S  L+ M+P  QIN N+P   AF        ++   + TL A  +S + +I+ +PR++Y+MAEDGLLFR L  V+  +  P  A V+  + +  +A  V +  L +++S+G ++++ +V   ++ILRY
Sbjct:   55 LHQFGQKLVRRRPLAANEQSESSLSRCLTTLDLVSLGVGSTLGAGVYVLAGEVAREKAGPSIIICFLIAALSSVMSGLCYAEFGARVPCSGSAYLYSYVTVGQLLAFITGWNLILNYVIGAASVARAWSAAFDGLIGNHISQAMQTTFPIQVPSFLAKYP-DFFALGLVIVLTGILALGARESALVTRVFTGVNLLVLCFVSLSGLINGKLHNWQLTEDDYKLALLESNNTDSLGPMGSGGFMPFGLKGILRGTATCFFAFIGFDCIASTGEEARCPQRSIPLGIVTSLFICFLMYFGVSGALTLMIPYYQININSPLPQAFIHVGWGPARYAVAVGTLCALSSSLIGSIFPVPRVVYSMAEDGLLFRKLAYVHPRTHTPVLATVLCGIIAAFMAFLVELSDLVDLSSIGTLLAYTLVTFSVLILRY 480          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Mouse
Match: Slc7a3 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 3 [Source:MGI Symbol;Acc:MGI:1100521])

HSP 1 Score: 226.868 bits (577), Expect = 4.018e-65
Identity = 138/428 (32.24%), Postives = 229/428 (53.50%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAV-NLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY----------------------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            L  F   + RRR        ET+L RCLST  L+  G+   +GAG+YVL G + KD+ G +  + FL + L S+  GLCY EF   +P +GS Y Y+Y+ +GEL AF  GW +I+   I  +S+A+ +S A  NL+ N+  +      +   P   +     D  AL L+  L  L + GA+ S  +  V   + L+ L+ +IIS F+ G  +N+                         GG++PFG+  I +GA    YA+ GF+C++ + EE + P++SIP  + +S+ I  + Y   S+ L+ M+P  +++  +P   AF+       ++L  I +L A   S L +++ +PR++Y+MAEDGLLFR L KV+  + +P  A +V  + +  +A    +  L ++ S+G +++  +V + ++ILRY
Sbjct:    6 LRRFGQKLVRRRVLELGMG-ETRLARCLSTLDLVALGVGSTLGAGVYVLAGEVAKDKAGPSIVICFLVAALSSVLAGLCYAEFGARVPGSGSAYLYSYVTVGELWAFTTGWNLILSYVIGTASVARAWSSAFDNLIGNHISRTLKGTILLKMP--HVLAEYPDFFALALVLLLTGLLVLGASKSALVTKVFTGMNLLVLSFVIISGFIKGELRNWKLTKEDYCLTMSESNGTCSLDSMGSGGFMPFGLEGILRGAATCFYAFVGFDCIATTGEEAQNPQRSIPMGIVISMFICFLAYFGVSSALTLMMPYYKLHPESPLPEAFSYVGWEPARYLVAIGSLCALSTSLLGSMFPMPRVMYSMAEDGLLFRVLAKVHSVTHIPIVATLVSGVIAAFMAFLFELTDLVDLMSIGTLLAHSLVSICVLILRY 430          
BLAST of Cationic amino acid transporter 4 vs. UniProt/SwissProt
Match: sp|P30823|SL7A1_RAT (High affinity cationic amino acid transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc7a1 PE=2 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 4.645e-72
Identity = 137/424 (32.31%), Postives = 235/424 (55.42%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY-------------------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            L S    + RR+    S+  E++L+RCL+T  L+  G+   +GAG+YVL G + ++  G A  +SFL + L S+  GLCY EF   +PK GS Y Y+Y+ +GEL AFI GW +I+   I  SS+A+ +S   + L    +  F+ +++ L     +  T  D+ A++++  L  L   G   S  +N +   + ++ L  I++S FV G+ +N+                   + +GG++PFG + +  GA    YA+ GF+C++ + EE K P+K+IP  +  SL I  + Y   S  L+ M+P   ++ ++P   AF  +   E K+   + +L A   S L +++ +PR+IYAMAEDGLLF+FL K+N+ +K P  A V     + ++A    ++ L ++ S+G ++++ +V   +++LRY
Sbjct:    6 LLSLGQQMLRRKVVDCSRE-ESRLSRCLNTYDLVALGVGSTLGAGVYVLAGAVARENAGPAIVISFLIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILSYIIGTSSVARAWSATFDELIGKPIGEFSRQHMALNAPGVLAQTP-DIFAVIIIIILTGLLTLGVKESAMVNKIFTCINVLVLCFIMVSGFVKGSIENWQLTENKSSPLCGNNDTNVKYGEGGFMPFGFSGVLSGAATCFYAFVGFDCIATTGEEVKNPQKAIPVGIVASLLICFIAYFGVSAALTLMMPYFCLDTDSPLPGAFKYRGWEEAKYAVAVGSLCALSTSPLGSMFPMPRVIYAMAEDGLLFKFLAKINDRTKTPIIATVTSGAIAAVMAFLFELKDLVDLMSIGTLLAYSLVAACVLVLRY 427          
BLAST of Cationic amino acid transporter 4 vs. UniProt/SwissProt
Match: sp|Q09143|SL7A1_MOUSE (High affinity cationic amino acid transporter 1 OS=Mus musculus OX=10090 GN=Slc7a1 PE=1 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 1.815e-71
Identity = 136/417 (32.61%), Postives = 232/417 (55.64%), Query Frame = 2
Query:  155 HSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY-----------------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
              + RR+    S+  E++L+RCL+T  L+  G+   +GAG+YVL G + ++  G A  +SFL + L S+  GLCY EF   +PK GS Y Y+Y+ +GEL AFI GW +I+   I  SS+A+ +S   + L    +  F+ +++ L     +  T  D+ A++++  L  L   G   S  +N +   + ++ L  I++S FV G+ +N+                 + +GG++PFG + +  GA    YA+ GF+C++ + EE K P+K+IP  +  SL I  + Y   S  L+ M+P   ++ ++P   AF  +   E K+   I +L A   S L +++ +PR+IYAMAEDGLLF+FL K+N  +K P  A V     + ++A    ++ L ++ S+G ++++ +V   +++LRY
Sbjct:   11 QQMLRRKVVDCSRE-ESRLSRCLNTYDLVALGVGSTLGAGVYVLAGAVARENAGPAIVISFLIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILSYIIGTSSVARAWSATFDELIGKPIGEFSRQHMALNAPGVLAQTP-DIFAVIIIIILTGLLTLGVKESAMVNKIFTCINVLVLCFIVVSGFVKGSIKNWQLTEKNFSCNNNDTNVKYGEGGFMPFGFSGVLSGAATCFYAFVGFDCIATTGEEVKNPQKAIPVGIVASLLICFIAYFGVSAALTLMMPYFCLDIDSPLPGAFKHQGWEEAKYAVAIGSLCALSTSLLGSMFPMPRVIYAMAEDGLLFKFLAKINNRTKTPVIATVTSGAIAAVMAFLFELKDLVDLMSIGTLLAYSLVAACVLVLRY 425          
BLAST of Cationic amino acid transporter 4 vs. UniProt/SwissProt
Match: sp|P30825|SL7A1_HUMAN (High affinity cationic amino acid transporter 1 OS=Homo sapiens OX=9606 GN=SLC7A1 PE=1 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 2.170e-67
Identity = 138/430 (32.09%), Postives = 233/430 (54.19%), Query Frame = 2
Query:  137 VLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY------FAD------------------GGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            VL +    + RR+    S+  ET+L+RCL+T  L+  G+   +GAG+YVL G + ++  G A  +SFL + L S+  GLCY EF   +PK GS Y Y+Y+ +GEL AFI GW +I+   I  SS+A+ +S   + L    +  F+  ++ L     + +   D+ A++++  L  L   G   S  +N +   + ++ L  I++S FV G+ +N+      F +                  GG++PFG + +  GA    YA+ GF+C++ + EE K P+K+IP  +  SL I  + Y   S  L+ M+P   ++ N+P   AF        K+   + +L A  AS L +++ +PR+IYAMAEDGLLF+FL  VN+ +K P  A +     + ++A    ++ L ++ S+G ++++ +V   +++LRY
Sbjct:    5 VLLNIGQQMLRRKVVDCSRE-ETRLSRCLNTFDLVALGVGSTLGAGVYVLAGAVARENAGPAIVISFLIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILSYIIGTSSVARAWSATFDELIGRPIGEFSRTHMTLNAPGVLAENP-DIFAVIIILILTGLLTLGVKESAMVNKIFTCINVLVLGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLNNDTKEGKPGVGGFMPFGFSGVLSGAATCFYAFVGFDCIATTGEEVKNPQKAIPVGIVASLLICFIAYFGVSAALTLMMPYFCLDNNSPLPDAFKHVGWEGAKYAVAVGSLCALSASLLGSMFPMPRVIYAMAEDGLLFKFLANVNDRTKTPIIATLASGAVAAVMAFLFDLKDLVDLMSIGTLLAYSLVAACVLVLRY 432          
BLAST of Cationic amino acid transporter 4 vs. UniProt/SwissProt
Match: sp|Q8WY07|CTR3_HUMAN (Cationic amino acid transporter 3 OS=Homo sapiens OX=9606 GN=SLC7A3 PE=1 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 1.162e-66
Identity = 139/427 (32.55%), Postives = 228/427 (53.40%), Query Frame = 2
Query:  143 HSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAV-NLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY----------------------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
              F   + RRR+  +S   ET+L RCLST  L+  G+   +GAG+YVL G + KD+ G +  + FL + L S+  GLCY EF   +P++GS Y Y+Y+ +GEL AF  GW +I+   I  +S+A+ +S A  NL+ N+  K          P   +     D  AL L+  L  L   GA+ S  +  V   + L+ L  ++IS FV G+  N+                         GG++PFG   I +GA    YA+ GF+C++ + EE + P++SIP  + +SL +  + Y   S+ L+ M+P  Q+   +P   AF        +++  + +L A   S L +++ +PR+IYAMAEDGLLFR L +++  ++ P  A VV  + +  +A   ++  L ++ S+G ++++ +V + ++ILRY
Sbjct:    7 RRFGQKLVRRRTL-ESGMAETRLARCLSTLDLVALGVGSTLGAGVYVLAGEVAKDKAGPSIVICFLVAALSSVLAGLCYAEFGARVPRSGSAYLYSYVTVGELWAFTTGWNLILSYVIGTASVARAWSSAFDNLIGNHISKTLQGSIALHVP--HVLAEYPDFFALGLVLLLTGLLALGASESALVTKVFTGVNLLVLGFVMISGFVKGDVHNWKLTEEDYELAMAELNDTYSLGPLGSGGFVPFGFEGILRGAATCFYAFVGFDCIATTGEEAQNPQRSIPMGIVISLSVCFLAYFAVSSALTLMMPYYQLQPESPLPEAFLYIGWAPARYVVAVGSLCALSTSLLGSMFPMPRVIYAMAEDGLLFRVLARIHTGTRTPIIATVVSGIIAAFMAFLFKLTDLVDLMSIGTLLAYSLVSICVLILRY 430          
BLAST of Cationic amino acid transporter 4 vs. UniProt/SwissProt
Match: sp|O08812|CTR3_RAT (Cationic amino acid transporter 3 OS=Rattus norvegicus OX=10116 GN=Slc7a3 PE=2 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 1.374e-65
Identity = 142/428 (33.18%), Postives = 227/428 (53.04%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAV-NLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY----------------------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            L  F   + RRR        ET+L RCLST  L+  G+   +GAG+YVL G + K++ G +  + FL + L S+  GLCY EF   +P +GS Y Y+Y+ +GEL AF  GW +I+   I  +S+A+ +S A  NL+ N+  +      +   P   +     D  AL L+  L  L + GAN S  +  V   + L+ L  +IIS F+ G  +N+                         GG++PFG+  I +GA    YA+ GF+C++ + EE + P++SIP  + +SL I  + Y   S+ L+ M+P  ++   +P   AFT       ++L  I +L A   S L +++ +PR+IYAMAEDGLLFR L +V+  +  P  A VV  + +  +A    +  L ++ S+G ++++ +V + ++ILRY
Sbjct:    6 LRRFGQKLVRRRLLELGMG-ETRLARCLSTLDLVALGVGSTLGAGVYVLAGEVAKEKAGPSIVICFLVAALSSVLAGLCYAEFGARVPGSGSAYLYSYVTVGELWAFTTGWNLILSYVIGTASVARAWSSAFDNLIGNHISQTLKGTILLNMP--HVLAEYPDFFALALVLLLTGLLVLGANESGLVTKVFTGMNLLVLGFVIISGFIKGELRNWKLTKEDYCLTMSESNGTCSLDSMGSGGFMPFGLEGILRGAATCFYAFVGFDCIATTGEEAQNPQRSIPMGIVISLSICFLAYFGVSSALTLMMPYYKLQPESPLPEAFTYVGWEPARYLVAIGSLCALSTSLLGSMFPMPRVIYAMAEDGLLFRVLARVHNGTHTPIVATVVSGVIAAFMAFLFELTDLVDLMSIGTLLAYSLVSICVLILRY 430          
BLAST of Cationic amino acid transporter 4 vs. TrEMBL
Match: A0A0H3YF62 (Slc7a-3 OS=Schmidtea mediterranea OX=79327 GN=slc7a-3 PE=2 SV=1)

HSP 1 Score: 746.503 bits (1926), Expect = 0.000e+0
Identity = 433/592 (73.14%), Postives = 510/592 (86.15%), Query Frame = 2
Query:   83 MHTVQVGQERSFIFFMSYVLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNYFADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRYLHXXXXXXXXXXXXXXXXMRFTIFSGLANRTCFKGIFICLLFSIIFMGLSILLLYPIHYISGIICSVFCXXXXXXXXXXXXXXXXXXXKDAFAXXXXXXXXXXXXXXXXXXXXXXXXETWIRFLVWILFGLLIYFFYGIPNSHLSEKAEEKTXXXXXXXXXXXXXKQE 1858
            MHTVQVGQERSFIFFMSYVLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFI+GWTMI+D  +SL+S++KGFSGAVN+L N+AVKNFTD+Y+PL+  S++W++S D++A  LLFTLFL+TLTGANIS+NIN VL+ +QLIFL+ III CFVYG+ QN+ +DGGYLPFG  SIFQGAGI I+AYSGFECL+NSAEETK PRKSIP ALFVSLGI+I+LYVL S+GLSFMVPRLQI++ APFI+AF+ ++L  LKW+TGIATLLATGA+KLA  YVIPRMIY MAEDGL+F+FL K++E SK+P  A++VG+ FS++LA+F++IQ+LA+ITSMGII+SF+ +G+DLIILRY+  +E      + S+ L MR    S +  R  FK     L+ SII  G+SIL + PI  I+GII S   ++ +LT ++++SLY+P   KD F TPLMPLTPIITI LNICLL+NLP  TW+RFLV  + GLLIYFFYGIPNSHLSEKAEEKTELILLDNNNDEILKQE
Sbjct:    1 MHTVQVGQERSFIFFMSYVLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVLAFALLFTLFLITLTGANISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNFVSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWITGIATLLATGATKLAVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIF-DENNENTIDNSQKLPMRINTNSMICTRKFFKISLFSLIISIILTGVSILFILPISQITGIIFSAIFILLILTFTIIISLYEPTDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSEKAEEKTELILLDNNNDEILKQE 591          
BLAST of Cationic amino acid transporter 4 vs. TrEMBL
Match: A0A0H3YJ04 (Slc7a-5 OS=Schmidtea mediterranea OX=79327 GN=slc7a-5 PE=2 SV=1)

HSP 1 Score: 565.074 bits (1455), Expect = 0.000e+0
Identity = 313/546 (57.33%), Postives = 419/546 (76.74%), Query Frame = 2
Query:  167 RRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNYFADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRYLHXXXXXXXXXXXXXXXXMRFTIFSGLANRTCFKGIFICLLFSIIFMGLSILLLYPIHYISGIICSVFCXXXXXXXXXXXXXXXXXXXKDAFAXXXXXXXXXXXXXXXXXXXXXXXXETWIRFLVWILFGLLIYFFYGIPNSHLSEKAEE 1804
            R++SFSQ ++L+T L+RCLST QL FYGIS MIG GIY+LTG IIKD+VG  TNLSFL SG ISIFTGLCYCEFSTLIPKAGS YTYTYLMMGELPAFIIGWT++M+  I+L+ +AKGFS A+N + N  + N+T +++PL+ DS IWD+S+D+VA+LL+  LF  +LTG +IS+N+N VLA  Q++FLTTIII+CFVYG++QNY  DGGYLPFG  S+F+GAG+ I+ Y+GFE L+N AEETK+P+KSIPTA+  SL ++++LY L STGL ++VPR QI+ ++PFI+AF  K+L  +KW+T I T+LA  A+K   IY+IPR IYAMA DGLLFRFL  +N+ SK+P +AL+ G+LFS  L MF++I+ILA++T++GIIISF+ VG++L+ILRYLH  + E      +  +EMR    + LAN+  FK +  C + S I  G S L +YP   I GI+   F L+ +L M ++LSLY+P   K+ F TPLMPL P+ITI LNI ++++ P+ TWIR+L+ + FGL++Y F+G  NS L+EK EE
Sbjct:   14 RKQSFSQLQTLDTNLDRCLSTYQLTFYGISRMIGVGIYILTGIIIKDKVGPGTNLSFLLSGFISIFTGLCYCEFSTLIPKAGSSYTYTYLMMGELPAFIIGWTVLMNYIIALAGVAKGFSAAINSIVNGTIGNWTLKHLPLSKDSTIWDSSIDIVAVLLILLLFSFSLTGISISMNVNCVLAISQILFLTTIIIACFVYGSNQNYLDDGGYLPFGFLSVFKGAGLVIFTYAGFESLANIAEETKDPKKSIPTAMLTSLSLIVILYFLISTGLPYLVPRHQIDASSPFITAFMEKNLVLMKWVTIIGTILAIAATKFTVIYIIPRAIYAMANDGLLFRFLANINKKSKIPISALITGILFSCTLTMFIKIEILADVTTIGIIISFITVGINLLILRYLHETDTEKSLMESNVPMEMRVNSCAFLANQNIFKAVLSCFIISNILFGFSFLYIYPTFQIFGIVVCTFSLMVILLMMIILSLYEPHCFKEGFTTPLMPLAPVITIILNISIIVHFPIGTWIRYLICLSFGLILYIFHGFSNSELAEKVEE 559          
BLAST of Cationic amino acid transporter 4 vs. TrEMBL
Match: A0A4E0RW66 (High affinity cationic amino acid transporter 1 OS=Fasciola hepatica OX=6192 GN=D915_003250 PE=4 SV=1)

HSP 1 Score: 417.542 bits (1072), Expect = 1.483e-134
Identity = 253/584 (43.32%), Postives = 376/584 (64.38%), Query Frame = 2
Query:  143 HSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNYFADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRYLHXXXXXXXXXXXXXXXXM------------RFTIFS----------------GLANRTCFKGIFICLLFSIIFMGLSILLLYPIHYISGI-ICSVFCXXXXXXXXXXXXXXXXXXXKDAFAXXXXXXXXXXXXXXXXXXXXXXXXETWIRFLVWILFGLLIYFFYGIPNSHLSEKAEEK 1807
              F   + R+R  ++   LET L RCL+TSQL  Y ++HMIGAG+YVLTG +I+D  G AT L++L S   SIFT LCY EF+TL P+AGS Y YTYLM GELPAF+ GWTMI D+ +S +++AK FSG +N LSN  ++N+T  ++    +S + D+S DLV+   L  L L+TLTGAN SL +NAVL+A+Q+  LT I ++ FV G   N+ A GG+ PFGV+ + +GAG+ ++A+SGFE ++N++EE K PR+ +P ALF SL I  +LYV  S GL+++VPR +I  +APF++AF+  +   L W +  ATLLATGA+KL A+YVIPR+ YA+A DGLLF  +  V   +KVP  +L+VG L + +L++F++IQ+LAE TS+G+I S+ ++G++L++LRYL  +E   IE++ ++  +M            R ++                  G+  R CF  I    + ++I +G++I + + IH IS + I S+  ++ LL    +L  Y+P+  +  F TP MP+ P +T+  N  L+  +   TW+RF VW   GLLIYF YG+  S   + A+++
Sbjct:   11 REFCRRLMRKRPVAEDSKLETPLKRCLNTSQLTLYCVAHMIGAGLYVLTGQLIRDYAGPATALAYLVSAFTSIFTALCYAEFTTLFPRAGSAYLYTYLMFGELPAFLTGWTMIADVIVSSAAVAKAFSGTINWLSNGTIRNWTSTHLVHIGNSHVLDSSPDLVSGGFLLLLVLVTLTGANFSLTVNAVLSAIQICCLTVITVAFFVLGTPDNFHAQGGFFPFGVSGVLRGAGLAVFAFSGFEAVANASEEAKNPRRDLPIALFSSLLICGILYVGVSLGLAYIVPRNEIVYDAPFVAAFSYVNQSGLMWFSAFATLLATGATKLVAMYVIPRLFYAIASDGLLFECMSCVESRTKVPMASLIVGGLITILLSIFIKIQVLAEFTSVGVIFSYFLIGLNLMVLRYLFVDEYHVIENDPTEKRDMMEYQASMQSDQTRASLIPPPTELWLRPCIPNCIRGIETRRCFHVILTVFICAVIGLGITINMFF-IHEISWLWILSLVFIVILLATFAMLCAYEPMRYRKGFETPAMPVAPCVTMLTNGILITCMEPLTWLRFGVWSALGLLIYFVYGMWFSKADDLAKKE 593          
BLAST of Cationic amino acid transporter 4 vs. TrEMBL
Match: A0A2H1CIM4 (Amino acid permease OS=Fasciola hepatica OX=6192 GN=D915_05323 PE=4 SV=1)

HSP 1 Score: 407.912 bits (1047), Expect = 1.198e-131
Identity = 204/405 (50.37%), Postives = 291/405 (71.85%), Query Frame = 2
Query:  143 HSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNYFADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRYL 1357
              F   + R+R  ++   LET L RCL+TSQL  Y ++HMIGAG+YVLTG +I+D  G AT L++L S   SIFT LCY EF+TL P+AGS Y YTYLM GELPAF+ GWTMI D+ +S +++AK FSG +N LSN  ++N+T  ++    +S + D+S DLV+   L  L L+TLTGAN SL +NAVL+A+Q+  LT I ++ FV G   N+ A GG+ PFGV+ + +GAG+ ++A+SGFE ++N++EE K PR+ +P ALF SL I  +LYV  S GL+++VPR +I  +APF++AF+  +   L W +  ATLLATGA+KL A+YVIPR+ YA+A DGLLF  +  V   +KVP  +L+VG L + +L++F++IQ+LAE TS+G+I S+ ++G++L++LRYL
Sbjct:   11 REFCRRLMRKRPVAEDSKLETPLKRCLNTSQLTLYCVAHMIGAGLYVLTGQLIRDYAGPATALAYLVSAFTSIFTALCYAEFTTLFPRAGSAYLYTYLMFGELPAFLTGWTMIADVIVSSAAVAKAFSGTINWLSNGTIRNWTSTHLVHIGNSHVLDSSPDLVSGGFLLLLVLVTLTGANFSLTVNAVLSAIQICCLTVITVAFFVLGTPDNFHAQGGFFPFGVSGVLRGAGLAVFAFSGFEAVANASEEAKNPRRDLPIALFSSLLICGILYVGVSLGLAYIVPRNEIVYDAPFVAAFSYVNQSGLMWFSAFATLLATGATKLVAMYVIPRLFYAIASDGLLFECMSCVESRTKVPMASLIVGGLITILLSIFIKIQVLAEFTSVGVIFSYFLIGLNLMVLRYL 415          
BLAST of Cationic amino acid transporter 4 vs. TrEMBL
Match: A0A504YNC3 (High affinity cationic amino acid transporter 1 OS=Fasciola gigantica OX=46835 GN=FGIG_03146 PE=4 SV=1)

HSP 1 Score: 403.675 bits (1036), Expect = 1.619e-129
Identity = 203/405 (50.12%), Postives = 290/405 (71.60%), Query Frame = 2
Query:  143 HSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNYFADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRYL 1357
              F   + R+R  ++   LET L RCL+ SQL  Y ++HMIGAG+YVLTG +I+D  GSAT L++L S   SIFT LCY EF+TL P+AGS Y YTYLM GELPAF+ GWTMI D+ +S +++AK FSG +N LSN  ++N+T  ++    +S + D+S DLV+   L  L L+TLTGAN SL +NAVL+A+Q+  L  I ++ FV G   N+ A GG+ PFGV+ + +GAG+ ++A+SGFE ++N++EE K PR+ +P ALF SL I  +LYV  S GL+++VPR +I  +APF++AF+  +   L W +  ATLLATGA+KL A+YVIPR+ YA+A DGLLF  +  V   +KVP  +L+VG L + +L++F++IQ+LAE TS+G+I S+ ++G++L++LRYL
Sbjct:   11 REFCRRLMRKRPVAEDSKLETPLKRCLNASQLTLYCVAHMIGAGLYVLTGQLIRDYAGSATALAYLVSAFTSIFTALCYAEFTTLFPRAGSAYLYTYLMFGELPAFLTGWTMIADVMVSSAAVAKAFSGTINWLSNGTIRNWTLTHLVHIGNSHVLDSSPDLVSGGFLLLLVLVTLTGANFSLTVNAVLSAIQICCLIVITVAFFVLGTPDNFHAQGGFFPFGVSGVLRGAGLAVFAFSGFEAVANASEEAKNPRRDLPIALFSSLLICGILYVGVSLGLAYIVPRNEIVYDAPFVAAFSYVNQSGLMWFSAFATLLATGATKLVAMYVIPRLFYAIASDGLLFECMSCVESRTKVPMVSLIVGGLITILLSIFIKIQVLAEFTSVGVIFSYFLIGLNLMVLRYL 415          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Cavefish
Match: slc7a3b (cationic amino acid transporter 3-like [Source:NCBI gene;Acc:103021899])

HSP 1 Score: 242.662 bits (618), Expect = 5.043e-71
Identity = 141/424 (33.25%), Postives = 231/424 (54.48%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY-------------------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            L SF   + RRR    +   ET+  RCL+T  LI  G+   +GAG+YVL G + +++ G A  LSFL + L S+  GLCY EF   +PK GS Y Y+Y+ +GE+ AFI GW +I+   I  +S+A+ +S   + L    +  F +  + L     +     DL AL+L+  L  L   G + S  +N +   + L+ L  +IIS FV G++ N+                   F +GG+ PFG + I  GA    YA+ GF+C++ ++EE K P++SIP  +  SL I  V Y   S  L+ M+P   ++ ++P   AF        +++  + +L A   S L +++ +PR+I+AMAEDGLLFR L ++++ +K P  A +   + + ++A    +  L ++ S+G ++++ +V V ++ILRY
Sbjct:    3 LASFGRMLVRRRVLDTNDE-ETRFARCLTTLDLIALGVGATLGAGVYVLAGEVAREKAGPAIVLSFLIAALSSVLAGLCYAEFGARVPKTGSAYLYSYVTVGEIWAFITGWNLILSYVIGTASVARAWSSTFDNLVEQKISTFFNGSMALPDTGGVLAKYPDLFALVLILLLTGLLAFGVSESALVNKIFTGINLVVLGFVIISGFVKGDTANWNISLEDIQNRSLLVPPNTKFGNGGFAPFGFSGILSGAATCFYAFVGFDCIATTSEEAKNPQRSIPIGIVASLLICFVAYFGVSAALTMMMPYYLLDTDSPLPEAFKYVEWDPARYIVAVGSLCALSTSLLGSMFPMPRVIFAMAEDGLLFRSLSRMHKKTKTPVLATIASGVVAALMAFIFSLDALVDLMSIGTLLAYTLVAVCVLILRY 425          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Cavefish
Match: ENSAMXT00000005386.2 (cationic amino acid transporter 4-like [Source:NCBI gene;Acc:111196449])

HSP 1 Score: 241.506 bits (615), Expect = 3.418e-70
Identity = 129/396 (32.58%), Postives = 228/396 (57.58%), Query Frame = 2
Query:  185 QSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTS-----VDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNYFA-DGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            +   + T L RCLST  L   G+  M+G+G+YVLTG + KD  G A  LSFL +G+ S+   LCY EF   +PK GS Y +TY+ +GE+ AF+IGW +I++  I  +++A+ +SG ++ + N+ ++NFT+ +V        WD        DL+A  +L    +    G  +S  +N + +A+ ++ +T I++  F+  +  N+ A +GG+ P+G++ +  G     YA+ GF+ ++ S+EE ++P+K+IP A  +SL +    Y+L ST L+ MVP   ++ N+    AF  +      ++  + ++ A     L+ ++ +PR++YAM+EDGL F    +VN  +KVP  A++V       LA+   ++ L +  S+G ++++  V   +I+LR+
Sbjct:   25 EDDVMATSLKRCLSTLDLALLGVGGMVGSGLYVLTGTVAKDTAGPAVVLSFLIAGIASLMAALCYAEFGARVPKTGSAYMFTYVSVGEIWAFLIGWNVILEYMIGGAAVARAWSGYLDSIFNHRIQNFTESHV------MRWDVPFLAHYPDLLAAGILVVASIFISFGVRVSSWLNHIFSAVSMVVITFILVFGFMLADPANWSAREGGFAPYGLSGVMAGTATCFYAFVGFDVIAASSEEARDPQKAIPIATAISLALAATAYILVSTVLTLMVPWHTLDPNSALSDAFFRRGYSWAGFIVAVGSICAMNTVLLSNLFSLPRIVYAMSEDGLFFPIFSRVNPVTKVPVIAILVFGSLMAFLALIFDLEALVQFLSIGTLLAYTFVAASIIVLRF 414          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Cavefish
Match: slc7a3a (cationic amino acid transporter 3 [Source:NCBI gene;Acc:103034170])

HSP 1 Score: 240.35 bits (612), Expect = 5.348e-70
Identity = 141/418 (33.73%), Postives = 224/418 (53.59%), Query Frame = 2
Query:  167 RRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY----------------------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            RRR    S   ET+  RCLST  L+  G+   +GAG+YVL G + +++ G A  L FL + L S+  GLCY EF   +PK GS Y Y+Y+ +GE+ AFI GW +I+   I  +S+A+ +S   + L    + +F    + +     +     DL AL+L+  L  L   G + S  +N +   + L+ L  +IIS FV GN++N+                      F  GG+ PFG + I  GA    YA+ GF+C++ ++EE K P +SIP  +  SL I    Y   S  L+ M+P  ++N  +P   AF+       +++  + +L A   S L +++ +PR+IYAMAEDGLLFR L ++N+ +K P  A V     + ++A    +  L ++ S+G ++++ +V V ++ILRY
Sbjct:   14 RRRVLDCSGE-ETRFARCLSTLDLVALGVGSTLGAGVYVLAGEVAREKAGPAIVLCFLVAALSSMLAGLCYAEFGARVPKTGSAYLYSYVTVGEIWAFITGWNLILSYVIGTASVARAWSSTFDNLVEQKISSFFKSAMAIKVPGNVLAEYPDLFALILILLLSGLLAFGVSESALVNKIFTGVNLVVLGFVIISGFVKGNTENWNLTLNDFINDTNITTPEVVEKSFGTGGFAPFGFSGILSGAATCFYAFVGFDCIATTSEEAKNPMRSIPVGIVASLLICFFAYFGVSAALTLMMPYYKLNTQSPLPEAFSYVGWAPARYIVAVGSLCALSTSLLGSMFPMPRVIYAMAEDGLLFRALSRMNKRTKTPLLATVASGFVAALMAFLFDLAALVDLMSIGTLLAYSLVAVCVLILRY 430          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Cavefish
Match: ENSAMXT00000010113.2 (pep primary_assembly:Astyanax_mexicanus-2.0:1:11948206:11968754:-1 gene:ENSAMXG00000009846.2 transcript:ENSAMXT00000010113.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 236.113 bits (601), Expect = 4.522e-69
Identity = 133/415 (32.05%), Postives = 227/415 (54.70%), Query Frame = 2
Query:  149 FLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY-------------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            F   + R ++   S   E++L+RCL+T  L+  G+   +GAG+YVL G + ++  G A  LSFL + L S+  GLCY EF   +PK GS Y Y+Y+ +GEL AFI GW +I+   I  SS+A+ +S   + L    ++ F   ++ +     I     D+ A+L++  L  L   G   S  +N V   + ++ L  +++S  + G  +N+               +GG++PFG   +  GA    YA+ GF+C++ + EE K P+++IP  +  SL I  V Y   S  L+ M+P   +++N+P  +AF        K+   + +L A   S L +++ +PR+I+AMAEDGLLF+FL K+N  SK P  A +   + + ++A    ++ L ++ S+G ++++ +V   +++LRY
Sbjct:    4 FGEQLLRVKAVDCSTE-ESRLSRCLNTFDLVALGVGSTLGAGVYVLAGAVARENAGPAIVLSFLIAALASVMAGLCYAEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILSYIIGTSSVARAWSATFDELIKKQIELFCRTHMRMNAPG-ILAEYPDMFAVLIILILTGLLAFGVKESAMVNKVFTCVNVLVLMFVVVSGLIKGTFKNWNIDPDDVLNGTSILGEGGFMPFGFTGVLSGAATCFYAFVGFDCIATTGEEVKNPQRAIPIGIVASLLICFVAYFGVSAALTMMMPYYLLDQNSPLPAAFKYVGWDGAKYAVAVGSLCALSTSLLGSMFPMPRIIWAMAEDGLLFKFLAKINTKSKTPVLATITSGIVAAVMAFLFDLKDLVDLMSIGTLLAYTLVAACVLVLRY 416          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Cavefish
Match: slc7a2 (solute carrier family 7 member 2 [Source:NCBI gene;Acc:103042120])

HSP 1 Score: 236.113 bits (601), Expect = 1.743e-68
Identity = 143/432 (33.10%), Postives = 231/432 (53.47%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLT-PDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY--------------------------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            L SF HS+ RR++    +  ++KL RCLST  LI  G+   +GAG+YVL G + K   G +  +SFL + L S+  GLCY EF   +PK GS Y Y+Y+ +GEL AFI GW +I+   I  SS+A+ +SG  + L    ++ F  +Y  ++ P    +    D  A+ L+  L  L   G   S  +N +  A+ ++ L  +IIS FV G+S N+                          +  GG+LP+G      GA    YA+ GF+C++ + EE K P+++IP  +  SL I  + Y   S  L+ M+P   ++E +P   AF        K++  + +L A   S L +I+ +PR+IYAMA+DG+LF+ L ++N  +K P  A +   + + I+A    ++ L ++ S+G ++++ +V   ++ILRY
Sbjct:    5 LLSFGHSLVRRKNVDCLE--DSKLCRCLSTVDLIALGVGSTLGAGVYVLAGEVAKGDSGPSIVVSFLIAALASVMAGLCYAEFGARVPKTGSAYLYSYVTVGELLAFITGWNLILSYVIGTSSVARAWSGTFDELIGGHIETFCTKYFRMSLPGLAEYP---DFFAVCLILLLSGLLSFGVKESAWVNKIFTAVNVLVLMFVIISGFVKGDSYNWNISEESLINVTIVTRNLSYTENVTSDYGAGGFLPYGFGGTLAGAATCFYAFVGFDCIATTGEEVKNPQRAIPIGIVSSLLICFLAYFGVSAALTLMMPYYLLDEKSPLPMAFEYVGWGPAKYVVAVGSLCALSTSLLGSIFPMPRVIYAMADDGVLFKVLARINPKTKTPVIATMTSGVVAAIMACIFDLKALVDMMSIGTLLAYSLVAACVLILRY 431          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000766.1 (pep scaffold:Pmarinus_7.0:GL478727:35765:49900:1 gene:ENSPMAG00000000697.1 transcript:ENSPMAT00000000766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 213.001 bits (541), Expect = 3.623e-61
Identity = 127/415 (30.60%), Postives = 215/415 (51.81%), Query Frame = 2
Query:  200 ETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY-----------------------------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRYL 1357
            ++ L RCLST  L+  G+   +GAG YVL G + +   G +  LSFL + L S+  GLCY EF   +P+ GS Y Y+Y+ +GEL AFI GW +I+   I  SS+A+ +S   N L    +  F  +++ +  D+       D+ A  ++  L  L   G   S  IN V   +  + LT +II+ F+ G++ N+                             F  GG++P+GV  +  GA    YA+ GF+C++ + EE + P+++IP  +  SL +  + Y   S  L+ ++P   ++ N P   AF        ++      L A  AS L +++ +PR++YAMA DGLLFR+L +V+E  + P  A +     + ++A+   ++ L ++ S+G ++++ +V   ++ILRY+
Sbjct:    2 DSSLARCLSTFDLVALGVGSTLGAGAYVLAGAVARQDAGPSIVLSFLVAALASVLAGLCYAEFGARVPRTGSAYLYSYVTVGELLAFITGWNLILSYVIGTSSVARAWSANFNDLIGGHISAFFGQHMVM--DAPGLARYPDVFAAFIIMLLAGLLSFGVKESAIINKVFTCINALVLTFVIIAGFIKGDTHNFNVPYSYLNVIMIFDDSSRNIPAGLNASSSFGVGGFMPYGVTGMLSGAATCFYAFVGFDCIATTGEEVRNPQRAIPFGIVASLLLCFLAYFGVSAALTLLMPYCLLDPNNPLPVAFQFVGWGPARYAVAAGALCALSASMLGSMFPLPRIMYAMARDGLLFRYLARVSE-RRTPVAATLSAGCLAAVMALLFDLKDLVDMMSIGTLLAYSLVAACVLILRYV 413          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Sea Lamprey
Match: slc7a4 (solute carrier family 7 member 4 [Source:ZFIN;Acc:ZDB-GENE-030919-2])

HSP 1 Score: 206.838 bits (525), Expect = 1.724e-58
Identity = 130/392 (33.16%), Postives = 220/392 (56.12%), Query Frame = 2
Query:  197 LETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTS-----VDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNYFA-DGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            +ET L RCLST  L   G+  M+G+G+YVLTG + K   G A  +SFL +GL S+   LCY EF    P+AGS Y YTY+ MGE+ AF+IGW ++++  I  +++A+ +SG  + +  + ++NFT  +V        WD        D +A  +LF   +L   G  +S  IN + A + +  +  I++  F   + QNY   +GG+ P+G + I  G     +A+ GF+ +++S+EE ++P +S+P A  +SL +  + Y L +T L+ MVP   +   +    AF+ +      ++    ++ A     L++++ +PR+IYAMA+DGL F     ++  +KVP NA+VV    + +LA    ++ L +  S+G ++++  V   +I+LRY
Sbjct:   29 METSLTRCLSTLDLTLLGLGGMVGSGLYVLTGTVAKSMAGPAVIISFLLAGLASMLAALCYAEFGARAPRAGSAYLYTYMTMGEVWAFMIGWNVVLEYMIGGAAVARAWSGYFDAIFEHKIQNFTLTHV------ASWDVPFLAHYPDFLACGILFIATILVSFGTKVSSWINHLFAVISMGAILFILVFGFTLADPQNYSKKEGGFAPYGFSGIMTGTATCFFAFVGFDVIASSSEEARDPSRSVPVATALSLVLATLAYTLVATVLTLMVPWHSLVPESALSDAFSRRGHPWAGFIVSTGSICAMNTVLLSSLFSLPRIIYAMADDGLFFSVFSHLHAVTKVPVNAIVVFGTLTAVLATLFDLEALVQFLSIGTLLAYTFVAASVIVLRY 414          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000741.1 (pep scaffold:Pmarinus_7.0:GL501074:1046:17370:1 gene:ENSPMAG00000000668.1 transcript:ENSPMAT00000000741.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 123.635 bits (309), Expect = 3.638e-30
Identity = 71/246 (28.86%), Postives = 130/246 (52.85%), Query Frame = 2
Query:  674 GANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY-------------------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            G   S  +N +   + ++ L  ++++ FV G+  N+                      GG+LPFGV  +  GA    YA+ GF+C++ + EE K P+++IP  + VSL I    Y   S  L+ M+P   +++ +P   AF        K+   + +L A   S L +++ +PR++YAMA DGL+FR L K++ S K P  A +   + + ++A+ + ++ L ++ S+G ++++ +V   ++ILRY
Sbjct:   58 GVKESAWVNKIFTVVNVLVLCFVVVAGFVKGDIHNWAIVPEEITNITSSHSAELRLGVGGFLPFGVTGMLAGAATCFYAFIGFDCIATTGEEVKNPQRAIPVGIVVSLLICFAAYFGVSAALTLMMPYYLLDKESPLPVAFEYVGWDPAKYPVAVGSLCALSTSLLGSMFPLPRIVYAMARDGLIFRHLAKLS-SRKSPVVATMASGMLAAVMALLLDLKDLVDMMSIGTLLAYSLVAACVLILRY 302          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001199.1 (pep scaffold:Pmarinus_7.0:GL479551:1043:11089:-1 gene:ENSPMAG00000001071.1 transcript:ENSPMAT00000001199.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.145 bits (261), Expect = 2.139e-25
Identity = 49/117 (41.88%), Postives = 73/117 (62.39%), Query Frame = 2
Query:  143 HSFLHSITRRRS--FSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMD 487
              F  +++RR+S       + E++L+R LST  L+  G+   +GAG+YVL G + +D  G A  LSFL + + S+  GLCY EF   +PK GS Y Y+Y+ +GEL AF+ GWT++ D
Sbjct:    6 ERFARTLSRRKSGAMDADGTEESQLSR-LSTLDLVVLGVGSTLGAGVYVLAGAVARDDAGPAIVLSFLVAAVASVLAGLCYAEFGARVPKTGSAYLYSYVAVGELCAFVTGWTLLRD 121          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002665.1 (pep scaffold:Pmarinus_7.0:GL476806:119517:143089:1 gene:ENSPMAG00000002414.1 transcript:ENSPMAT00000002665.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.6481 bits (200), Expect = 9.085e-17
Identity = 94/383 (24.54%), Postives = 172/383 (44.91%), Query Frame = 2
Query:  251 ISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSG--LISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLS---NNAVKNFTDRYV--PLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVY---GNSQNYFADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTG-LSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAM-FVRIQILAEITSMGIIISFMIVGVD---LIILRY 1354
            +  M+G+GI+V  G +++   G  ++   +++G  L+S+   LCY E    +P  G  Y Y     G   AF+  WT                  +V LL    N+AV      YV  PL          V  +A+  L  + +L       ++    VL  L+++ L  + +   V    G + N        P   A I +    G++AY G+  L+ + EE K+  K+I   + V++ +V   YVL +   ++ + P+ +I  +A     +  + L    W+  ++  ++T  S   + +V+ R+ YA A +G     L  ++   + PT A    V FST+L++ FV    L  +T+    +++++VG++   L++LRY
Sbjct:   50 VGSMVGSGIFVSPGGVLRFVGGDPSSALLVWAGCGLLSLLGALCYAELGAAVPTTGGEYAYVRRAFGAPLAFLFAWT------------------SVALLRPAMNSAVALTFAEYVLRPLFHGCPAPPAIVKCLAIASLLVVGILNCVSMKWAMRALDVLTLLKMLALAIVSVGGLVLLASGRTHNPLGSFAGAPPSPAQIGESFYQGLWAYGGWNALNYATEELKDVHKNITRCIVVAVPLVTAFYVLVNISYMTVLTPK-EIISSAAVAVTWGDRVLGSFSWIVPLSVAVSTFGSLNCSAFVMGRLNYAAAREGHALPLLAMLSVRHQTPTPA----VAFSTLLSVAFVLPTDLIMLTNYFGFVTWLLVGLNCAGLLVLRY 409          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Yeast
Match: BAP2 (High-affinity leucine permease; functions as a branched-chain amino acid permease involved in uptake of leucine, isoleucine and valine; contains 12 predicted transmembrane domains; BAP2 has a paralog, BAP3, that arose from the whole genome duplication [Source:SGD;Acc:S000000272])

HSP 1 Score: 55.0694 bits (131), Expect = 2.498e-8
Identity = 41/147 (27.89%), Postives = 73/147 (49.66%), Query Frame = 2
Query:  848 YAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQ---------INENAPFISAFTGKSLHELKWLTGIAT---LLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTI 1252
            +++ G E  + S +E   PRKS P A   S+  ++V+Y+LT   + F VP                +P++ A    S+H +K +  I     L++  +   +++Y  PR+I ++A+ G   +FLD V+   + P  AL+V  +F  I
Sbjct:  299 FSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLA---ASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGR-PLRALIVCCVFGVI 441          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Yeast
Match: HIP1 (High-affinity histidine permease; also involved in the transport of manganese ions [Source:SGD;Acc:S000003423])

HSP 1 Score: 54.6842 bits (130), Expect = 2.877e-8
Identity = 43/155 (27.74%), Postives = 75/155 (48.39%), Query Frame = 2
Query:  809 GVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQIN----------ENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLF 1243
            G+ S+F  A    ++YSG E  + SA E+K PR++IP A   +  ++   YV   T +  +VP                ++P + A     +  L  L     L+A  +   +A+Y   R + AMA  G L +FL++V++  + P NA+++ + F
Sbjct:  283 GLCSVFVTAA---FSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGR-PMNAILLTLFF 433          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Yeast
Match: DIP5 (Dicarboxylic amino acid permease; mediates high-affinity and high-capacity transport of L-glutamate and L-aspartate; also a transporter for Gln, Asn, Ser, Ala, and Gly; relocalizes from plasma membrane to vacuole upon DNA replication stress [Source:SGD;Acc:S000006186])

HSP 1 Score: 51.2174 bits (121), Expect = 3.965e-7
Identity = 41/152 (26.97%), Postives = 73/152 (48.03%), Query Frame = 2
Query:  845 IYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLT----STGLSFMVPRLQINEN-------APFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFV 1267
            +++Y+G E       E + PRKS+P A+ +++  +IV Y+ T       +++  PRL   +        +PF+ A     +  L  +     L+   ++  + +YV  R +YA+A DG   +   K +    VP NAL++ VLF  +  M V
Sbjct:  294 LFSYTGIELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWG-VPYNALILSVLFCGLAYMNV 444          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Yeast
Match: TAT1 (Amino acid transporter for valine, leucine, isoleucine, and tyrosine; low-affinity tryptophan and histidine transporter; overexpression confers FK506 and FTY720 resistance; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000000273])

HSP 1 Score: 50.0618 bits (118), Expect = 9.211e-7
Identity = 46/186 (24.73%), Postives = 86/186 (46.24%), Query Frame = 2
Query:  737 TIIISCFVYGNSQNYFADGGYLPFGVASIFQGAGI----GIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVP----------RLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTI 1252
             III+C   G+ +   A+  + P   A  F+G         ++Y G E L  SA E + P KSIP A    +  ++++Y+LT+  + F+VP              +  +PF+ A     +  +        L++  +   +++Y  PR++ ++AE G+L + L  V+ + + P     V ++F  I
Sbjct:  251 AIIINCGGAGDRRYIGAEYWHNPGPFAHGFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKSIPNACKKVVYRILLIYMLTTILVCFLVPYNSDELLGSSDSSGSHASPFVIAVASHGVKVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGR-PLLCFFVSLVFGCI 435          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Yeast
Match: BAP3 (Amino acid permease; involved in uptake of cysteine, leucine, isoleucine and valine; BAP3 has a paralog, BAP2, that arose from the whole genome duplication [Source:SGD;Acc:S000002453])

HSP 1 Score: 48.521 bits (114), Expect = 2.789e-6
Identity = 36/140 (25.71%), Postives = 69/140 (49.29%), Query Frame = 2
Query:  848 YAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQ---------INENAPFISAFTGKSLHELKWLTGIAT---LLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVV 1231
            +++ G E    S  E   PRKS P A   S+  ++++Y+LT   + F VP                +P++ A    S+H+++ +  I     L++  +   +A+Y  PR++ ++A+ G   +FL+ ++   + P  ALVV
Sbjct:  294 FSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHASPYVLA---ASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGR-PLRALVV 429          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Nematostella
Match: EDO41863 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2Z0])

HSP 1 Score: 189.504 bits (480), Expect = 1.787e-52
Identity = 117/400 (29.25%), Postives = 208/400 (52.00%), Query Frame = 2
Query:  170 RRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTS-----VDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNYFADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            RR       +ET L+RCL+   L   G+  M+GAG+Y+ TG I +   G A  +S L   +    + LCY EF + I K GS YTYTY  MGE+ AFI+GW +I++  I+ + +    S  +N +S   +  F       T +   W  +      D VA  ++     L   GAN S     V   + +  +  +++S   + +++N+   G + P+G   I  GA    +AY GF+ L+ ++EE   P+ SIP A  +S  + I +Y+LT+  L+ M+P  Q++       AF  +     K+   +  + A   S LA ++  PR++YAM+ DGL+ +F +K++ +++VP   ++   L +  +++FV    L E+ S+G +++++ + + +++ R+
Sbjct:   12 RRKTKDIFHVETILHRCLNALDLTLLGVGSMLGAGLYIATGEIARSTAGPAIVISLLIGAIPVCLSSLCYAEFGSRISKTGSSYTYTYFAMGEIWAFIVGWNLILENIIAAALLGHESSRFLNSISGGRIYKF------FTDNISNWQITGLLPFPDFVAFAIVMIFTTLASFGANRSAGFIRVAMLINVFVVVFVVLSGVYFVDTKNW-TKGNFAPYGFYGIMSGAASSYFAYLGFDTLNTASEEAINPKHSIPKACNISTYLGIAMYLLTAGILTLMIPYKQLSPEIALPQAFADEGFPIGKYFVAVGGMSAMALSLLAYLFSGPRILYAMSRDGLMIKFFNKISYATQVPVRGVLFCGLTAASVSLFVNTSNLVEMLSIGTMLAYIAIAISVLLERH 404          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Nematostella
Match: EDO40885 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5Y3])

HSP 1 Score: 183.726 bits (465), Expect = 2.141e-52
Identity = 109/366 (29.78%), Postives = 189/366 (51.64%), Query Frame = 2
Query:  128 MSYVLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEI----WDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNYFADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVP 1213
            M+ V+  F  ++ R++  ++   + T L+RCL+   L   G+   +GAGIYV+ G + +   G    +SF  +   S+ +GLCY EF   +PKAGS Y Y+Y+ MGEL AFIIGW ++++  I  SS+A+ +S   + +  + ++  T + +      EI         D  + LL+  +  +   G   S   N+V   + ++ +  I +  F +    N+  D  +LPFG + +  GA    Y + GF+ ++ + EE + P ++IP ++ VSLGI  V Y   S  L+ M P   +         F  +     ++L     L    AS + A++ +PR++YAMA DGL+F FL +++  +++P
Sbjct:    1 MAAVIRWF-GNLGRKKYLNEEAIVRTDLSRCLTLQDLTALGVGSTLGAGIYVVAGEVARSVAGPGVVISFFIAAFASVLSGLCYAEFGARVPKAGSAYVYSYVTMGELCAFIIGWNLVLEYVIGASSVARAWSSYFDTIIQDRIRTSTIQTI-----GEINFPGLGKYPDFFSFLLVLVITFVLAIGVKNSSRFNSVFTFVNVLVIIFITVLGFYHAKGVNWTRD--FLPFGFSGVVSGAATCFYCFVGFDIIATTGEEAQNPSRAIPISIVVSLGICFVAYFGVSAALTLMWPYNLLPAQGALPKVFALRGAPWAQYLIAAGALCGLTASLIGALFPLPRLLYAMASDGLIFTFLARIHPRTEIP 358          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Nematostella
Match: EDO40886 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5Y4])

HSP 1 Score: 165.236 bits (417), Expect = 1.347e-46
Identity = 87/272 (31.99%), Postives = 160/272 (58.82%), Query Frame = 2
Query:  128 MSYVLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNYFADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLG 943
            M+ +  S L +++R++ F      +T+L+RCLS   L   GI+  +GAGIYVL G + K+  G    LSFL +G+ S+ + LCY EF + +P+AGS Y Y+Y+ +GE  AF++GW MI++  I  SS+A+G +  ++ L N  ++ ++ +++  + ++ +     D +A  +   + +    GA ++   N V+ A+ LI +T I +    + + +N+     +LP+G + +  GA    +++ GF+C++ SAEE K P K +P A+ +++G
Sbjct:    1 MAELTKSALTTMSRKKIFVAKDYTKTELSRCLSKIDLAGLGIASTLGAGIYVLAGIVAKNIAGPGLVLSFLIAGIASLMSALCYAEFGSRVPRAGSAYVYSYVAIGEFCAFVVGWNMILEYLIGASSLARGCTEYLDALFNGQIREYSLKHIG-SMNAPLIAQYPDFLAFAIALIVTIPLALGAAMTTRTNNVITAINLIVITFITLVGLSFADRKNW---NNFLPYGFSGVVAGAATCFFSFVGFDCIATSAEEAKNPTKDVPIAILITIG 268          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Nematostella
Match: EDO40406 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7D5])

HSP 1 Score: 160.999 bits (406), Expect = 1.820e-42
Identity = 110/405 (27.16%), Postives = 211/405 (52.10%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNYFADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            + SF+  + RR+S   +   E+ L RC+    L   G+  M+ AGIYV+ G +     G +  +SFL + + ++  GL Y E S+ I K GS Y +TY+ +GE+  F +GW+M+ +  ++ +S+AK  S  +N LS  AV ++    +     +       DLVAL L+    ++   G   S  +  ++  +    +   I+S  V+ +++ +     + P G+  I        Y  SGF+ +  ++EE  EP +++P A+ + L I    Y+  S+ ++ MVP   I+ ++P   AF+ +      ++  I    A  AS LA+ Y   R++Y+++ DGL+  FL+K+N+S +VP N+++   + + + ++   ++ L E+ ++  I ++  V V +++ R+
Sbjct:    1 MSSFISGLLRRKS-QGTWFQESGLARCMDLFDLTVLGLGGMLDAGIYVVIGQL-AIVAGPSVIVSFLVATVAALLAGLSYAELSSRITKTGSAYVFTYVTLGEVLGFFVGWSMLAEYIVNAASMAKACSLYINSLSGGAVYSYLAENISWGARNNYVGHFPDLVALALVLCSVVIIGLGVRESKTLMDIIMIMNGTVILFSIVSGVVFADTKLWSTPQKFAPKGLDGIILAIPQCFYCLSGFDTIPTASEEALEPSRTVPKAIVLCLVITSCAYLGISSIITLMVPYTAIDYHSPLAEAFSTRGFPPGYYVVSIGATAAIFASLLASYYAASRLLYSLSYDGLICMFLNKINKSRQVPLNSVIAVGVITGLSSLVFNMRELVELVAVATICTYTSVSVCVLVSRF 403          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Nematostella
Match: EDO40551 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S703])

HSP 1 Score: 84.7297 bits (208), Expect = 2.589e-17
Identity = 88/366 (24.04%), Postives = 160/366 (43.72%), Query Frame = 2
Query:  260 MIGAGIYVLTGHIIKDRVGSATNLSFLF---SGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFT-DRYV--PLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGA-------NISLNINAVLAALQLIFLTTIIISCFVYGNSQNYFADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISF 1318
            MIG+GI++    +++ + GS   LS +     GL+++F  LCYCE  T+IPK+G+ Y+Y     G LPAF+  WT+ +                +   S+ A+ + T  RYV  P  P+ EI   SV  +       L L     +         S  +  ++A   L+ L  I I+       ++ F      P  +   F     G++AY G+  L+   EE K P + +P AL + + +V + Y+LT+     +V R  I  +           L  + W+  I    +T       ++   R++Y  A +G + R L  ++   + P  +    ++F   +A+   I ++ + +  G ++++
Sbjct:   52 MIGSGIFISPKGVLQ-QTGS-VGLSLVVWAGCGLLALFGSLCYCEMGTMIPKSGAEYSYLKDAFGPLPAFLYSWTLAL----------------IIRPSSLAIVSLTFARYVTQPFFPNCEISPLSVRKILAACCLALTLFINCASVRWATRIQDSFTLGKLIAIAILVILGIITIAKGQVEYLEDPFEKSTPNPAAIGLAFYS---GLWAYDGWNALNFVTEEMKNPARDLPRALIIGIPLVTICYLLTNIAYIAVVGREGILSSGAVAMTVGDMYLGPMSWIIPIFVACSTFGCVNGLLFSGARLVYVSARNGHMPRLLAMIHNKCQTPMPS----IIFMNTIAL---IMLIPDASEFGTLVNY 389          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Medaka
Match: slc7a3a (cationic amino acid transporter 3 [Source:NCBI gene;Acc:101173804])

HSP 1 Score: 238.81 bits (608), Expect = 1.485e-69
Identity = 144/435 (33.10%), Postives = 230/435 (52.87%), Query Frame = 2
Query:  128 MSYVLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY--------------------------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            M+  L  F   + RRR+   S   ET+  RCLST  LI  G+   +GAG+YVL G + +++ G A  L FL + L S+  GLCY EF   +PK GS Y Y+Y+ +GE+ AFI GW +I+   I  +S+A+ +S   + L    + +F    + +    ++     DL AL+L+  L  L   G + S  +N +   + L+ L  +IIS FV GN+ N+                          F  GG+ PFG   +  GA    YA+ GF+C++ ++EE K P +SIP  +  SL I    Y   S  L+ M+P  ++N  +P   AF+       +++    +L A   S L +++ +PR+IYAMAEDGLLFR L K++E +K P  A +V  + + ++A    +  L ++ S+G ++++ +V + ++ILRY
Sbjct:    1 MASKLSKFGKMLLRRRALDCSGE-ETRFARCLSTLDLIALGVGSTLGAGVYVLAGEVAREKAGPAIVLCFLIAALSSMLAGLCYAEFGARVPKTGSAYLYSYVTVGEIWAFITGWNLILSYVIGTASVARAWSSTFDNLVEQKISSFFKGIMEMKVPGKVLAEYPDLFALILVLLLSGLLAFGVSESALVNKIFTGINLVVLGFVIISGFVKGNTANWNLKEEDYITFINATNSTHKPLNVEKDFGVGGFAPFGFTGVLSGAATCFYAFVGFDCIATTSEEAKNPMRSIPIGIVASLLICFFAYFGVSAALTMMMPYYELNTQSPLPVAFSYVGWGPARYIVAFGSLCALSTSLLGSMFPMPRVIYAMAEDGLLFRALSKMSERTKTPVLATIVSGIVAALMAFLFDLGALVDLMSIGTLLAYSLVAICVLILRY 434          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Medaka
Match: slc7a2 (solute carrier family 7 member 2 [Source:NCBI gene;Acc:101165487])

HSP 1 Score: 236.113 bits (601), Expect = 4.795e-69
Identity = 136/419 (32.46%), Postives = 227/419 (54.18%), Query Frame = 2
Query:  146 SFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY-----------------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILR 1351
            SF  S+ RR+    +   ++KL RCL T  LI  G+   +GAG+YVL G + K   G +  +SFL + L S+  GLCY EF   +PK GS Y Y+Y+ +GE+ AFI GW +I+   I  SS+A+ +SG  + +    ++ F   Y  +  +S       D  A+ L+  L  L   G   S  +N V  ++ ++ L  +IIS FV G++ N+                 +  GG+LP+G +    GA    YA+ GF+C++ + EE + P+++IP  + VSL +  + Y   S  L+ M+P   ++E +P   AF        K++  + +L A   S L +I+ +PR+IYAMAEDG++F+ L ++N  +K P  A +   + + I+A    ++ L ++ S+G ++++ +V V ++ILR
Sbjct:    7 SFSRSLVRRKVVDMNNLEDSKLCRCLGTVDLIALGVGSTLGAGVYVLAGEVAKGNSGPSIVISFLIAALASVMAGLCYAEFGARVPKTGSAYLYSYVTVGEIWAFITGWNLILSYVIGTSSVARAWSGTFDEMIGGHIEKFCKTYFSM--NSPGLAPYPDFFAVCLILLLSGLLSFGVKESAWVNKVFTSVNVLVLLFVIISGFVKGDAVNWKISEESLINFTVVTRSDYGVGGFLPYGFSGTLAGAATCFYAFVGFDCIATTGEEVRNPQRAIPIGIVVSLTVCFLAYFGVSAALTLMMPYYLLDEKSPLPMAFEYVGWGPAKYVVAVGSLCALSTSLLGSIFPMPRVIYAMAEDGVVFKALARINPKTKTPVIATMSSGVVAAIMAFLFDLKALVDMMSIGTLLAYSLVAVCVLILR 423          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Medaka
Match: slc7a2 (solute carrier family 7 member 2 [Source:NCBI gene;Acc:101165487])

HSP 1 Score: 233.417 bits (594), Expect = 1.967e-67
Identity = 137/429 (31.93%), Postives = 228/429 (53.15%), Query Frame = 2
Query:  146 SFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY--------------------------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            SF  S+ RR+    +   ++KL RCL T  LI  G+   +GAG+YVL G + K   G +  +SFL + L S+  GLCY EF   +PK GS Y Y+Y+ +GE+ AFI GW +I+   I  SS+A+ +SG  + +    ++ F   Y  +  +S       D  A+ L+  L  L   G   S  +N V  ++ ++ L  +IIS FV G++ N+                          +  GG+LP+G +    GA    YA+ GF+C++ + EE + P+++IP  + VSL +  + Y   S  L+ M+P   ++E +P   AF        K++  + +L A   S L +I+ +PR+IYAMAEDG++F+ L ++N  +K P  A +   + + I+A    ++ L ++ S+G ++++ +V V ++ILRY
Sbjct:    7 SFSRSLVRRKVVDMNNLEDSKLCRCLGTVDLIALGVGSTLGAGVYVLAGEVAKGNSGPSIVISFLIAALASVMAGLCYAEFGARVPKTGSAYLYSYVTVGEIWAFITGWNLILSYVIGTSSVARAWSGTFDEMIGGHIEKFCKTYFSM--NSPGLAPYPDFFAVCLILLLSGLLSFGVKESAWVNKVFTSVNVLVLLFVIISGFVKGDAVNWKISEESLINFTVVTRNLSVAANVSSDYGVGGFLPYGFSGTLAGAATCFYAFVGFDCIATTGEEVRNPQRAIPIGIVVSLTVCFLAYFGVSAALTLMMPYYLLDEKSPLPMAFEYVGWGPAKYVVAVGSLCALSTSLLGSIFPMPRVIYAMAEDGVVFKALARINPKTKTPVIATMSSGVVAAIMAFLFDLKALVDMMSIGTLLAYSLVAVCVLILRY 433          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Medaka
Match: ENSORLT00000008841.2 (cationic amino acid transporter 2 [Source:NCBI gene;Acc:101168301])

HSP 1 Score: 230.72 bits (587), Expect = 7.841e-67
Identity = 139/435 (31.95%), Postives = 227/435 (52.18%), Query Frame = 2
Query:  128 MSYVLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLT-PDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY-----------------------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRYLH 1360
            MS+V  SFL S++RR+   +    ++  NRCL+T  L+  G+   +GAG+YVL+G + +D  G +  +SF  + L SIF GLCY EF + +PK GS Y Y+Y+ +GEL AFI GW +++   I  SS+A  +SG  + L    +  + +    +  P    +    D  A  L+  L  +   G   S  IN +  A+ ++ L  + IS F+ GN  N+                       F  GG+ P+G      GA    YA+ GF+C++ + EE K P+KS+P  +  SL I  + Y   S  L+ M+P   +NE +P   AF        K++  + +L A   S L +++ +PR+++AMA DGLLF+ L KV      P  A +   + + I+A+   ++ L E+ S+G + ++ +V + ++ILRY++
Sbjct:    1 MSWV-KSFLVSLSRRKPI-EPDGEQSTFNRCLTTLDLVALGVGSTLGAGVYVLSGEVARDTAGPSIIISFFIAALASIFAGLCYAEFGSRVPKTGSAYLYSYVTVGELLAFITGWNLLLSYVIGTSSVALAWSGTFDDLIGGVISKYFEENASMGLPGLAPYP---DFFAAALILLLSGVLAFGVKESTTINKIFTAINILVLLFVTISGFIKGNIDNWYISEEALLNATAEENSTINVTSVFGVGGFFPYGFNGTLAGAATCFYAFVGFDCIATTGEEVKNPQKSVPVGIVASLLICFLAYFAVSAALTLMMPYYMLNEKSPLPVAFEYVGWGPAKYVVAVGSLCALSTSLLGSMFPMPRVLFAMARDGLLFQPLTKVTAKGS-PAIATIASGVVAAIMALLFDLEALVEMMSIGTLFAYTLVAICILILRYVY 429          
BLAST of Cationic amino acid transporter 4 vs. Ensembl Medaka
Match: ENSORLT00000045655.1 (cationic amino acid transporter 2 [Source:NCBI gene;Acc:101168301])

HSP 1 Score: 228.024 bits (580), Expect = 6.752e-66
Identity = 139/436 (31.88%), Postives = 225/436 (51.61%), Query Frame = 2
Query:  128 MSYVLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLT-PDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY--------------------------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            MS+V  SFL S++RR+   +    ++  NRCL+T  L+  G+   +GAG+YVL+G + +D  G +  +SF  + L SIF GLCY EF + +PK GS Y Y+Y+ +GEL AFI GW +++   I  SS+A  +SG  + L    +  + +    +  P    +    D  A  L+  L  +   G   S  IN +  A+ ++ L  + IS F+ GN  N+                          F  GG+ P+G      GA    YA+ GF+C++ + EE K P+KS+P  +  SL I  + Y   S  L+ M+P   +NE +P   AF        K++  + +L A   S L +++ +PR+++AMA DGLLF+ L KV      P  A +   + + I+A+   ++ L E+ S+G + ++ +V + ++ILRY
Sbjct:    1 MSWV-KSFLVSLSRRKPI-EPDGEQSTFNRCLTTLDLVALGVGSTLGAGVYVLSGEVARDTAGPSIIISFFIAALASIFAGLCYAEFGSRVPKTGSAYLYSYVTVGELLAFITGWNLLLSYVIGTSSVALAWSGTFDDLIGGVISKYFEENASMGLPGLAPYP---DFFAAALILLLSGVLAFGVKESTTINKIFTAINILVLLFVTISGFIKGNIDNWYISEEALLNATAEEKNLSSTINVTSVFGVGGFFPYGFNGTLAGAATCFYAFVGFDCIATTGEEVKNPQKSVPVGIVASLLICFLAYFAVSAALTLMMPYYMLNEKSPLPVAFEYVGWGPAKYVVAVGSLCALSTSLLGSMFPMPRVLFAMARDGLLFQPLTKVTAKGS-PAIATIASGVVAAIMALLFDLEALVEMMSIGTLFAYTLVAICILILRY 430          
BLAST of Cationic amino acid transporter 4 vs. Planmine SMEST
Match: SMESG000081298.1 (SMESG000081298.1)

HSP 1 Score: 892.493 bits (2305), Expect = 0.000e+0
Identity = 548/565 (96.99%), Postives = 559/565 (98.94%), Query Frame = 2
Query:  164 TRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNYFADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRYLHXXXXXXXXXXXXXXXXMRFTIFSGLANRTCFKGIFICLLFSIIFMGLSILLLYPIHYISGIICSVFCXXXXXXXXXXXXXXXXXXXKDAFAXXXXXXXXXXXXXXXXXXXXXXXXETWIRFLVWILFGLLIYFFYGIPNSHLSEKAEEKTXXXXXXXXXXXXXKQE 1858
            TR+R  S++KSL+TKL+RCLST QLIFYGISHMIGAGIYVLTGHIIK++VG ATNLSF+ SG +SIFTGLCYCEF+TLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDLSISLSSIAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVALLLLFTLFLLTLTGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNYFADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVG+DLIILRYLHNEELENIESNESKNLEMRFTIFSGLANRTCFKGIFICLLFSIIFMGLSILLLYPIHYISGIICSVFCLITLLTMSLLLSLYKPLLTKDAFATPLMPLTPIITITLNICLLINLPLETWIRFLVWILFGLLIYFFYGIPNSHLSEKAEEKTELILLDNNNDEILKQE
Sbjct:   13 TRKRVLSKNKSLDTKLHRCLSTYQLIFYGISHMIGAGIYVLTGHIIKEKVGPATNLSFVLSGFVSIFTGLCYCEFATLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDLSISLSSIAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVALLLLFTLFLLTLTGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNYFADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGIDLIILRYLHNEELENIESNESKNLEMRFTIFSGLANRTCFKGIFICLLFSIIFMGLSILLLYPIHYISGIICSVFCLITLLTMSLLLSLYKPLLTKDAFATPLMPLTPIITITLNICLLINLPLETWIRFLVWILFGLLIYFFYGIPNSHLSEKAEEKTELILLDNNNDEILKQE 577          
BLAST of Cationic amino acid transporter 4 vs. Planmine SMEST
Match: SMESG000081300.1 (SMESG000081300.1)

HSP 1 Score: 692.96 bits (1787), Expect = 0.000e+0
Identity = 394/557 (70.74%), Postives = 472/557 (84.74%), Query Frame = 2
Query:   83 MHTVQVGQERSFIFFMSYVLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNYFADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRYLHXXXXXXXXXXXXXXXXMRFTIFSGLANRTCFKGIFICLLFSIIFMGLSILLLYPIHYISGIICSVFCXXXXXXXXXXXXXXXXXXXKDAFAXXXXXXXXXXXXXXXXXXXXXXXXETWIRFLVWILFGLLI 1753
            MHTVQVGQERSFIFFMS VLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFI+GWTMI+D  +SL+S++KGFSGAVN+L N+AVKNFTD+Y+PL+  S++W++S D++A  LLFTLFL+TLTGANIS+NIN VL+ +QLIFL+ III CF YG+ QN+ +DGGYLPFG  SIFQGAGI I+AYSGFECL+NSAEETK PRKSIP ALFVSLGI+I+LYVL S+GLSFMVPRLQI++ APFI+AF+ ++L  LKW+TGIATLLATGA+KLA  YVIPRMIY MAEDGL+F+FL K++E SK+P  A++VG+ FS++LA+F++IQ+LA+ITSMGII+SF+ +G+DLIILRY+  +E      + S+ L MR    S +  R  FK     L+ SII  G+SIL + PI  I+GII S   ++ +LT ++++SLY+P   KD F TPLMPLTPIITI LNICLL+NLP  TW+RFLV  + G +I
Sbjct:    1 MHTVQVGQERSFIFFMSSVLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVLAFALLFTLFLITLTGANISMNINLVLSTIQLIFLSVIIIYCFFYGSHQNFVSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWITGIATLLATGATKLAVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIF-DENNENTIDNSEKLPMRINTNSMICTRKFFKISLFSLIISIILTGVSILFILPISQITGIIFSAIFILLILTFTIIISLYEPTDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGKII 556          
BLAST of Cationic amino acid transporter 4 vs. Planmine SMEST
Match: SMESG000081293.1 (SMESG000081293.1)

HSP 1 Score: 563.148 bits (1450), Expect = 0.000e+0
Identity = 312/546 (57.14%), Postives = 418/546 (76.56%), Query Frame = 2
Query:  167 RRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNYFADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRYLHXXXXXXXXXXXXXXXXMRFTIFSGLANRTCFKGIFICLLFSIIFMGLSILLLYPIHYISGIICSVFCXXXXXXXXXXXXXXXXXXXKDAFAXXXXXXXXXXXXXXXXXXXXXXXXETWIRFLVWILFGLLIYFFYGIPNSHLSEKAEE 1804
            R++SFSQ ++L+T L+RCLST QL FYGIS MIG GIY+LTG IIKD+VG  TNLSFL SG ISIFTGLCYCEFSTLIPKAGS YTYTYLMMGELPAFIIGWT++M+  I+L+ +AKGFS A+N + N  + N+T +++PL+ DS IWD+S+D+VA+LL+  LF  +LTG +IS+N+N VLA  Q++FL TIII+CFVYG++QNY  DGGYLPFG  S+F+GAG+ I+ Y+GFE L+N AEETK+P+KSIPTA+  SL ++++LY L STGL ++VPR QI+ ++PFI+AF  K+L  +KW+T I T+LA  A+K   IY+IPR IYAMA DGLLFRFL  +N+ SK+P +AL+ G+LFS  L MF++I+ILA++T++GIIISF+ VG++L+ILRYLH  + E      +  +EMR    + LAN+  FK +  C + S I  G S L +YP   I GI+   F L+ +L M ++LSLY+P   K+ F TPLMPL P+ITI LNI ++++ P+ TWIR+L+ + FGL++Y F+G  NS L+EK EE
Sbjct:   14 RKQSFSQLQTLDTNLDRCLSTYQLTFYGISRMIGVGIYILTGIIIKDKVGPGTNLSFLLSGFISIFTGLCYCEFSTLIPKAGSSYTYTYLMMGELPAFIIGWTVLMNYIIALAGVAKGFSAAINSIVNGTIGNWTLKHLPLSKDSTIWDSSIDIVAVLLILLLFSFSLTGISISMNVNCVLAISQILFLMTIIIACFVYGSNQNYLDDGGYLPFGFLSVFKGAGLVIFTYAGFESLANIAEETKDPKKSIPTAMLTSLSLIVILYFLISTGLPYLVPRHQIDASSPFITAFMEKNLVLMKWVTIIGTILAIAATKFTVIYIIPRAIYAMANDGLLFRFLANINKKSKIPISALITGILFSCTLTMFIKIEILADVTTIGIIISFITVGINLLILRYLHETDTEKSLMESNVPMEMRVNSCAFLANQNIFKAVLSCFIISNILFGFSFLYIYPTFQIFGIVVCTFSLMVILLMMIILSLYEPHCFKEGFTTPLMPLAPVITIILNISIIVHFPIGTWIRYLICLSFGLILYIFHGFSNSELAEKVEE 559          
BLAST of Cationic amino acid transporter 4 vs. Planmine SMEST
Match: SMESG000033534.1 (SMESG000033534.1)

HSP 1 Score: 212.616 bits (540), Expect = 3.896e-60
Identity = 123/406 (30.30%), Postives = 216/406 (53.20%), Query Frame = 2
Query:  146 SFLHSITRRRSFSQ--SKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKA-GSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNYFADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGVDLIILRY 1354
            S  +++ RR+  +    +S  + L +CL+T  L   GI  ++GAGIYV+ G +  +  G +  LS   + + S+ +GLCY EF + +P+  GS Y+Y+Y  +GE  AFIIGW +I++  I  ++ A+  S A++ L ++ + NFT+  +   P   + +   DL+  +L  ++ ++   G   S         L       II++        N+ +   + P GV  +  GA    YAY GF+ ++ + EE + P KSIP A+ ++L +    Y   +T L+ MVP   +  ++P   AF  + LH  KW+ G+  +    AS + + + +PR+IYAMA DGLLF+FL +V   ++VP  A ++    +    M   +  L E+ S+G ++++ +V   +++LRY
Sbjct:   13 SLRYTLFRRKHITNLNRESSTSDLAKCLTTFDLTNLGIGSILGAGIYVVVGQVSTNIAGPSVTLSLFIAAVTSLLSGLCYAEFGSRVPRTTGSAYSYSYHTVGEFIAFIIGWNLILEYMIGTAADARALSSAIDYLLDHKLSNFTETQIGRVP---LTNALPDLLGFILTISVTMILAAGVKESARYTTFFNFLTAAVAIFIIVAGAAESKLSNWNSKKKFFPKGVHGVLSGAATCFYAYVGFDVIATTGEEARSPSKSIPKAMSLTLLVCFTFYFGVATVLTMMVPFGNLKTSSPITEAFDLRGLHWAKWIVGLGGVAGMSASLMGSEFPLPRIIYAMASDGLLFKFLSQVWNRTEVPIFATLIPGFLTAFFTMLFDLGELVEMMSIGTLLAYSLVCTSVLLLRY 415          
BLAST of Cationic amino acid transporter 4 vs. Planmine SMEST
Match: SMESG000031905.1 (SMESG000031905.1)

HSP 1 Score: 180.259 bits (456), Expect = 9.486e-49
Identity = 113/363 (31.13%), Postives = 182/363 (50.14%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDXXXXXXXXAKGFSGAVNLLSNNAVKNFTDRYVP-----LTPDSEIWDTSVDLVAXXXXXXXXXXXXXGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNY-----------------FADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAED 1162
            +  F     R++++      ++ L RCL+T  L   GI   +GAG+YV+ G + K+  G +  +SFL + + SIF GLCY EF   +P+ GS Y Y+Y+ +GEL AFIIGW +I++  I  +S+A+ +S   + ++   +K+F +  +P     L P         DL A L+   L  +   G   S   N +   L +  +  +II  F   + +N+                    G + PFG++ +  GAG   YA+ GF+ ++ + EE   P+K+IP A+   L +  V Y   ST ++ M P   INE+AP    F     +  K++ GI  L     S L A++ +PR+IYAM+ D
Sbjct:    3 IKRFFMGFFRKKTYIGVDLNKSLLARCLTTLDLTALGIGATLGAGVYVVAGKVAKESAGPSVVVSFLVAAIASIFAGLCYAEFGARVPRTGSAYIYSYVSVGELMAFIIGWNLILEYVIGTASVARAWSSNFDEITGGHIKDFFNSTMPMNLIGLAPYP-------DLFAFLITVVLTSILCIGVKESSRFNNIFTVLNVSVILYVIICGFWNVDIKNWKIPPKTMSNGTIIYNPHIGSGYFFPFGISGMLSGAGTCFYAFVGFDSIATTGEEVINPQKAIPFAIIFCLSLCFVAYASISTIITLMCPFYIINEDAPLPFIFDKAGWYVSKYIVGIGALFGLSTSLLGALFPLPRIIYAMSSD 358          
The following BLAST results are available for this feature:
BLAST of Cationic amino acid transporter 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC7A14.519e-6832.09solute carrier family 7 member 1 [Source:HGNC Symb... [more]
SLC7A32.419e-6732.55solute carrier family 7 member 3 [Source:HGNC Symb... [more]
SLC7A32.419e-6732.55solute carrier family 7 member 3 [Source:HGNC Symb... [more]
SLC7A21.612e-6432.33solute carrier family 7 member 2 [Source:HGNC Symb... [more]
SLC7A21.612e-6432.33solute carrier family 7 member 2 [Source:HGNC Symb... [more]
back to top
BLAST of Cationic amino acid transporter 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B0454.61.050e-7333.25pep chromosome:WBcel235:II:3032780:3036122:1 gene:... [more]
C50D2.21.385e-7335.45pep chromosome:WBcel235:II:109165:111429:1 gene:WB... [more]
F23F1.61.227e-6733.58pep chromosome:WBcel235:II:35202:37313:-1 gene:WBG... [more]
Y53F4B.126.571e-1522.98pep chromosome:WBcel235:II:15019223:15025768:1 gen... [more]
Y53F4B.121.062e-1225.61pep chromosome:WBcel235:II:15019223:15025768:1 gen... [more]
back to top
BLAST of Cationic amino acid transporter 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG132482.604e-7535.85gene:FBgn0036984 transcript:FBtr0078234[more]
CG55353.723e-7133.01gene:FBgn0036764 transcript:FBtr0075159[more]
CG55354.532e-7133.01gene:FBgn0036764 transcript:FBtr0273277[more]
slif6.989e-7031.33gene:FBgn0037203 transcript:FBtr0078555[more]
slif6.989e-7031.33gene:FBgn0037203 transcript:FBtr0078556[more]
back to top
BLAST of Cationic amino acid transporter 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc7a3a5.081e-7334.19solute carrier family 7 member 3a [Source:ZFIN;Acc... [more]
slc7a3b1.326e-7233.02solute carrier family 7 member 3b [Source:ZFIN;Acc... [more]
slc7a3b3.343e-7233.02solute carrier family 7 member 3b [Source:ZFIN;Acc... [more]
slc7a42.432e-6832.51solute carrier family 7 member 4 [Source:ZFIN;Acc:... [more]
slc7a42.432e-6832.51solute carrier family 7 member 4 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Cationic amino acid transporter 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hipk11.873e-6832.26homeodomain interacting protein kinase 1 [Source:X... [more]
SLC7A21.445e-6732.71solute carrier family 7 (cationic amino acid trans... [more]
SLC7A15.930e-6732.92solute carrier family 7 (cationic amino acid trans... [more]
SLC7A17.989e-6731.99solute carrier family 7 (cationic amino acid trans... [more]
SLC7A24.191e-6632.17solute carrier family 7 (cationic amino acid trans... [more]
back to top
BLAST of Cationic amino acid transporter 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc7a13.316e-7332.61solute carrier family 7 (cationic amino acid trans... [more]
Slc7a12.595e-7232.61solute carrier family 7 (cationic amino acid trans... [more]
AU0180912.608e-6631.15expressed sequence AU018091 [Source:MGI Symbol;Acc... [more]
AU0180912.608e-6631.15expressed sequence AU018091 [Source:MGI Symbol;Acc... [more]
Slc7a34.018e-6532.24solute carrier family 7 (cationic amino acid trans... [more]
back to top
BLAST of Cationic amino acid transporter 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P30823|SL7A1_RAT4.645e-7232.31High affinity cationic amino acid transporter 1 OS... [more]
sp|Q09143|SL7A1_MOUSE1.815e-7132.61High affinity cationic amino acid transporter 1 OS... [more]
sp|P30825|SL7A1_HUMAN2.170e-6732.09High affinity cationic amino acid transporter 1 OS... [more]
sp|Q8WY07|CTR3_HUMAN1.162e-6632.55Cationic amino acid transporter 3 OS=Homo sapiens ... [more]
sp|O08812|CTR3_RAT1.374e-6533.18Cationic amino acid transporter 3 OS=Rattus norveg... [more]
back to top
BLAST of Cationic amino acid transporter 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF620.000e+073.14Slc7a-3 OS=Schmidtea mediterranea OX=79327 GN=slc7... [more]
A0A0H3YJ040.000e+057.33Slc7a-5 OS=Schmidtea mediterranea OX=79327 GN=slc7... [more]
A0A4E0RW661.483e-13443.32High affinity cationic amino acid transporter 1 OS... [more]
A0A2H1CIM41.198e-13150.37Amino acid permease OS=Fasciola hepatica OX=6192 G... [more]
A0A504YNC31.619e-12950.12High affinity cationic amino acid transporter 1 OS... [more]
back to top
BLAST of Cationic amino acid transporter 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc7a3b5.043e-7133.25cationic amino acid transporter 3-like [Source:NCB... [more]
ENSAMXT00000005386.23.418e-7032.58cationic amino acid transporter 4-like [Source:NCB... [more]
slc7a3a5.348e-7033.73cationic amino acid transporter 3 [Source:NCBI gen... [more]
ENSAMXT00000010113.24.522e-6932.05pep primary_assembly:Astyanax_mexicanus-2.0:1:1194... [more]
slc7a21.743e-6833.10solute carrier family 7 member 2 [Source:NCBI gene... [more]
back to top
BLAST of Cationic amino acid transporter 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000766.13.623e-6130.60pep scaffold:Pmarinus_7.0:GL478727:35765:49900:1 g... [more]
slc7a41.724e-5833.16solute carrier family 7 member 4 [Source:ZFIN;Acc:... [more]
ENSPMAT00000000741.13.638e-3028.86pep scaffold:Pmarinus_7.0:GL501074:1046:17370:1 ge... [more]
ENSPMAT00000001199.12.139e-2541.88pep scaffold:Pmarinus_7.0:GL479551:1043:11089:-1 g... [more]
ENSPMAT00000002665.19.085e-1724.54pep scaffold:Pmarinus_7.0:GL476806:119517:143089:1... [more]
back to top
BLAST of Cationic amino acid transporter 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
BAP22.498e-827.89High-affinity leucine permease; functions as a bra... [more]
HIP12.877e-827.74High-affinity histidine permease; also involved in... [more]
DIP53.965e-726.97Dicarboxylic amino acid permease; mediates high-af... [more]
TAT19.211e-724.73Amino acid transporter for valine, leucine, isoleu... [more]
BAP32.789e-625.71Amino acid permease; involved in uptake of cystein... [more]
back to top
BLAST of Cationic amino acid transporter 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO418631.787e-5229.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408852.141e-5229.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408861.347e-4631.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404061.820e-4227.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405512.589e-1724.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cationic amino acid transporter 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc7a3a1.485e-6933.10cationic amino acid transporter 3 [Source:NCBI gen... [more]
slc7a24.795e-6932.46solute carrier family 7 member 2 [Source:NCBI gene... [more]
slc7a21.967e-6731.93solute carrier family 7 member 2 [Source:NCBI gene... [more]
ENSORLT00000008841.27.841e-6731.95cationic amino acid transporter 2 [Source:NCBI gen... [more]
ENSORLT00000045655.16.752e-6631.88cationic amino acid transporter 2 [Source:NCBI gen... [more]
back to top
BLAST of Cationic amino acid transporter 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081298.10.000e+096.99SMESG000081298.1[more]
SMESG000081300.10.000e+070.74SMESG000081300.1[more]
SMESG000081293.10.000e+057.14SMESG000081293.1[more]
SMESG000033534.13.896e-6030.30SMESG000033534.1[more]
SMESG000031905.19.486e-4931.13SMESG000031905.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014053 ID=SMED30014053|Name=Cationic amino acid transporter 4|organism=Schmidtea mediterranea sexual|type=transcript|length=1940bp
AAATCGATATTAACAAGCCAACTCAACTGCAACACACGCACATTCATCAA
ATTTGCGTGGCCAGAATGAGTGCGTGTGTGTAATGCACACAGTACAAGTT
GGACAAGAAAGATCATTCATTTTTTTCATGTCTTATGTATTGCATTCATT
TCTTCATTCGATAACAAGGAGACGATCGTTTTCTCAAAGCAAATCTCTCG
AAACAAAGCTTAATCGATGCCTTTCCACTTCTCAACTGATTTTCTATGGA
ATATCACATATGATTGGGGCTGGAATATACGTATTAACTGGTCATATTAT
CAAAGACAGAGTTGGATCGGCAACAAATTTGTCGTTTTTATTTAGCGGTC
TCATTTCAATTTTTACCGGATTATGTTACTGTGAATTTTCAACTCTTATT
CCAAAAGCCGGTTCATGTTACACCTACACTTATTTGATGATGGGAGAGTT
GCCAGCATTTATCATTGGCTGGACAATGATTATGGACTTATCTATTTCAT
TATCAAGTATTGCGAAGGGATTTAGTGGAGCAGTAAATCTATTGAGCAAT
AATGCTGTGAAAAACTTTACGGATAGATATGTTCCTCTAACTCCTGACAG
TGAGATATGGGATACGTCTGTAGATTTAGTAGCCCTACTTTTACTATTTA
CTTTATTTTTACTCACACTGACGGGTGCAAATATTTCATTGAATATCAAT
GCAGTGTTAGCTGCTCTTCAATTAATATTTTTGACAACGATAATCATTTC
ATGCTTTGTCTATGGAAATAGTCAAAATTATTTTGCCGATGGTGGCTATC
TACCGTTTGGAGTTGCTTCTATTTTTCAAGGAGCTGGAATAGGGATATAT
GCATATTCAGGGTTTGAATGTCTATCAAATTCTGCTGAAGAAACAAAGGA
ACCTAGAAAAAGCATACCTACAGCTCTCTTTGTGTCGTTAGGTATTGTTA
TTGTGTTATATGTTTTAACTTCAACTGGTTTGTCTTTTATGGTTCCCCGA
TTGCAAATAAATGAAAATGCTCCTTTTATTTCTGCTTTTACTGGAAAAAG
TTTACATGAACTAAAATGGTTAACTGGTATTGCTACTCTTTTAGCAACAG
GTGCGTCAAAGTTAGCAGCAATTTATGTTATTCCAAGAATGATTTATGCC
ATGGCAGAAGATGGTCTTTTGTTTAGATTTCTTGACAAAGTTAATGAAAG
TTCCAAAGTTCCAACTAATGCACTTGTAGTTGGAGTATTATTTTCTACAA
TATTAGCAATGTTTGTTAGAATACAAATTCTAGCTGAAATAACATCAATG
GGCATTATCATTTCTTTCATGATTGTTGGAGTAGATTTGATTATTTTACG
ATACCTTCATAACGAAGAATTAGAAAATATAGAGTCTAATGAATCTAAAA
ATTTGGAAATGAGATTTACAATATTTTCAGGTCTTGCAAATCGTACTTGT
TTTAAGGGAATTTTTATATGCCTTTTATTTTCAATTATTTTCATGGGACT
ATCTATTCTTTTACTATATCCAATTCATTATATATCAGGGATTATCTGTA
GTGTGTTCTGTTTGATTACATTATTGACAATGAGCCTGTTGCTTTCACTT
TACAAACCATTATTAACGAAAGATGCTTTTGCAACCCCATTGATGCCTTT
AACACCAATTATAACAATCACTTTAAACATTTGTCTTTTAATCAATCTTC
CACTCGAAACTTGGATTAGATTTTTAGTTTGGATTTTGTTTGGATTGCTT
ATTTACTTTTTCTATGGAATTCCAAACAGCCATTTATCGGAAAAGGCGGA
AGAGAAAACTGAGTTGATTTTGCTGGATAATAATAATGATGAAATATTAA
AACAAGAGTGATATACATTTTATTTTTTCGAATAAACATTATGGTGATTA
GCTGATTTATTTTGAATAAAGGATTTTATTTTAAAAAAAA
back to top

protein sequence of SMED30014053-orf-1

>SMED30014053-orf-1 ID=SMED30014053-orf-1|Name=SMED30014053-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=593bp
MHTVQVGQERSFIFFMSYVLHSFLHSITRRRSFSQSKSLETKLNRCLSTS
QLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYC
EFSTLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDLSISLSSIAKGFSGA
VNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVALLLLFTLFLLTLTGAN
ISLNINAVLAALQLIFLTTIIISCFVYGNSQNYFADGGYLPFGVASIFQG
AGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGL
SFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVI
PRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQIL
AEITSMGIIISFMIVGVDLIILRYLHNEELENIESNESKNLEMRFTIFSG
LANRTCFKGIFICLLFSIIFMGLSILLLYPIHYISGIICSVFCLITLLTM
SLLLSLYKPLLTKDAFATPLMPLTPIITITLNICLLINLPLETWIRFLVW
ILFGLLIYFFYGIPNSHLSEKAEEKTELILLDNNNDEILKQE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0015171amino acid transmembrane transporter activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0003333amino acid transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR002293AA/rel_permease1
IPR029485CAT_C
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002293Amino acid/polyamine transporter IPFAMPF13520AA_permease_2coord: 38..335
e-value: 1.9E-32
score: 112.6
IPR002293Amino acid/polyamine transporter IPIRSFPIRSF006060AA_transportercoord: 3..299
e-value: 3.6E-45
score: 151.6
coord: 324..448
e-value: 180.0
score: -2.5
IPR029485Cationic amino acid transporter, C-terminalPFAMPF13906AA_permease_Ccoord: 385..435
e-value: 1.1E-16
score: 60.7
NoneNo IPR availableGENE3DG3DSA:1.20.1740.10coord: 1..305
e-value: 1.1E-54
score: 187.9
NoneNo IPR availablePANTHERPTHR43243FAMILY NOT NAMEDcoord: 1..436
NoneNo IPR availableTMHMMTMhelixcoord: 49..71
NoneNo IPR availableTMHMMTMhelixcoord: 198..220
NoneNo IPR availableTMHMMTMhelixcoord: 413..432
NoneNo IPR availableTMHMMTMhelixcoord: 76..98
NoneNo IPR availableTMHMMTMhelixcoord: 151..173
NoneNo IPR availableTMHMMTMhelixcoord: 268..290
NoneNo IPR availableTMHMMTMhelixcoord: 108..130
NoneNo IPR availableTMHMMTMhelixcoord: 384..406
NoneNo IPR availableTMHMMTMhelixcoord: 352..374
NoneNo IPR availableTMHMMTMhelixcoord: 328..350