Endothelin-converting enzyme 1

Overview
NameEndothelin-converting enzyme 1
Smed IDSMED30014052
Length (bp)1559
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Endothelin-converting enzyme 1 (SMED30014052) t-SNE clustered cells

Violin plots show distribution of expression levels for Endothelin-converting enzyme 1 (SMED30014052) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Endothelin-converting enzyme 1 (SMED30014052) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Endothelin-converting enzyme 1 (SMED30014052) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014052

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30014052SMESG000003235.1 SMESG000003226.1 SMESG000003222.1 dd_Smed_v4_1910_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014052SMESG000003235.1 SMESG000003226.1 SMESG000003222.1 dd_Smed_v4_1910_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30014052SMESG000003235.1 SMESG000003226.1 SMESG000003222.1 dd_Smed_v6_1910_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30014052SMESG000003235.1 SMESG000003226.1 SMESG000003222.1 OX_Smed_1.0.23034ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Human
Match: MME (membrane metalloendopeptidase [Source:HGNC Symbol;Acc:HGNC:7154])

HSP 1 Score: 256.914 bits (655), Expect = 2.208e-76
Identity = 130/344 (37.79%), Postives = 197/344 (57.27%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLIS-ETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASY---VINNKPLPSLQTVGEDIADNAGIRMSYFAANS--KLEVREKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            W++C    +  ++  VG ++V++ F    K  +E +I  I+  F   +++ TWMD+ T   A EK  AI+ +IGYPD ++S +  L  +Y  +         N +   +F++ + LK + EK+  DEW  G+  VNA+Y+   N+IVFPA IL+ PF+      + NYGGIGMVIGHEI HGFD  G  F+  G L +WWT+ S   +  ++QC++ QY ++   +   + L  + T+GE+IADN G+  +Y A  +  K    EKL LPG+DL+ +QLFF+   + WC      +    +K DVHS   +RI G + N  EFS+ F+C +N  MN  KKC VW
Sbjct:  408 WRRCANYVNGNMENAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKRAEEKALAIKERIGYPDDIVSNDNKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKDGDLVDWWTQQSASNFKEQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIADNGGLGQAYRAYQNYIKKNGEEKL-LPGLDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRIIGTLQNSAEFSEAFHCRKNSYMNPEKKCRVW 750          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Human
Match: MME (membrane metalloendopeptidase [Source:HGNC Symbol;Acc:HGNC:7154])

HSP 1 Score: 256.914 bits (655), Expect = 2.208e-76
Identity = 130/344 (37.79%), Postives = 197/344 (57.27%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLIS-ETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASY---VINNKPLPSLQTVGEDIADNAGIRMSYFAANS--KLEVREKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            W++C    +  ++  VG ++V++ F    K  +E +I  I+  F   +++ TWMD+ T   A EK  AI+ +IGYPD ++S +  L  +Y  +         N +   +F++ + LK + EK+  DEW  G+  VNA+Y+   N+IVFPA IL+ PF+      + NYGGIGMVIGHEI HGFD  G  F+  G L +WWT+ S   +  ++QC++ QY ++   +   + L  + T+GE+IADN G+  +Y A  +  K    EKL LPG+DL+ +QLFF+   + WC      +    +K DVHS   +RI G + N  EFS+ F+C +N  MN  KKC VW
Sbjct:  408 WRRCANYVNGNMENAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKRAEEKALAIKERIGYPDDIVSNDNKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKDGDLVDWWTQQSASNFKEQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIADNGGLGQAYRAYQNYIKKNGEEKL-LPGLDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRIIGTLQNSAEFSEAFHCRKNSYMNPEKKCRVW 750          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Human
Match: MME (membrane metalloendopeptidase [Source:HGNC Symbol;Acc:HGNC:7154])

HSP 1 Score: 256.914 bits (655), Expect = 2.208e-76
Identity = 130/344 (37.79%), Postives = 197/344 (57.27%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLIS-ETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASY---VINNKPLPSLQTVGEDIADNAGIRMSYFAANS--KLEVREKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            W++C    +  ++  VG ++V++ F    K  +E +I  I+  F   +++ TWMD+ T   A EK  AI+ +IGYPD ++S +  L  +Y  +         N +   +F++ + LK + EK+  DEW  G+  VNA+Y+   N+IVFPA IL+ PF+      + NYGGIGMVIGHEI HGFD  G  F+  G L +WWT+ S   +  ++QC++ QY ++   +   + L  + T+GE+IADN G+  +Y A  +  K    EKL LPG+DL+ +QLFF+   + WC      +    +K DVHS   +RI G + N  EFS+ F+C +N  MN  KKC VW
Sbjct:  408 WRRCANYVNGNMENAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKRAEEKALAIKERIGYPDDIVSNDNKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKDGDLVDWWTQQSASNFKEQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIADNGGLGQAYRAYQNYIKKNGEEKL-LPGLDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRIIGTLQNSAEFSEAFHCRKNSYMNPEKKCRVW 750          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Human
Match: MME (membrane metalloendopeptidase [Source:HGNC Symbol;Acc:HGNC:7154])

HSP 1 Score: 256.914 bits (655), Expect = 2.208e-76
Identity = 130/344 (37.79%), Postives = 197/344 (57.27%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLIS-ETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASY---VINNKPLPSLQTVGEDIADNAGIRMSYFAANS--KLEVREKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            W++C    +  ++  VG ++V++ F    K  +E +I  I+  F   +++ TWMD+ T   A EK  AI+ +IGYPD ++S +  L  +Y  +         N +   +F++ + LK + EK+  DEW  G+  VNA+Y+   N+IVFPA IL+ PF+      + NYGGIGMVIGHEI HGFD  G  F+  G L +WWT+ S   +  ++QC++ QY ++   +   + L  + T+GE+IADN G+  +Y A  +  K    EKL LPG+DL+ +QLFF+   + WC      +    +K DVHS   +RI G + N  EFS+ F+C +N  MN  KKC VW
Sbjct:  408 WRRCANYVNGNMENAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKRAEEKALAIKERIGYPDDIVSNDNKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKDGDLVDWWTQQSASNFKEQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIADNGGLGQAYRAYQNYIKKNGEEKL-LPGLDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRIIGTLQNSAEFSEAFHCRKNSYMNPEKKCRVW 750          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Human
Match: MME (membrane metalloendopeptidase [Source:HGNC Symbol;Acc:HGNC:7154])

HSP 1 Score: 256.914 bits (655), Expect = 2.208e-76
Identity = 130/344 (37.79%), Postives = 197/344 (57.27%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLIS-ETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASY---VINNKPLPSLQTVGEDIADNAGIRMSYFAANS--KLEVREKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            W++C    +  ++  VG ++V++ F    K  +E +I  I+  F   +++ TWMD+ T   A EK  AI+ +IGYPD ++S +  L  +Y  +         N +   +F++ + LK + EK+  DEW  G+  VNA+Y+   N+IVFPA IL+ PF+      + NYGGIGMVIGHEI HGFD  G  F+  G L +WWT+ S   +  ++QC++ QY ++   +   + L  + T+GE+IADN G+  +Y A  +  K    EKL LPG+DL+ +QLFF+   + WC      +    +K DVHS   +RI G + N  EFS+ F+C +N  MN  KKC VW
Sbjct:  408 WRRCANYVNGNMENAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKRAEEKALAIKERIGYPDDIVSNDNKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKDGDLVDWWTQQSASNFKEQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIADNGGLGQAYRAYQNYIKKNGEEKL-LPGLDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRIIGTLQNSAEFSEAFHCRKNSYMNPEKKCRVW 750          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Celegans
Match: nep-2 (Neprilysin-2 [Source:UniProtKB/Swiss-Prot;Acc:O44857])

HSP 1 Score: 239.965 bits (611), Expect = 1.408e-70
Identity = 126/354 (35.59%), Postives = 199/354 (56.21%), Query Frame = 1
Query:  376 LLKGKQEEWKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNY----VNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVIN--NKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVREKL--TLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            ++  ++  W  CV   +S +      ++VK+ F    K+ +E MI  I  +F D++ +  W+   T  +A +K+  ++ KIGYPD L     +  +Y     TFK   G+Y     +F E  + + L+ + E +  + W  G+  VNA+Y+P +NEI+FPA IL+  FY    P + N+GGIG+VIGHEI HGFD +G  +D+ G +R+WW  ++  ++  K QCI  QY+SYV++  N  +    T GE+IADN G++ +Y  A  K E R      LPGV+L+ +QLFF+   + WC  +       +L+   HS    R+ GP+SN  +F+K +NC+   +MN  +KC VW
Sbjct:  388 IMNVQKVRWHGCVTRINSLMPMATSAIYVKNHFDHEAKQQVEEMISLIMESFVDLLLSEDWLTKETKQTAKQKVNEMKRKIGYPDYLNDPAAVNNEYK----TFKVYPGHYYQTKFSFYEQYQRDVLERITEAVDRERWVAGAALVNAFYSPNTNEIIFPAGILQPVFYSKDFPSSMNFGGIGVVIGHEITHGFDDRGRLYDNLGNIRQWWDNATISKFEHKAQCIEKQYSSYVLDQINMQINGKSTKGENIADNGGLKQAY-RAYKKYEKRHSRPPRLPGVNLTHDQLFFLNYAQIWCGTMNDKEAIRKLRTSEHSPGPIRVKGPLSNSYDFAKAYNCEPGSQMNPREKCRVW 736          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Celegans
Match: nep-1 (Neprilysin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q18673])

HSP 1 Score: 233.802 bits (595), Expect = 2.779e-68
Identity = 131/353 (37.11%), Postives = 189/353 (53.54%), Query Frame = 1
Query:  373 YLLKGKQEEWKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQ-EFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLP--SLQTVGEDIADNAGIRMSYFAANSKLEVR--EKLTLPGVD-LSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            Y  K +Q  WK CV      L    G+M+V+  F  + K     MI  ++ AF++++    WMD+ T   ALEK   +  +IGYPD ++++  L   Y  +E   ++     V    ++    Y + + E ++  E+   +  VNA+Y+PT N I FPA IL+ PF+D   P   NYGGIG VIGHEI HGFD  G +FD+ G LR+WW  ++  ++  +TQCII QYA   +    L      T GE+IADN GI+ ++ A  S LE    ++  LP  + L+ EQLFFVG  + WC   T       L  D HS    R+N  ++N PEF++ F C     MN  K+C+VW
Sbjct:  402 YGRKQRQPRWKDCVSSAGGKLSYASGSMYVRKYFDANAKNTTLDMITDLQEAFRNMMHANDWMDAETKKYALEKADQMLKQIGYPDFILNDEKLDDWYKGLEGAPEDSFSQLVEKSIQWRNNFYYRRLLEPVNRFEFISSAAVVNAFYSPTRNAIAFPAGILQQPFFDARFPKALNYGGIGAVIGHEITHGFDDTGRQFDNVGNLRDWWDNTTSSKFNERTQCIIEQYADVKLRGTDLRINGKLTQGENIADNGGIKQAFKAYKSYLEKHGGQEARLPQFESLTNEQLFFVGYAQVWCGAKTPETKTLLLLTDPHSPETARVNTVLTNQPEFAEAFKCPAGSPMNPTKRCVVW 754          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Celegans
Match: nep-11 (Neprilysin-11 [Source:UniProtKB/Swiss-Prot;Acc:O16796])

HSP 1 Score: 221.476 bits (563), Expect = 3.316e-63
Identity = 122/357 (34.17%), Postives = 198/357 (55.46%), Query Frame = 1
Query:  376 LLKGKQE---EWKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEM----TFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVI--NNKPLPSLQTVGEDIADNAGIRMSYFAANSKL-EVREKLTLPGV-DLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            ++ G+Q+    WK C Q+ S+ L    G ++V++ FQ S K +   MI +++ +F D++    WMD  T + A+EK  ++ + IGYPD       L K+Y  + +    T+  ++   V + + +RE   + + +     E+ +    VNA+Y+P  N I FPA IL+ PF+    P   NYG IG VIGHEI HGFD QGS++D  G L  WW++SS + + ++ +CI+ QY +Y +   N  +    T GE+IADN G++ ++ A    + E  E+  LPG+   + EQ+FFV     WC    ++   +++  D HS   +R+ G +SNM  F+ ++ C RN  +N   KC+VW
Sbjct:  495 VMTGQQQSPPRWKDCAQVPSTVLPLAAGAIYVQAHFQESDKHEALRMIMHLRNSFADLVRQNDWMDEETKAVAIEKANSMINNIGYPDVTNDLPKLDKQYLGLSISDSDTYYYIMKKSVVWMQ-SRE--FQKLTKPFDKHEFDISPAVVNAFYSPEKNAITFPAGILQPPFFSGTFPKAVNYGAIGAVIGHEITHGFDDQGSQYDKDGNLHNWWSESSLNSFDTRRRCIVEQYGNYTVPKTNFRVNGKLTQGENIADNGGVKEAFQAYQKYVTENGEEPRLPGLQQYTNEQIFFVSYAHFWCGKKKEAAAMQQVLTDEHSPEVFRVIGVLSNMQAFADVYKCPRNAPVNPDHKCIVW 848          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Celegans
Match: nep-21 (Neprilysin-21 [Source:UniProtKB/Swiss-Prot;Acc:Q22523])

HSP 1 Score: 207.223 bits (526), Expect = 1.670e-58
Identity = 112/347 (32.28%), Postives = 181/347 (52.16%), Query Frame = 1
Query:  394 EEWKKCVQITSSTLQEIVGNMFVKSQFQPSKK-KDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQY--ASYVINNKPLPSLQTVGEDIADNAGIRM---SYFAANSKLEVREKLTLPGV-DLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            + W+ CV ++   +   VG +FV++ F+  +  K +  +  Y+K  F   +    WMD  T   A+ K   I +K G+P  L ++T++ K +  I    + LL   +  +     E L  + + +    W     +V+AYY P +NE++FPA I++FPF  +G+P    YG +G VIGHE+ H FD QG ++D  G L +WW   + ++++ KT+C + QY     V  +  L    ++GE+IADN G++    +Y A  S      +  LPG  + + +Q+FF+     WCS+V      + +  DVH+  KYR   P+ N PEF+K F C     MN  +KC VW
Sbjct:  423 DRWEDCVTLSVIMMDMPVGRLFVENFFEKERAMKKMTELTSYLKNEFIKQLHVLDWMDEITRRRAISKANMIEYKSGFPMVLFNDTWMEKNWGMIIKPREYLLHLTIRVKLVRFTEELLRLDQPLDRSMWFQSPAQVDAYYAPNNNEMIFPAGIMQFPFLTLGVPNYITYGMVGAVIGHEVSHAFDDQGGQYDEMGNLNDWWDAETEEKFIEKTRCFVRQYENVHVVEADIHLNGQLSLGENIADNGGVKTAFNAYKAWKSNTTGISEPALPGFQNFTSQQMFFLAYANNWCSLVRPKHYIQIILTDVHAPSKYRAMIPLQNRPEFAKAFQCPIGSPMNPERKCQVW 769          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Celegans
Match: nep-21 (Neprilysin-21 [Source:UniProtKB/Swiss-Prot;Acc:Q22523])

HSP 1 Score: 207.223 bits (526), Expect = 1.670e-58
Identity = 112/347 (32.28%), Postives = 181/347 (52.16%), Query Frame = 1
Query:  394 EEWKKCVQITSSTLQEIVGNMFVKSQFQPSKK-KDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQY--ASYVINNKPLPSLQTVGEDIADNAGIRM---SYFAANSKLEVREKLTLPGV-DLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            + W+ CV ++   +   VG +FV++ F+  +  K +  +  Y+K  F   +    WMD  T   A+ K   I +K G+P  L ++T++ K +  I    + LL   +  +     E L  + + +    W     +V+AYY P +NE++FPA I++FPF  +G+P    YG +G VIGHE+ H FD QG ++D  G L +WW   + ++++ KT+C + QY     V  +  L    ++GE+IADN G++    +Y A  S      +  LPG  + + +Q+FF+     WCS+V      + +  DVH+  KYR   P+ N PEF+K F C     MN  +KC VW
Sbjct:  423 DRWEDCVTLSVIMMDMPVGRLFVENFFEKERAMKKMTELTSYLKNEFIKQLHVLDWMDEITRRRAISKANMIEYKSGFPMVLFNDTWMEKNWGMIIKPREYLLHLTIRVKLVRFTEELLRLDQPLDRSMWFQSPAQVDAYYAPNNNEMIFPAGIMQFPFLTLGVPNYITYGMVGAVIGHEVSHAFDDQGGQYDEMGNLNDWWDAETEEKFIEKTRCFVRQYENVHVVEADIHLNGQLSLGENIADNGGVKTAFNAYKAWKSNTTGISEPALPGFQNFTSQQMFFLAYANNWCSLVRPKHYIQIILTDVHAPSKYRAMIPLQNRPEFAKAFQCPIGSPMNPERKCQVW 769          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Fly
Match: Nep3 (gene:FBgn0031081 transcript:FBtr0307554)

HSP 1 Score: 269.626 bits (688), Expect = 2.899e-81
Identity = 134/345 (38.84%), Postives = 199/345 (57.68%), Query Frame = 1
Query:  385 GKQEEWKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVREK--LTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            G +E W+ CV  T++ +   VG +FV+  F    K   E MI  I+ AFK  ++N TW+D  T   A+EK   I   IG+PD ++    L KKYA + +T      N +    +  +  LK + + ++   W M  Q VNAYY PT N+IVFPA IL+ PF+DI  P + N+G +G+V+GHE+ H FD QG ++D  G +  WW   S + +  K++CI  QY+ Y +N + L   QT+GE+IADN G++ +Y A       R+   L LPG++L+  QLFFV   + WCS  T      +++ D HS  ++R+ G +SNM EF+++F C   K+MN  +KC VW
Sbjct:  442 GGEEIWRYCVSDTNNVVGFAVGAIFVRQAFHGESKPAAEQMIAEIREAFKMNLQNLTWVDKQTREKAIEKANQISDMIGFPDYILDPVELDKKYAELNITPNAYFENNIQVAIYNLKSNLKRLDQPVNKTNWGMTPQTVNAYYTPTKNQIVFPAGILQTPFFDINNPKSLNFGAMGVVMGHELTHAFDDQGREYDKFGNINRWWDSKSIERFNEKSECIARQYSGYKMNGRTLNGKQTLGENIADNGGLKAAYHAYQRTKSDRDVDILKLPGLNLTHSQLFFVSFAQVWCSSTTDETNLLQMEKDPHSPSQFRVIGTLSNMKEFAEVFQCKPGKRMNPTEKCEVW 786          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Fly
Match: Nep3 (gene:FBgn0031081 transcript:FBtr0070000)

HSP 1 Score: 269.626 bits (688), Expect = 2.899e-81
Identity = 134/345 (38.84%), Postives = 199/345 (57.68%), Query Frame = 1
Query:  385 GKQEEWKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVREK--LTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            G +E W+ CV  T++ +   VG +FV+  F    K   E MI  I+ AFK  ++N TW+D  T   A+EK   I   IG+PD ++    L KKYA + +T      N +    +  +  LK + + ++   W M  Q VNAYY PT N+IVFPA IL+ PF+DI  P + N+G +G+V+GHE+ H FD QG ++D  G +  WW   S + +  K++CI  QY+ Y +N + L   QT+GE+IADN G++ +Y A       R+   L LPG++L+  QLFFV   + WCS  T      +++ D HS  ++R+ G +SNM EF+++F C   K+MN  +KC VW
Sbjct:  442 GGEEIWRYCVSDTNNVVGFAVGAIFVRQAFHGESKPAAEQMIAEIREAFKMNLQNLTWVDKQTREKAIEKANQISDMIGFPDYILDPVELDKKYAELNITPNAYFENNIQVAIYNLKSNLKRLDQPVNKTNWGMTPQTVNAYYTPTKNQIVFPAGILQTPFFDINNPKSLNFGAMGVVMGHELTHAFDDQGREYDKFGNINRWWDSKSIERFNEKSECIARQYSGYKMNGRTLNGKQTLGENIADNGGLKAAYHAYQRTKSDRDVDILKLPGLNLTHSQLFFVSFAQVWCSSTTDETNLLQMEKDPHSPSQFRVIGTLSNMKEFAEVFQCKPGKRMNPTEKCEVW 786          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Fly
Match: Nep3 (gene:FBgn0031081 transcript:FBtr0307555)

HSP 1 Score: 269.626 bits (688), Expect = 2.899e-81
Identity = 134/345 (38.84%), Postives = 199/345 (57.68%), Query Frame = 1
Query:  385 GKQEEWKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVREK--LTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            G +E W+ CV  T++ +   VG +FV+  F    K   E MI  I+ AFK  ++N TW+D  T   A+EK   I   IG+PD ++    L KKYA + +T      N +    +  +  LK + + ++   W M  Q VNAYY PT N+IVFPA IL+ PF+DI  P + N+G +G+V+GHE+ H FD QG ++D  G +  WW   S + +  K++CI  QY+ Y +N + L   QT+GE+IADN G++ +Y A       R+   L LPG++L+  QLFFV   + WCS  T      +++ D HS  ++R+ G +SNM EF+++F C   K+MN  +KC VW
Sbjct:  442 GGEEIWRYCVSDTNNVVGFAVGAIFVRQAFHGESKPAAEQMIAEIREAFKMNLQNLTWVDKQTREKAIEKANQISDMIGFPDYILDPVELDKKYAELNITPNAYFENNIQVAIYNLKSNLKRLDQPVNKTNWGMTPQTVNAYYTPTKNQIVFPAGILQTPFFDINNPKSLNFGAMGVVMGHELTHAFDDQGREYDKFGNINRWWDSKSIERFNEKSECIARQYSGYKMNGRTLNGKQTLGENIADNGGLKAAYHAYQRTKSDRDVDILKLPGLNLTHSQLFFVSFAQVWCSSTTDETNLLQMEKDPHSPSQFRVIGTLSNMKEFAEVFQCKPGKRMNPTEKCEVW 786          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Fly
Match: Nep2 (gene:FBgn0027570 transcript:FBtr0333922)

HSP 1 Score: 250.751 bits (639), Expect = 2.429e-74
Identity = 130/360 (36.11%), Postives = 199/360 (55.28%), Query Frame = 1
Query:  358 QCAHNYLLKGKQEE---WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQE--VNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYV--INNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVR-EKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            Q  +   L G+QE+   WK+CV I +S+L   VG+++V   F    K +   M++ I+  F D+++   WMD+ T   A  KL ++   IGYPD ++    L   YA +++       +++    F  +     +   ++  +W   ++   VNA+Y+   N I FPA IL+  F++   P   N+G IG VIGHEI HGFD QG +FD KG LR+WW   ++  YL+K +CII QY +Y        L  + T GE+IADN G++ SY A     E    +  LPG+D +PEQ+F+V  G+TWC+   K  +  R+   VHS  ++R+ G +SNM +F+K F+C     MN ++KC VW
Sbjct:  404 QLQYATALSGRQEQEARWKECVDIATSSLGISVGSLYVGKHFHKDSKANALEMVNEIRNVFNDILDEVNWMDAKTKKEAKLKLHSMATHIGYPDEMLDNEKLAAYYAKLDIDPDKYFESFLGMNIFGTDYSFNKLRLPVNKTDWVRHARPAIVNAFYSSLENSIQFPAGILQGHFFNAQRPKYMNFGAIGYVIGHEITHGFDDQGRQFDVKGNLRDWWHPDTQKAYLAKAKCIIEQYGNYTERATGLNLNGINTQGENIADNGGVKESYIAYRRWAEKHGPEAKLPGLDYTPEQMFWVAAGQTWCAKYRKESLKMRITTGVHSPSEFRVLGSLSNMKDFAKDFHCPEGSPMNPVQKCEVW 763          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Fly
Match: Nep2 (gene:FBgn0027570 transcript:FBtr0078891)

HSP 1 Score: 250.751 bits (639), Expect = 2.429e-74
Identity = 130/360 (36.11%), Postives = 199/360 (55.28%), Query Frame = 1
Query:  358 QCAHNYLLKGKQEE---WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQE--VNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYV--INNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVR-EKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            Q  +   L G+QE+   WK+CV I +S+L   VG+++V   F    K +   M++ I+  F D+++   WMD+ T   A  KL ++   IGYPD ++    L   YA +++       +++    F  +     +   ++  +W   ++   VNA+Y+   N I FPA IL+  F++   P   N+G IG VIGHEI HGFD QG +FD KG LR+WW   ++  YL+K +CII QY +Y        L  + T GE+IADN G++ SY A     E    +  LPG+D +PEQ+F+V  G+TWC+   K  +  R+   VHS  ++R+ G +SNM +F+K F+C     MN ++KC VW
Sbjct:  404 QLQYATALSGRQEQEARWKECVDIATSSLGISVGSLYVGKHFHKDSKANALEMVNEIRNVFNDILDEVNWMDAKTKKEAKLKLHSMATHIGYPDEMLDNEKLAAYYAKLDIDPDKYFESFLGMNIFGTDYSFNKLRLPVNKTDWVRHARPAIVNAFYSSLENSIQFPAGILQGHFFNAQRPKYMNFGAIGYVIGHEITHGFDDQGRQFDVKGNLRDWWHPDTQKAYLAKAKCIIEQYGNYTERATGLNLNGINTQGENIADNGGVKESYIAYRRWAEKHGPEAKLPGLDYTPEQMFWVAAGQTWCAKYRKESLKMRITTGVHSPSEFRVLGSLSNMKDFAKDFHCPEGSPMNPVQKCEVW 763          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Zebrafish
Match: ece2b (endothelin converting enzyme 2b [Source:ZFIN;Acc:ZDB-GENE-131120-140])

HSP 1 Score: 278.1 bits (710), Expect = 1.727e-84
Identity = 138/339 (40.71%), Postives = 197/339 (58.11%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVR-EKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            W+ C+  T  TL   +G +FVK+ F    K+  E MI+ I+ AFK  +++  WMD  T  +A +K  AI   IG+PD ++    L   Y   E+T  N   N +NF  F+       + +  + D+W+M    VNAYY PT N IVFPA IL+ PFY    P   N+GGIG+V+GHE+ H FD QG ++D  G LR WW  SS + + ++T+C+++QY  Y IN + +   QT+GE+IADN G++ +Y A  S ++   E+  LP V+L+ +QLFFVG  + WCS+ T     E L  D HS  KYR+ G +SN PEF++ F C     MN   +C VW
Sbjct:  427 WQTCIGNTDDTLGFALGALFVKATFDKQSKEIAEGMINEIRTAFKGALDDLKWMDEQTRQAAKDKADAIYDMIGFPDFILDSKELDDVYDGYEVTEDNFFQNMINFYNFSARVMADQLRKPPNRDQWSMTPPTVNAYYMPTKNGIVFPAGILQAPFYAQDHPKALNFGGIGVVMGHELTHAFDDQGREYDKDGNLRSWWQNSSVEAFKNRTECMVDQYTQYTINGEHINGKQTLGENIADNGGLKAAYHAYRSWVQKNGEEKRLPAVNLTNDQLFFVGFAQVWCSVRTPESAHEGLMTDPHSPPKYRVIGTLSNSPEFAEHFQCPLGSSMNSGHRCEVW 765          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Zebrafish
Match: ece1 (endothelin converting enzyme 1 [Source:ZFIN;Acc:ZDB-GENE-061110-100])

HSP 1 Score: 257.299 bits (656), Expect = 8.671e-77
Identity = 137/343 (39.94%), Postives = 201/343 (58.60%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMT----FKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFA-ANSKLEVREKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            WK CV  T S L   +G +FVK+ F    K  +E M+  IK AF+D ++  +WMD  T  +A EK  AI + +GYP  +++   L K +   ++     F+N++ NY NF      + L+    +   D+W+M    VNAYYNPT NE+V PA I + PFY+   P   N+GGIG+V+GHE+ H FD QG K+D  G L +WW  SS + +  +TQC++ QY++Y INN+PL    T+GE+IADN G+  +Y A  N   +  E+ +LP + ++  QLFFVG  + WCS+ T     E +  D HS  ++R+ G +SN  EFS+ F C  +  MN  +KC +W
Sbjct:  414 WKLCVSDTDSALGFALGALFVKATFSEDSKAFVEDMVSEIKWAFEDSLKTVSWMDPETKKAAKEKADAIYNMVGYPKFIMNPKELDKVFNDFDVVSDLYFQNVM-NYYNFSARVTADQLRKAPNR---DQWSMTPPTVNAYYNPTKNEMVLPAGIFQAPFYNHAWPKAMNFGGIGVVMGHELTHAFDDQGRKYDKDGNLAKWWQNSSVEAFQHQTQCMVEQYSNYSINNEPLNGKHTLGENIADNGGLNAAYKAYVNWIKKNGEEASLPALGMNNHQLFFVGFAQVWCSVRTPESSHEGVITDPHSPSRFRVIGTISNSHEFSEHFGCKADSPMNPKRKCELW 752          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Zebrafish
Match: ece1 (endothelin converting enzyme 1 [Source:ZFIN;Acc:ZDB-GENE-061110-100])

HSP 1 Score: 257.299 bits (656), Expect = 8.671e-77
Identity = 137/343 (39.94%), Postives = 201/343 (58.60%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMT----FKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFA-ANSKLEVREKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            WK CV  T S L   +G +FVK+ F    K  +E M+  IK AF+D ++  +WMD  T  +A EK  AI + +GYP  +++   L K +   ++     F+N++ NY NF      + L+    +   D+W+M    VNAYYNPT NE+V PA I + PFY+   P   N+GGIG+V+GHE+ H FD QG K+D  G L +WW  SS + +  +TQC++ QY++Y INN+PL    T+GE+IADN G+  +Y A  N   +  E+ +LP + ++  QLFFVG  + WCS+ T     E +  D HS  ++R+ G +SN  EFS+ F C  +  MN  +KC +W
Sbjct:  414 WKLCVSDTDSALGFALGALFVKATFSEDSKAFVEDMVSEIKWAFEDSLKTVSWMDPETKKAAKEKADAIYNMVGYPKFIMNPKELDKVFNDFDVVSDLYFQNVM-NYYNFSARVTADQLRKAPNR---DQWSMTPPTVNAYYNPTKNEMVLPAGIFQAPFYNHAWPKAMNFGGIGVVMGHELTHAFDDQGRKYDKDGNLAKWWQNSSVEAFQHQTQCMVEQYSNYSINNEPLNGKHTLGENIADNGGLNAAYKAYVNWIKKNGEEASLPALGMNNHQLFFVGFAQVWCSVRTPESSHEGVITDPHSPSRFRVIGTISNSHEFSEHFGCKADSPMNPKRKCELW 752          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Zebrafish
Match: mmel1 (membrane metallo-endopeptidase-like 1 [Source:ZFIN;Acc:ZDB-GENE-101112-2])

HSP 1 Score: 242.276 bits (617), Expect = 5.123e-71
Identity = 119/348 (34.20%), Postives = 195/348 (56.03%), Query Frame = 1
Query:  388 KQEEWKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISET--YLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASY---VINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVR-EKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            ++  W+ CV+     ++  VG ++V+  F  + K+ +  +I  I+ A+ + +E  +WMD  +   A EK  AI  +IGYPD ++ E    L ++YA +  + +N   N +     + ++  K + E + PD W +G+  VNA+Y+   N+IVFPA IL+ PF+        N+GGIGMVIGHEI HGFD  G  FD  G +  WW+  S + +  +++C++ QY  +   +   + +  + T+GE+IADN G+R +Y A    +E   E+  LPG+D++ +QLFF+   + WC      +  + +K D HS  +YR+ G + N   FS+ F+C R   MN  +KC VW
Sbjct:  418 EEARWRDCVRYVQGNMENAVGALYVRETFSGNSKRMVGELIKKIQEAYVETLEELSWMDEQSKVKAREKAMAISEQIGYPDHILEEENKKLDQEYAHLNFSEENYFENILENLAASAQKGHKKLREPVDPDMWIIGAAVVNAFYSHNRNQIVFPAGILQPPFFSEKQLQALNFGGIGMVIGHEITHGFDDHGRNFDKDGNMYNWWSNYSAERFEDQSKCMVEQYGRFSWKLAGGQNVSGITTLGENIADNGGVRQAYKAYVKWVEREGEEPRLPGLDMNHKQLFFLNFAQVWCGACRPEYAIQTIKTDPHSPLEYRVLGSLQNFEAFSEAFHCARGAPMNPEEKCRVW 765          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Zebrafish
Match: mmel1 (membrane metallo-endopeptidase-like 1 [Source:ZFIN;Acc:ZDB-GENE-101112-2])

HSP 1 Score: 242.276 bits (617), Expect = 5.123e-71
Identity = 119/348 (34.20%), Postives = 195/348 (56.03%), Query Frame = 1
Query:  388 KQEEWKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISET--YLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASY---VINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVR-EKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            ++  W+ CV+     ++  VG ++V+  F  + K+ +  +I  I+ A+ + +E  +WMD  +   A EK  AI  +IGYPD ++ E    L ++YA +  + +N   N +     + ++  K + E + PD W +G+  VNA+Y+   N+IVFPA IL+ PF+        N+GGIGMVIGHEI HGFD  G  FD  G +  WW+  S + +  +++C++ QY  +   +   + +  + T+GE+IADN G+R +Y A    +E   E+  LPG+D++ +QLFF+   + WC      +  + +K D HS  +YR+ G + N   FS+ F+C R   MN  +KC VW
Sbjct:  418 EEARWRDCVRYVQGNMENAVGALYVRETFSGNSKRMVGELIKKIQEAYVETLEELSWMDEQSKVKAREKAMAISEQIGYPDHILEEENKKLDQEYAHLNFSEENYFENILENLAASAQKGHKKLREPVDPDMWIIGAAVVNAFYSHNRNQIVFPAGILQPPFFSEKQLQALNFGGIGMVIGHEITHGFDDHGRNFDKDGNMYNWWSNYSAERFEDQSKCMVEQYGRFSWKLAGGQNVSGITTLGENIADNGGVRQAYKAYVKWVEREGEEPRLPGLDMNHKQLFFLNFAQVWCGACRPEYAIQTIKTDPHSPLEYRVLGSLQNFEAFSEAFHCARGAPMNPEEKCRVW 765          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Xenopus
Match: dhdds (dehydrodolichyl diphosphate synthase subunit [Source:Xenbase;Acc:XB-GENE-1002142])

HSP 1 Score: 274.633 bits (701), Expect = 4.692e-83
Identity = 140/339 (41.30%), Postives = 200/339 (59.00%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKL-EVREKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            W+ C+  T  TL   +G++FVKS F  + K   E MI  I+ AF+  +   TWMD  T  +A EK  AI   IG+PD ++    L + Y   E++      N +NF  F+ +   + + +  + ++W+M  Q VNAYY P  NEIVFPA IL+ PFY    P   N+GGIG+V+GHE+ H FD QG ++D  G LR WW  SS + + ++T+C++NQY SY +N + +   QT+GE+IADN G++ +Y A  S L +  E+  LPGV L+  QLFFVG  + WCS+ T     E L  D HS  K+R+ G +SN  +F++ FNC +   MN  K C VW
Sbjct:  417 WQTCLSNTDDTLGFALGSLFVKSTFDKNSKNIAEQMISEIRDAFELTLGGLTWMDEKTRRAAKEKADAIYDMIGFPDFILDTKELDEVYDGFEVSEDAFFQNMLNFYNFSAKLMAEQLRKPPNREQWSMTPQTVNAYYLPNKNEIVFPAGILQAPFYAPTHPKALNFGGIGVVMGHELTHAFDDQGREYDEDGNLRPWWQNSSLEAFKNRTECMVNQYNSYTVNGERVNGRQTLGENIADNGGLKAAYHAYKSWLVKHGEEKQLPGVGLTNNQLFFVGFAQVWCSVRTPESSHEGLVTDPHSPAKFRVIGTLSNSKDFAEHFNCPKGTPMNPGKHCDVW 755          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Xenopus
Match: dhdds (dehydrodolichyl diphosphate synthase subunit [Source:Xenbase;Acc:XB-GENE-1002142])

HSP 1 Score: 274.633 bits (701), Expect = 5.913e-83
Identity = 140/339 (41.30%), Postives = 200/339 (59.00%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKL-EVREKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            W+ C+  T  TL   +G++FVKS F  + K   E MI  I+ AF+  +   TWMD  T  +A EK  AI   IG+PD ++    L + Y   E++      N +NF  F+ +   + + +  + ++W+M  Q VNAYY P  NEIVFPA IL+ PFY    P   N+GGIG+V+GHE+ H FD QG ++D  G LR WW  SS + + ++T+C++NQY SY +N + +   QT+GE+IADN G++ +Y A  S L +  E+  LPGV L+  QLFFVG  + WCS+ T     E L  D HS  K+R+ G +SN  +F++ FNC +   MN  K C VW
Sbjct:  428 WQTCLSNTDDTLGFALGSLFVKSTFDKNSKNIAEQMISEIRDAFELTLGGLTWMDEKTRRAAKEKADAIYDMIGFPDFILDTKELDEVYDGFEVSEDAFFQNMLNFYNFSAKLMAEQLRKPPNREQWSMTPQTVNAYYLPNKNEIVFPAGILQAPFYAPTHPKALNFGGIGVVMGHELTHAFDDQGREYDEDGNLRPWWQNSSLEAFKNRTECMVNQYNSYTVNGERVNGRQTLGENIADNGGLKAAYHAYKSWLVKHGEEKQLPGVGLTNNQLFFVGFAQVWCSVRTPESSHEGLVTDPHSPAKFRVIGTLSNSKDFAEHFNCPKGTPMNPGKHCDVW 766          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Xenopus
Match: dhdds (dehydrodolichyl diphosphate synthase subunit [Source:Xenbase;Acc:XB-GENE-1002142])

HSP 1 Score: 274.248 bits (700), Expect = 7.235e-83
Identity = 140/339 (41.30%), Postives = 200/339 (59.00%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKL-EVREKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            W+ C+  T  TL   +G++FVKS F  + K   E MI  I+ AF+  +   TWMD  T  +A EK  AI   IG+PD ++    L + Y   E++      N +NF  F+ +   + + +  + ++W+M  Q VNAYY P  NEIVFPA IL+ PFY    P   N+GGIG+V+GHE+ H FD QG ++D  G LR WW  SS + + ++T+C++NQY SY +N + +   QT+GE+IADN G++ +Y A  S L +  E+  LPGV L+  QLFFVG  + WCS+ T     E L  D HS  K+R+ G +SN  +F++ FNC +   MN  K C VW
Sbjct:  426 WQTCLSNTDDTLGFALGSLFVKSTFDKNSKNIAEQMISEIRDAFELTLGGLTWMDEKTRRAAKEKADAIYDMIGFPDFILDTKELDEVYDGFEVSEDAFFQNMLNFYNFSAKLMAEQLRKPPNREQWSMTPQTVNAYYLPNKNEIVFPAGILQAPFYAPTHPKALNFGGIGVVMGHELTHAFDDQGREYDEDGNLRPWWQNSSLEAFKNRTECMVNQYNSYTVNGERVNGRQTLGENIADNGGLKAAYHAYKSWLVKHGEEKQLPGVGLTNNQLFFVGFAQVWCSVRTPESSHEGLVTDPHSPAKFRVIGTLSNSKDFAEHFNCPKGTPMNPGKHCDVW 764          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Xenopus
Match: dhdds (dehydrodolichyl diphosphate synthase subunit [Source:Xenbase;Acc:XB-GENE-1002142])

HSP 1 Score: 268.855 bits (686), Expect = 1.292e-81
Identity = 143/341 (41.94%), Postives = 201/341 (58.94%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPI--EMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKL-EVREKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            W+ C+  T  TL   +G++FVKS F  + K   E MI  I+ AF+  +   TWMD  T  +A EK  AI   IG+PD ++    L + Y  +  +  F+N+L N+ NF      E L+    +   ++W+M  Q VNAYY P  NEIVFPA IL+ PFY    P   N+GGIG+V+GHE+ H FD QG ++D  G LR WW  SS + + ++T+C++NQY SY +N + +   QT+GE+IADN G++ +Y A  S L +  E+  LPGV L+  QLFFVG  + WCS+ T     E L  D HS  K+R+ G +SN  +F++ FNC +   MN  K C VW
Sbjct:  341 WQTCLSNTDDTLGFALGSLFVKSTFDKNSKNIAEQMISEIRDAFELTLGGLTWMDEKTRRAAKEKADAIYDMIGFPDFILDTKELDEVYDGVSEDAFFQNML-NFYNFSAKLMAEQLRKPPNR---EQWSMTPQTVNAYYLPNKNEIVFPAGILQAPFYAPTHPKALNFGGIGVVMGHELTHAFDDQGREYDEDGNLRPWWQNSSLEAFKNRTECMVNQYNSYTVNGERVNGRQTLGENIADNGGLKAAYHAYKSWLVKHGEEKQLPGVGLTNNQLFFVGFAQVWCSVRTPESSHEGLVTDPHSPAKFRVIGTLSNSKDFAEHFNCPKGTPMNPGKHCDVW 677          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Xenopus
Match: dhdds (dehydrodolichyl diphosphate synthase subunit [Source:Xenbase;Acc:XB-GENE-1002142])

HSP 1 Score: 269.24 bits (687), Expect = 2.730e-81
Identity = 143/341 (41.94%), Postives = 201/341 (58.94%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPI--EMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKL-EVREKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            W+ C+  T  TL   +G++FVKS F  + K   E MI  I+ AF+  +   TWMD  T  +A EK  AI   IG+PD ++    L + Y  +  +  F+N+L N+ NF      E L+    +   ++W+M  Q VNAYY P  NEIVFPA IL+ PFY    P   N+GGIG+V+GHE+ H FD QG ++D  G LR WW  SS + + ++T+C++NQY SY +N + +   QT+GE+IADN G++ +Y A  S L +  E+  LPGV L+  QLFFVG  + WCS+ T     E L  D HS  K+R+ G +SN  +F++ FNC +   MN  K C VW
Sbjct:  394 WQTCLSNTDDTLGFALGSLFVKSTFDKNSKNIAEQMISEIRDAFELTLGGLTWMDEKTRRAAKEKADAIYDMIGFPDFILDTKELDEVYDGVSEDAFFQNML-NFYNFSAKLMAEQLRKPPNR---EQWSMTPQTVNAYYLPNKNEIVFPAGILQAPFYAPTHPKALNFGGIGVVMGHELTHAFDDQGREYDEDGNLRPWWQNSSLEAFKNRTECMVNQYNSYTVNGERVNGRQTLGENIADNGGLKAAYHAYKSWLVKHGEEKQLPGVGLTNNQLFFVGFAQVWCSVRTPESSHEGLVTDPHSPAKFRVIGTLSNSKDFAEHFNCPKGTPMNPGKHCDVW 730          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Mouse
Match: Ece2 (endothelin converting enzyme 2 [Source:MGI Symbol;Acc:MGI:1101356])

HSP 1 Score: 258.455 bits (659), Expect = 2.292e-77
Identity = 133/339 (39.23%), Postives = 192/339 (56.64%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVR-EKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            W+ C+  T   L   +G++FVK+ F    K+  E MI+ I++AF++ + +  WMD  T  +A EK  AI   IG+PD ++    L   Y   E++  +   N +N   F+ +     + +  S D+W+M  Q VNAYY PT NEIVFPA IL+ PFY    P   N+GGIG+V+GHE+ H FD QG ++D +G LR WW   S   + + T C+  QY+ Y +N + L  LQT+GE+IADN G++ +Y A  + L    E+  LP V L+  QLFFVG  + WCS+ T     E L  D HS  ++R+ G +SN  +F + F C     MN  + C VW
Sbjct:  396 WQTCISNTDDALGFALGSLFVKATFDRQSKEIAEGMINEIRSAFEETLGDLVWMDEKTRLAAKEKADAIYDMIGFPDFILEPKELDDVYDGYEVSEDSFFQNMLNLYNFSAKVMADQLRKPPSRDQWSMTPQTVNAYYLPTKNEIVFPAGILQAPFYAHNHPKALNFGGIGVVMGHELTHAFDDQGREYDKEGNLRPWWQNESLTAFQNHTACMEEQYSQYQVNGERLNGLQTLGENIADNGGLKAAYNAYKAWLRKHGEEQPLPAVGLTNHQLFFVGFAQVWCSVRTPESSHEGLVTDPHSPARFRVLGTLSNSRDFLRHFGCPVGSPMNPGQLCEVW 734          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Mouse
Match: Ece2 (endothelin converting enzyme 2 [Source:MGI Symbol;Acc:MGI:1101356])

HSP 1 Score: 258.84 bits (660), Expect = 3.116e-77
Identity = 133/339 (39.23%), Postives = 192/339 (56.64%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVR-EKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            W+ C+  T   L   +G++FVK+ F    K+  E MI+ I++AF++ + +  WMD  T  +A EK  AI   IG+PD ++    L   Y   E++  +   N +N   F+ +     + +  S D+W+M  Q VNAYY PT NEIVFPA IL+ PFY    P   N+GGIG+V+GHE+ H FD QG ++D +G LR WW   S   + + T C+  QY+ Y +N + L  LQT+GE+IADN G++ +Y A  + L    E+  LP V L+  QLFFVG  + WCS+ T     E L  D HS  ++R+ G +SN  +F + F C     MN  + C VW
Sbjct:  425 WQTCISNTDDALGFALGSLFVKATFDRQSKEIAEGMINEIRSAFEETLGDLVWMDEKTRLAAKEKADAIYDMIGFPDFILEPKELDDVYDGYEVSEDSFFQNMLNLYNFSAKVMADQLRKPPSRDQWSMTPQTVNAYYLPTKNEIVFPAGILQAPFYAHNHPKALNFGGIGVVMGHELTHAFDDQGREYDKEGNLRPWWQNESLTAFQNHTACMEEQYSQYQVNGERLNGLQTLGENIADNGGLKAAYNAYKAWLRKHGEEQPLPAVGLTNHQLFFVGFAQVWCSVRTPESSHEGLVTDPHSPARFRVLGTLSNSRDFLRHFGCPVGSPMNPGQLCEVW 763          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Mouse
Match: Mme (membrane metallo endopeptidase [Source:MGI Symbol;Acc:MGI:97004])

HSP 1 Score: 257.684 bits (657), Expect = 5.964e-77
Identity = 131/344 (38.08%), Postives = 197/344 (57.27%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLIS-ETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASY---VINNKPLPSLQTVGEDIADNAGIRMSYFAANS--KLEVREKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            W++C    +  ++  VG ++V++ F    K  +E +I  I+  F   +++ TWMD+ T   A EK  AI+ +IGYPD +IS E  L  +Y  +         N +   +F++ + LK + EK+  DEW  G+  VNA+Y+   N+IVFPA IL+ PF+      + NYGGIGMVIGHEI HGFD  G  F+  G L +WWT+ S + +  ++QC++ QY ++   +   + L  + T+GE+IADN GI  +Y A  +  K    EKL LPG+DL+ +QLFF+   + WC      +    +K DVHS   +RI G + N  EF+  F+C +N  MN  +KC VW
Sbjct:  408 WRRCANYVNGNMENAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKKAEEKALAIKERIGYPDDIISNENKLNNEYLELNYREDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKDGDLVDWWTQQSANNFKDQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIADNGGIGQAYRAYQNYVKKNGEEKL-LPGLDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRIIGTLQNSAEFADAFHCRKNSYMNPERKCRVW 750          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Mouse
Match: Mme (membrane metallo endopeptidase [Source:MGI Symbol;Acc:MGI:97004])

HSP 1 Score: 257.684 bits (657), Expect = 5.964e-77
Identity = 131/344 (38.08%), Postives = 197/344 (57.27%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLIS-ETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASY---VINNKPLPSLQTVGEDIADNAGIRMSYFAANS--KLEVREKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            W++C    +  ++  VG ++V++ F    K  +E +I  I+  F   +++ TWMD+ T   A EK  AI+ +IGYPD +IS E  L  +Y  +         N +   +F++ + LK + EK+  DEW  G+  VNA+Y+   N+IVFPA IL+ PF+      + NYGGIGMVIGHEI HGFD  G  F+  G L +WWT+ S + +  ++QC++ QY ++   +   + L  + T+GE+IADN GI  +Y A  +  K    EKL LPG+DL+ +QLFF+   + WC      +    +K DVHS   +RI G + N  EF+  F+C +N  MN  +KC VW
Sbjct:  408 WRRCANYVNGNMENAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKKAEEKALAIKERIGYPDDIISNENKLNNEYLELNYREDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKDGDLVDWWTQQSANNFKDQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIADNGGIGQAYRAYQNYVKKNGEEKL-LPGLDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRIIGTLQNSAEFADAFHCRKNSYMNPERKCRVW 750          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Mouse
Match: Mme (membrane metallo endopeptidase [Source:MGI Symbol;Acc:MGI:97004])

HSP 1 Score: 257.684 bits (657), Expect = 5.964e-77
Identity = 131/344 (38.08%), Postives = 197/344 (57.27%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLIS-ETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASY---VINNKPLPSLQTVGEDIADNAGIRMSYFAANS--KLEVREKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            W++C    +  ++  VG ++V++ F    K  +E +I  I+  F   +++ TWMD+ T   A EK  AI+ +IGYPD +IS E  L  +Y  +         N +   +F++ + LK + EK+  DEW  G+  VNA+Y+   N+IVFPA IL+ PF+      + NYGGIGMVIGHEI HGFD  G  F+  G L +WWT+ S + +  ++QC++ QY ++   +   + L  + T+GE+IADN GI  +Y A  +  K    EKL LPG+DL+ +QLFF+   + WC      +    +K DVHS   +RI G + N  EF+  F+C +N  MN  +KC VW
Sbjct:  408 WRRCANYVNGNMENAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKKAEEKALAIKERIGYPDDIISNENKLNNEYLELNYREDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKDGDLVDWWTQQSANNFKDQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIADNGGIGQAYRAYQNYVKKNGEEKL-LPGLDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRIIGTLQNSAEFADAFHCRKNSYMNPERKCRVW 750          
BLAST of Endothelin-converting enzyme 1 vs. UniProt/SwissProt
Match: sp|Q8IS64|ECE_LOCMI (Endothelin-converting enzyme homolog OS=Locusta migratoria OX=7004 PE=2 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 2.665e-85
Identity = 136/348 (39.08%), Postives = 210/348 (60.34%), Query Frame = 1
Query:  382 KGKQEEWKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVREK----LTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            +G ++ W+ CV  T++ +   +G MFV+  F  + K   E MI+ I+ AFK  ++N  WMD+ T  +A +K  AI   IG+PD +++   L KKY  +E+       N +   ++  +  L+ + + ++   W M    VNAYY PT N+IVFPA IL+ PFYDIG P + NYG +G+V+GHE+ H FD QG ++D  G L +WW   + + +  +TQC+++QY++Y ++NK +   QT+GE+IADN G++ +Y A    LE  ++    L LPG++ S +QLFF+   + WCS  T   I  +L+ D H+  K+R+ GP+SN+ EFS  F C    KMN + KC VW
Sbjct:  383 EGGEKPWRYCVTDTNNVIGFAIGAMFVREAFHGNSKPAAENMINQIRTAFKSNLKNLKWMDAETRRAAEKKADAISDMIGFPDYILNPEELDKKYKDLEIKEDEYFENNLRVNKYNLKSNLEKLDQPVNKTRWGMTPPTVNAYYTPTKNQIVFPAGILQAPFYDIGHPKSMNYGAMGVVMGHELTHAFDDQGREYDQNGNLHKWWNNQTIEAFKKRTQCVVDQYSNYTVDNKHVNGKQTLGENIADNGGLKAAYHAY---LEWEQRNPRELPLPGLNFSHKQLFFLSFAQVWCSASTDEAIKLQLEKDPHAPPKFRVIGPLSNLQEFSTEFRCPLGSKMNPVHKCEVW 727          

HSP 2 Score: 54.6842 bits (130), Expect = 1.477e-6
Identity = 30/107 (28.04%), Postives = 54/107 (50.47%), Query Frame = 2
Query:    5 LAKALPSIADQSDPEKYTNKLSIRNMQQKFPSISWIRVINEVLENSDKKLKEDDKLVAFSLEYFDSLIKILKEYLGDSQKKQILQRDLEWAVISSLVPLGSDSLIEA 325
            LAK +    D+ D EK  N + +  +Q + P I+W    +  +EN  +K+ + +K+V ++ EY + L  I++ Y   +  K IL   L W  + S+    S +  +A
Sbjct:  265 LAKIMSPQEDRRDEEKLYNNMELDKVQGRPPFINWHAFFSNAMENITRKISKKEKVVVYAPEYLEKLNDIIRNYTNTTDGKIILNNYLVWQTVRSMTSYLSKAFRDA 371          
BLAST of Endothelin-converting enzyme 1 vs. UniProt/SwissProt
Match: sp|Q9W5Y0|NEP3_DROME (Neprilysin-3 OS=Drosophila melanogaster OX=7227 GN=Nep3 PE=2 SV=2)

HSP 1 Score: 269.626 bits (688), Expect = 2.906e-80
Identity = 134/345 (38.84%), Postives = 199/345 (57.68%), Query Frame = 1
Query:  385 GKQEEWKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVREK--LTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            G +E W+ CV  T++ +   VG +FV+  F    K   E MI  I+ AFK  ++N TW+D  T   A+EK   I   IG+PD ++    L KKYA + +T      N +    +  +  LK + + ++   W M  Q VNAYY PT N+IVFPA IL+ PF+DI  P + N+G +G+V+GHE+ H FD QG ++D  G +  WW   S + +  K++CI  QY+ Y +N + L   QT+GE+IADN G++ +Y A       R+   L LPG++L+  QLFFV   + WCS  T      +++ D HS  ++R+ G +SNM EF+++F C   K+MN  +KC VW
Sbjct:  442 GGEEIWRYCVSDTNNVVGFAVGAIFVRQAFHGESKPAAEQMIAEIREAFKMNLQNLTWVDKQTREKAIEKANQISDMIGFPDYILDPVELDKKYAELNITPNAYFENNIQVAIYNLKSNLKRLDQPVNKTNWGMTPQTVNAYYTPTKNQIVFPAGILQTPFFDINNPKSLNFGAMGVVMGHELTHAFDDQGREYDKFGNINRWWDSKSIERFNEKSECIARQYSGYKMNGRTLNGKQTLGENIADNGGLKAAYHAYQRTKSDRDVDILKLPGLNLTHSQLFFVSFAQVWCSSTTDETNLLQMEKDPHSPSQFRVIGTLSNMKEFAEVFQCKPGKRMNPTEKCEVW 786          
BLAST of Endothelin-converting enzyme 1 vs. UniProt/SwissProt
Match: sp|F1N476|ECE2_BOVIN (Endothelin-converting enzyme 2 OS=Bos taurus OX=9913 GN=ECE2 PE=2 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 3.535e-77
Identity = 134/339 (39.53%), Postives = 190/339 (56.05%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVR-EKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            W+ C+  T   L   +G++FVK+ F    K+  E MI  I+AAF++ + +  WMD  T  +A EK  AI   IG+PD ++    L   Y   E++  +   N +N   F+ +     + +  S D+W+M  Q VNAYY PT NEIVFPA IL+ PFY    P   N+GGIG+V+GHE+ H FD QG ++D +G LR WW   S   + + T CI  QY+ Y +N + L   QT+GE+IADN G++ +Y A  + L    E+  LP V L+  QLFFVG  + WCS+ T     E L  D HS  ++R+ G +SN  +F + F C     MN  + C VW
Sbjct:  427 WQTCISNTDDALGFALGSLFVKATFDRQSKEIAEGMISEIRAAFEEALGHLVWMDEKTRQAAKEKADAIYDMIGFPDFILEPKELDDVYDGYEVSEDSFFQNMLNLYNFSAKVMADQLRKPPSRDQWSMTPQTVNAYYLPTKNEIVFPAGILQAPFYTCNHPKALNFGGIGVVMGHELTHAFDDQGREYDKEGNLRPWWQNESLAAFRNHTACIEEQYSQYQVNGEKLNGRQTLGENIADNGGLKAAYNAYKAWLRKHGEEQQLPAVGLTNHQLFFVGFAQVWCSVRTPESSHEGLVTDPHSPARFRVLGTLSNSRDFLRHFGCPVGSPMNSGQLCEVW 765          
BLAST of Endothelin-converting enzyme 1 vs. UniProt/SwissProt
Match: sp|B2RQR8|ECE2_MOUSE (Endothelin-converting enzyme 2 OS=Mus musculus OX=10090 GN=Ece2 PE=1 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 2.180e-76
Identity = 133/339 (39.23%), Postives = 192/339 (56.64%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVR-EKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            W+ C+  T   L   +G++FVK+ F    K+  E MI+ I++AF++ + +  WMD  T  +A EK  AI   IG+PD ++    L   Y   E++  +   N +N   F+ +     + +  S D+W+M  Q VNAYY PT NEIVFPA IL+ PFY    P   N+GGIG+V+GHE+ H FD QG ++D +G LR WW   S   + + T C+  QY+ Y +N + L  LQT+GE+IADN G++ +Y A  + L    E+  LP V L+  QLFFVG  + WCS+ T     E L  D HS  ++R+ G +SN  +F + F C     MN  + C VW
Sbjct:  425 WQTCISNTDDALGFALGSLFVKATFDRQSKEIAEGMINEIRSAFEETLGDLVWMDEKTRLAAKEKADAIYDMIGFPDFILEPKELDDVYDGYEVSEDSFFQNMLNLYNFSAKVMADQLRKPPSRDQWSMTPQTVNAYYLPTKNEIVFPAGILQAPFYAHNHPKALNFGGIGVVMGHELTHAFDDQGREYDKEGNLRPWWQNESLTAFQNHTACMEEQYSQYQVNGERLNGLQTLGENIADNGGLKAAYNAYKAWLRKHGEEQPLPAVGLTNHQLFFVGFAQVWCSVRTPESSHEGLVTDPHSPARFRVLGTLSNSRDFLRHFGCPVGSPMNPGQLCEVW 763          
BLAST of Endothelin-converting enzyme 1 vs. UniProt/SwissProt
Match: sp|P0DPE2|EFCE2_BOVIN (EEF1AKMT4-ECE2 readthrough transcript protein OS=Bos taurus OX=9913 GN=EEF1AKMT4-ECE2 PE=1 SV=1)

HSP 1 Score: 260.766 bits (665), Expect = 2.811e-76
Identity = 134/339 (39.53%), Postives = 190/339 (56.05%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVR-EKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            W+ C+  T   L   +G++FVK+ F    K+  E MI  I+AAF++ + +  WMD  T  +A EK  AI   IG+PD ++    L   Y   E++  +   N +N   F+ +     + +  S D+W+M  Q VNAYY PT NEIVFPA IL+ PFY    P   N+GGIG+V+GHE+ H FD QG ++D +G LR WW   S   + + T CI  QY+ Y +N + L   QT+GE+IADN G++ +Y A  + L    E+  LP V L+  QLFFVG  + WCS+ T     E L  D HS  ++R+ G +SN  +F + F C     MN  + C VW
Sbjct:  545 WQTCISNTDDALGFALGSLFVKATFDRQSKEIAEGMISEIRAAFEEALGHLVWMDEKTRQAAKEKADAIYDMIGFPDFILEPKELDDVYDGYEVSEDSFFQNMLNLYNFSAKVMADQLRKPPSRDQWSMTPQTVNAYYLPTKNEIVFPAGILQAPFYTCNHPKALNFGGIGVVMGHELTHAFDDQGREYDKEGNLRPWWQNESLAAFRNHTACIEEQYSQYQVNGEKLNGRQTLGENIADNGGLKAAYNAYKAWLRKHGEEQQLPAVGLTNHQLFFVGFAQVWCSVRTPESSHEGLVTDPHSPARFRVLGTLSNSRDFLRHFGCPVGSPMNSGQLCEVW 883          
BLAST of Endothelin-converting enzyme 1 vs. TrEMBL
Match: A0A4C1TXN3 (Endothelin-converting enzyme homolog OS=Eumeta variegata OX=151549 GN=EVAR_14404_1 PE=4 SV=1)

HSP 1 Score: 290.812 bits (743), Expect = 2.178e-85
Identity = 142/345 (41.16%), Postives = 209/345 (60.58%), Query Frame = 1
Query:  382 KGKQEEWKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFA-ANSKLEVREKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            +G +E W+ CV  T++ +   VG MFV+  F    K   E+MID IK AFK  ++N  WMD  T  SA  K  AI   IG+PD ++++  L K+Y  +E+       N + + EF+ +  LK + + ++  +W M    VNAYY PT N+IVFPA IL+ PFYD   P   NYG +G+V+GHE+ H FD QG ++D  G L  WW   +  ++ ++TQCI  QY++Y I+ + L   QT+GE+IADN G++ S+ A  +     +  LTLPG++ +  QLFF+   + WCS +TK     +++ D H+V KYR+ GP++N+ EFS+ FNC    KMN +KKC VW
Sbjct:  405 EGTEESWRYCVTDTNNAIGFAVGAMFVREVFHGEAKTQGEIMIDNIKNAFKRNLKNLDWMDEETRKSAETKADAITDMIGFPDYILNKEELDKQYEELEVKENQYFENNIAYNEFSLKNDLKKLDQPVNKTKWGMTPSTVNAYYTPTKNQIVFPAGILQLPFYDGDNPKCVNYGAMGVVMGHELTHAFDDQGREYDRFGNLNHWWNNETIAKFKARTQCIQQQYSNYSIDGQRLNGKQTLGENIADNGGLKASFHAYLDYSRTSKVNLTLPGLEYNHRQLFFISFAQVWCSAMTKESTKMQIEKDDHTVAKYRVIGPIANLKEFSQEFNCPLGSKMNPIKKCEVW 749          
BLAST of Endothelin-converting enzyme 1 vs. TrEMBL
Match: A0A4S2K871 (F-box domain-containing protein OS=Temnothorax longispinosus OX=300112 GN=DBV15_09151 PE=4 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 4.479e-85
Identity = 131/346 (37.86%), Postives = 212/346 (61.27%), Query Frame = 1
Query:  379 LKGKQEEWKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLE-VREKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            ++G +E+W+ CV   ++ +   +G MFV+  FQ   K   E MI++I+ AF    +N  WMD+ T ++A EK  AI   IG+PD ++  + L ++Y  + +       N +   +++  + L+ + + ++   W M    VNAYY PT N++VFPA IL+ PFYD+  P + N+GG+G+V+GHE+ H FD QG ++D  G L  WW  ++ + + ++T+C + QY  Y +  + +   QT+GE+IADN G+R +Y A  S  +  +++L LPG++L+  QLFF+   + WCS +T   +  +++ D HS  KYR+ GP+SNMPEFS  FNC ++ KMN + KC VW
Sbjct:  917 MEGHEEQWRYCVNDVNNAMGFAIGAMFVREVFQGKSKPMAEEMINHIRKAFTKNFKNLNWMDAETRNAAEEKANAITDMIGFPDFILQASELDERYRDLSIKQNEYFQNTLRVNKYSFRKNLEKLDQVVNKTTWIMTPPAVNAYYTPTKNQMVFPAGILQSPFYDMKNPYSLNFGGVGVVMGHELTHAFDDQGREYDLHGNLHHWWNDATVERFKNRTECFVEQYNQYQVQGRNINGRQTLGENIADNGGLRAAYHAYLSMTKSYKDQLPLPGLNLTHRQLFFLNFAQIWCSSITSETVTLQIEKDTHSPPKYRVIGPLSNMPEFSTEFNCPKDSKMNPVHKCEVW 1262          

HSP 2 Score: 59.3066 bits (142), Expect = 4.479e-85
Identity = 34/108 (31.48%), Postives = 54/108 (50.00%), Query Frame = 2
Query:    2 RLAKALPSIADQSDPEKYTNKLSIRNMQQKFPSISWIRVINEVLENSDKKLKEDDKLVAFSLEYFDSLIKILKEYLGDSQKKQILQRDLEWAVISSLVPLGSDSLIEA 325
            RLA+      ++ D EK  N +S+ ++Q+K P +SW+          +KK+     +V F+ EYF +L K+++EY   +  K IL   L W  + SL    S    EA
Sbjct:  799 RLAEITIPPEERRDEEKMYNLMSLNDLQKKAPFMSWVEFFQNATRLVNKKINSKAMIVNFAPEYFGNLTKVVQEYNRTTSGKIILNNYLVWQTVRSLTAFLSKPFREA 906          
BLAST of Endothelin-converting enzyme 1 vs. TrEMBL
Match: A0A0C9RDQ3 (ECE1_5 protein OS=Fopius arisanus OX=64838 GN=ECE1_5 PE=4 SV=1)

HSP 1 Score: 279.256 bits (713), Expect = 4.859e-85
Identity = 131/345 (37.97%), Postives = 205/345 (59.42%), Query Frame = 1
Query:  382 KGKQEEWKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFA-ANSKLEVREKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            +G++E+W+ CV  T++ +   +G MFV+  F    K   E MI+ I+ AF   + N  WMD  T  +A EK  AI   IG+P+ +++   L ++Y  +++       N +   ++   + L+ + + ++   W M    VNAYY PT N+IVFPA IL+ PFYD+  P + N+GGIG+V+GHE+ H FD QG ++D  G L +WW  ++ D + ++T+C + QY    I  + +   QT+GE+IADN G++ +Y A  N++   +++L LPG+ L+  QLFF+   + WCS +T   I  ++  D H   KYR+ GP+SN+PEFS  FNC +  KMN   KC VW
Sbjct:   87 EGREEQWRYCVSDTNNVMGFAIGAMFVREVFHGKSKPKAEEMINEIRTAFVKNLRNLDWMDEETRKAAEEKANAITDMIGFPNFILNPNELDERYKDLQIRPNEYFLNNIRVSKYTLRKNLEKLDKPVNKTTWIMTPPTVNAYYTPTKNQIVFPAGILQNPFYDMENPSSLNFGGIGVVMGHELTHAFDDQGREYDLHGNLHKWWNNATIDRFKNRTECFVEQYGDIEIEGRHINGRQTLGENIADNGGLKAAYHAYLNTRKNSQDQLPLPGLQLTHRQLFFLNFAQVWCSAITPESIGLQIDKDSHCPPKYRVIGPLSNLPEFSAEFNCPKGSKMNPADKCEVW 431          
BLAST of Endothelin-converting enzyme 1 vs. TrEMBL
Match: E9HFF5 (Uncharacterized protein OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_300917 PE=4 SV=1)

HSP 1 Score: 286.189 bits (731), Expect = 5.728e-85
Identity = 140/344 (40.70%), Postives = 201/344 (58.43%), Query Frame = 1
Query:  385 GKQEEWKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVR-EKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            G +E W+ CV  T+S L   VG MFVK  F    K   E MI  +K AFK+  +N  WMD  T  +A +K  AI   IGYP  +++   L + Y  +++       N V   +FA  + L  + E ++   W M    VNAYY P  N+IVFPA IL+ PF+D   P   N+G +G+V+GHE+ H FD QG +FD  G L  WW  ++ + +  +T+C+I QY+SY IN +PL   QT+GE+IADN G++ ++ A ++    R E+L LPG++L+  QLFF+   + WCS  TK  +  ++  D HS  +YR+ GP+SNMPEFS +F C  +  MN   KC +W
Sbjct:  331 GNEETWRSCVTDTNSVLGFAVGAMFVKQNFHGESKPLAENMIAAVKEAFKNNFDNLDWMDDETRLAARDKADAITDMIGYPKFILNPEELDELYGDLKIESNEYFLNNVRSNQFALRQNLIKLNEPVNKTLWGMTPSMVNAYYTPNKNQIVFPAGILQQPFFDNSFPYALNFGAMGVVMGHELTHAFDDQGREFDRNGDLAPWWNNATIERFQKRTECLIQQYSSYTINGQPLNGKQTLGENIADNGGLKAAFHAFDNWSSTRDEELLLPGLNLTRNQLFFLAFAQVWCSSSTKEALHLQILNDPHSPARYRVIGPVSNMPEFSSVFKCQPDTPMNPKNKCEIW 674          
BLAST of Endothelin-converting enzyme 1 vs. TrEMBL
Match: A0A1I8PTA7 (Uncharacterized protein OS=Stomoxys calcitrans OX=35570 GN=106083574 PE=4 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 1.156e-84
Identity = 144/345 (41.74%), Postives = 205/345 (59.42%), Query Frame = 1
Query:  385 GKQEEWKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSY--FAANSKLEVREKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            G +E W+ CV  T + +   VG +FV+  F    K + E MI+ I+ AFK  I N TWMD  T   A++K  AI   IG+PD ++++  L KKYA + +T      N +    F  ++ L+ + + ++   W M    VNAYY P+ N+IVFPA IL+ PF+DI  P + N+G +G+V+GHE+ H FD QG +FD  G +  WW   S D +  KT+CI  QY SY IN + L   QT+GE+IADN G++ +Y  F   S  +  + L LPG++L+ +QLFFV   R WCS  T+  I  +L+ D HS  + R+ G +SNMPEF+++F C    KMN  KKC VW
Sbjct:  440 GGEEVWRFCVADTGNVVGFAVGAIFVRQAFHGESKPEAEQMINEIREAFKVSIHNLTWMDKRTRERAIDKANAISDMIGFPDYILNQEELDKKYADLNVTANAYFENNIQSNIFNLKKNLEKLDQPVNKTNWGMVPHMVNAYYTPSKNQIVFPAGILQSPFFDIHHPKSLNFGAMGVVMGHELTHAFDDQGREFDKFGNINRWWDNKSIDRFNEKTECIEKQYGSYAINGRHLNGKQTLGENIADNGGLKAAYHAFLKTSMGKEADVLKLPGLNLTHKQLFFVSFARVWCSSDTEETIILQLEKDTHSPSRLRVIGTLSNMPEFAEVFQCKPGSKMNPEKKCAVW 784          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Cavefish
Match: ece2b (endothelin-converting enzyme 2 [Source:NCBI gene;Acc:103045399])

HSP 1 Score: 279.256 bits (713), Expect = 5.097e-85
Identity = 138/339 (40.71%), Postives = 198/339 (58.41%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVR-EKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            W+ C+  T  TL   +G +FV + F    K+  E MI+ I+ AF+D +++  WMD  T  +A EK   I   IGYPD ++    L   Y   +++  N   N +NF  F+       + +  + D+W+M    VNAYY PT N IVFPA IL+ PFY    P   N+GGIG+V+GHE+ H FD QG ++D  G LR WW  SS D + ++T+C+++QY  Y IN + +   QT+GE+IADN G++ +Y A  S ++   E+ +LP V+L+ +QLFFVG  + WCS+ T     E L  D HS  KYR+ G +SN P+FS+ FNC     MN   +C VW
Sbjct:  427 WQTCIGNTDDTLGFALGALFVNATFDKHSKEIAEGMINEIRTAFQDALDHLNWMDDQTRKAAKEKADDIYDMIGYPDFILDPKELDDVYDGYDVSEDNFFQNMLNFYNFSARVMADQLRKPPNKDQWSMTPPTVNAYYMPTKNGIVFPAGILQAPFYARDHPKALNFGGIGVVMGHELTHAFDDQGREYDKTGNLRPWWQNSSVDAFKNRTECMVDQYTQYTINGEHINGKQTLGENIADNGGLKAAYHAYRSWVKTNGEEKSLPAVNLTNDQLFFVGFAQVWCSVRTPESAHEGLMTDPHSPPKYRVIGTLSNSPDFSQHFNCPLGSPMNSGHRCEVW 765          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Cavefish
Match: ece2b (endothelin-converting enzyme 2 [Source:NCBI gene;Acc:103045399])

HSP 1 Score: 279.256 bits (713), Expect = 5.330e-85
Identity = 138/339 (40.71%), Postives = 198/339 (58.41%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVR-EKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            W+ C+  T  TL   +G +FV + F    K+  E MI+ I+ AF+D +++  WMD  T  +A EK   I   IGYPD ++    L   Y   +++  N   N +NF  F+       + +  + D+W+M    VNAYY PT N IVFPA IL+ PFY    P   N+GGIG+V+GHE+ H FD QG ++D  G LR WW  SS D + ++T+C+++QY  Y IN + +   QT+GE+IADN G++ +Y A  S ++   E+ +LP V+L+ +QLFFVG  + WCS+ T     E L  D HS  KYR+ G +SN P+FS+ FNC     MN   +C VW
Sbjct:  425 WQTCIGNTDDTLGFALGALFVNATFDKHSKEIAEGMINEIRTAFQDALDHLNWMDDQTRKAAKEKADDIYDMIGYPDFILDPKELDDVYDGYDVSEDNFFQNMLNFYNFSARVMADQLRKPPNKDQWSMTPPTVNAYYMPTKNGIVFPAGILQAPFYARDHPKALNFGGIGVVMGHELTHAFDDQGREYDKTGNLRPWWQNSSVDAFKNRTECMVDQYTQYTINGEHINGKQTLGENIADNGGLKAAYHAYRSWVKTNGEEKSLPAVNLTNDQLFFVGFAQVWCSVRTPESAHEGLMTDPHSPPKYRVIGTLSNSPDFSQHFNCPLGSPMNSGHRCEVW 763          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Cavefish
Match: ece2b (endothelin-converting enzyme 2 [Source:NCBI gene;Acc:103045399])

HSP 1 Score: 279.256 bits (713), Expect = 8.020e-85
Identity = 138/339 (40.71%), Postives = 198/339 (58.41%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVR-EKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            W+ C+  T  TL   +G +FV + F    K+  E MI+ I+ AF+D +++  WMD  T  +A EK   I   IGYPD ++    L   Y   +++  N   N +NF  F+       + +  + D+W+M    VNAYY PT N IVFPA IL+ PFY    P   N+GGIG+V+GHE+ H FD QG ++D  G LR WW  SS D + ++T+C+++QY  Y IN + +   QT+GE+IADN G++ +Y A  S ++   E+ +LP V+L+ +QLFFVG  + WCS+ T     E L  D HS  KYR+ G +SN P+FS+ FNC     MN   +C VW
Sbjct:  448 WQTCIGNTDDTLGFALGALFVNATFDKHSKEIAEGMINEIRTAFQDALDHLNWMDDQTRKAAKEKADDIYDMIGYPDFILDPKELDDVYDGYDVSEDNFFQNMLNFYNFSARVMADQLRKPPNKDQWSMTPPTVNAYYMPTKNGIVFPAGILQAPFYARDHPKALNFGGIGVVMGHELTHAFDDQGREYDKTGNLRPWWQNSSVDAFKNRTECMVDQYTQYTINGEHINGKQTLGENIADNGGLKAAYHAYRSWVKTNGEEKSLPAVNLTNDQLFFVGFAQVWCSVRTPESAHEGLMTDPHSPPKYRVIGTLSNSPDFSQHFNCPLGSPMNSGHRCEVW 786          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Cavefish
Match: MME (membrane metalloendopeptidase [Source:HGNC Symbol;Acc:HGNC:7154])

HSP 1 Score: 268.855 bits (686), Expect = 1.425e-81
Identity = 135/342 (39.47%), Postives = 206/342 (60.23%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASY---VINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVREK-LTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            W++C    ++ ++  VG ++V   F    K   ++MI  I+  F   + + TWMD +T+ +A EK +AIR +IG+ ++++++TYL ++Y  +  +      N +   EF +++ LK +  K++ +EW  G+  VNA+Y+ + N+IVFPA IL+ PF+  G P + NYGGIGMVIGHEI HGFD  G  FD  G L++WWT SS  ++   ++CI++QY+S+   + N + L    T+GE+IADN GIR SY A  + ++   K   LPG+DL+ EQLFF+   + WC           +K DVHS  K+R+ G + N PEF+K F C RN  M   K C VW
Sbjct:  359 WRQCAIYVNNNMENAVGRLYVDEAFAGDSK---DMMIVNIREVFVSNLNDLTWMDLDTSKAAEEKARAIRERIGFSENIMNDTYLDEEYKELSYSSDEYFENILKNLEFGQKKRLKRLRVKVNKEEWISGAAVVNAFYSSSRNQIVFPAGILQPPFFGKGQPWSLNYGGIGMVIGHEITHGFDDNGRNFDKDGDLKDWWTPSSTQKFQELSKCIVDQYSSFSWDLANGQNLNGNNTLGENIADNGGIRQSYQAYQNYVKKHGKEAPLPGLDLNHEQLFFLNFAQIWCGTHRPEHAVNSIKTDVHSPGKFRVLGSLQNFPEFAKAFQCQRNDYMVPEKTCRVW 697          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Cavefish
Match: ece2b (endothelin-converting enzyme 2 [Source:NCBI gene;Acc:103045399])

HSP 1 Score: 261.151 bits (666), Expect = 1.720e-78
Identity = 129/309 (41.75%), Postives = 183/309 (59.22%), Query Frame = 1
Query:  490 KDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVR-EKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            K  E MI+ I+ AF+D +++  WMD  T  +A EK   I   IGYPD ++    L   Y   +++  N   N +NF  F+       + +  + D+W+M    VNAYY PT N IVFPA IL+ PFY    P   N+GGIG+V+GHE+ H FD QG ++D  G LR WW  SS D + ++T+C+++QY  Y IN + +   QT+GE+IADN G++ +Y A  S ++   E+ +LP V+L+ +QLFFVG  + WCS+ T     E L  D HS  KYR+ G +SN P+FS+ FNC     MN   +C VW
Sbjct:  420 KKAEGMINEIRTAFQDALDHLNWMDDQTRKAAKEKADDIYDMIGYPDFILDPKELDDVYDGYDVSEDNFFQNMLNFYNFSARVMADQLRKPPNKDQWSMTPPTVNAYYMPTKNGIVFPAGILQAPFYARDHPKALNFGGIGVVMGHELTHAFDDQGREYDKTGNLRPWWQNSSVDAFKNRTECMVDQYTQYTINGEHINGKQTLGENIADNGGLKAAYHAYRSWVKTNGEEKSLPAVNLTNDQLFFVGFAQVWCSVRTPESAHEGLMTDPHSPPKYRVIGTLSNSPDFSQHFNCPLGSPMNSGHRCEVW 728          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Sea Lamprey
Match: mmel1 (membrane metallo-endopeptidase-like 1 [Source:ZFIN;Acc:ZDB-GENE-101112-2])

HSP 1 Score: 244.202 bits (622), Expect = 5.825e-73
Identity = 122/353 (34.56%), Postives = 196/353 (55.52%), Query Frame = 1
Query:  373 YLLKGKQEEWKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLI--SETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASY---VINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVR-EKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            Y     +  W+ C    ++ L   VG ++V+  F    KK ++ ++ +I+  F   ++  TWMD  T   A +K  AI  +IGYP+ ++  ++  + ++YA +  +      N +    F  +  L  +   +  +EW  G+  VNA+Y+ + N+IVFPA IL+ PF+ +   ++ N+GGIGMVIGHEI+HGFD  G  FD  G L +WW+  S   +  K+QCII+QY ++   +   + L  + T+GE+IADN GIR +Y A  + ++   E+L LPG+ LS +QLFF+   + WC      +    +K DVHS  K+R+ G + N  +FS+ + C  +  MN   KC VW
Sbjct:  355 YGTTSDKARWRSCSSYVNNILSNAVGALYVEEAFAGDSKKVVQELVKWIREVFISNLDKITWMDDATKGRARDKAFAIVERIGYPEFIVDKNDPKIDEEYADLAYSTTEYFANTLASLAFDSKRRLARINTAVDKNEWISGAAVVNAFYSSSYNQIVFPAGILQPPFFGLDQAMSLNFGGIGMVIGHEIIHGFDDSGRNFDKDGNLVDWWSAESAKNFKQKSQCIIDQYGNFQWDLAGGQNLSGINTLGENIADNGGIRQAYEAYMAWVKDNGEELPLPGLHLSHQQLFFLNFAQVWCGDYRPEYASNSIKTDVHSPGKFRVIGSLQNFEKFSEAYQCKASDAMNPRSKCHVW 707          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Sea Lamprey
Match: ecel1 (endothelin converting enzyme-like 1 [Source:ZFIN;Acc:ZDB-GENE-130530-692])

HSP 1 Score: 217.624 bits (553), Expect = 1.392e-64
Identity = 117/341 (34.31%), Postives = 183/341 (53.67%), Query Frame = 1
Query:  409 CVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVRE---KLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKY---RINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            C+   +     ++G +FV+  F    K+ ++ M++ IK AF   +E   WMD  T  +A  K + +   IGYP+ L     + K+Y   E+  K+   N +N  EF     +  + +K+  + W +  Q +NAYY PT N++VFPA IL+   YD   P + NYGGIG +IGHE+ HG+D  G ++D  G L++WWT  S  ++L +T+C++  Y ++ IN + +    T+GE+IAD  G++++Y A      VRE   +  L G+  + EQLFFV   + WC       +  +L  D HS   Y   R+ G  S   EF ++F+C R   M+   KC VW
Sbjct:  182 CLAQANKYFGMVLGALFVREHFSLHSKQRVQQMVEDIKHAFDQRLEELGWMDEKTKDAARGKFQLMMDMIGYPEFLGRMDEVDKEYG-FEVNEKSYFKNILNSIEFNINVSIHKIHQKVERNVWLLPPQTLNAYYLPTHNQMVFPAGILQPTLYDPEFPQSMNYGGIGTIIGHELTHGYDDWGGQYDRHGNLKQWWTAESYGKFLERTECVVKLYNNFTINKQNVNGKLTLGENIADMGGLKLAYHAYQKW--VRENGPEPPLQGMAYTHEQLFFVAFAQNWCMKRRPQSLYLQLLTDKHSPENYSRRRVLGSASQFDEFGRVFHCRRGSPMSPQHKCSVW 519          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004622.1 (pep scaffold:Pmarinus_7.0:GL480748:697:25272:-1 gene:ENSPMAG00000004207.1 transcript:ENSPMAT00000004622.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 186.422 bits (472), Expect = 8.083e-54
Identity = 104/329 (31.61%), Postives = 179/329 (54.41%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNA-YYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQ-GSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFA-ANSKLEVREKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSF---IDERLKGDVHSVWKYRINGPMSNMPEFSKLFNC 1368
            W+ C+ +   +L   +G +F   +    +K+D++ MID +K AFKD +++  WMD+ T  +A EK K I+  +G  D +   + +   Y   ++         VNF  +     ++++    +  +W   +Q V+A YY  + N +  PA I++ PFY    P+   Y GIG VIGHE+ HGFD + GS+++ +G    WW  ++ +E+  +T C+  QY++Y    +P+   QT+GE+IADN G+  +  A A  + +  ++  LP ++L+ +Q FFV   + WCS+  +S    I++ L  D HS    R+ G +SN P F++ F C
Sbjct:   93 WEFCMDLADKSLAYALGEIFAMKEITAKRKEDVKKMIDNLKHAFKDNLDHLPWMDNKTRLAAKEKAKNIQSAVGEDDYMEDVSNVDMFYENFKVVEGRFFETMVNFYNYTSRRTIRSM--LATSMQWRAPAQTVDAFYYYESLNTMYIPAGIMQEPFYQDVYPMFLKYAGIGTVIGHELCHGFDNKAGSEYNVEGKQENWWENTTHNEFKLRTHCMEVQYSNYTWKERPINGTQTLGENIADNGGLHTALLAYARWEEQHGKEEPLPYLNLTNKQAFFVWFAQLWCSMEKESVEVEIEDAL-SDSHSPAAVRVRGMVSNSPAFAEAFTC 418          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Sea Lamprey
Match: mmel1 (membrane metallo-endopeptidase-like 1 [Source:ZFIN;Acc:ZDB-GENE-101112-2])

HSP 1 Score: 182.57 bits (462), Expect = 3.133e-51
Identity = 89/227 (39.21%), Postives = 140/227 (61.67%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLI--SETYLTKKYAPI----EMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASY 1062
            W+ CV   ++ L   VG ++V   F    K  +E+MI+ ++ AF   ++  TWMD  T + A EK  AI  ++GY D ++  +   L ++YA +    ++ F+N L +     EFA +  LK +    S  EW +G   +NA+Y+P+ N+IVFPA IL+ PF+ +G  ++ N+GGIGMVIGHEI HGFD  G KFD +G L +WWT  S +++ S+++C+++QY+SY
Sbjct:  340 WRHCVDYVNTALPSAVGALYVLDAFPRHGKTKVEMMIERLREAFIHTLDEMTWMDDRTRARAREKALAITTQMGYADYIVDGNNPRLDEEYADLNYEEDVHFENTLQDL----EFAVKNELKRLRRTTSKQEWDIGPATINAFYHPSKNQIVFPAGILQPPFFGLGQAMSLNFGGIGMVIGHEITHGFDNFGRKFDKEGNLVDWWTAESDEDFDSRSRCLVSQYSSY 562          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Sea Lamprey
Match: mmel1 (membrane metallo-endopeptidase-like 1 [Source:ZFIN;Acc:ZDB-GENE-101112-2])

HSP 1 Score: 182.57 bits (462), Expect = 3.631e-51
Identity = 89/227 (39.21%), Postives = 140/227 (61.67%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLI--SETYLTKKYAPI----EMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASY 1062
            W+ CV   ++ L   VG ++V   F    K  +E+MI+ ++ AF   ++  TWMD  T + A EK  AI  ++GY D ++  +   L ++YA +    ++ F+N L +     EFA +  LK +    S  EW +G   +NA+Y+P+ N+IVFPA IL+ PF+ +G  ++ N+GGIGMVIGHEI HGFD  G KFD +G L +WWT  S +++ S+++C+++QY+SY
Sbjct:  345 WRHCVDYVNTALPSAVGALYVLDAFPRHGKTKVEMMIERLREAFIHTLDEMTWMDDRTRARAREKALAITTQMGYADYIVDGNNPRLDEEYADLNYEEDVHFENTLQDL----EFAVKNELKRLRRTTSKQEWDIGPATINAFYHPSKNQIVFPAGILQPPFFGLGQAMSLNFGGIGMVIGHEITHGFDNFGRKFDKEGNLVDWWTAESDEDFDSRSRCLVSQYSSY 567          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Nematostella
Match: EDO37487 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFL4])

HSP 1 Score: 256.914 bits (655), Expect = 2.418e-80
Identity = 137/343 (39.94%), Postives = 196/343 (57.14%), Query Frame = 1
Query:  394 EEWKKCV-QITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKN-LLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANS-KLEVREKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            + W++C+ ++  + L+  +G +FV   F    +  IE M  YI+ +F D +++  WMD  T   A EK  AI   IGYPD +     L  K     +TF + L  N ++  +F  +  L  + + ++ ++W +G  +VN YYN   N IVF A IL+ PF++   P   NYGG+GMVIGHEI HGFD  G  FD  G L  WW+  +   + SKTQC+++QY +Y    K L   QT+ E+IADN GI+M+Y    +   E   +  LPG+ LS +QLF+VG  R WCSI T+     ++  D HS  KYR+ GP+ N P FS++F C +N KMN  KKC VW
Sbjct:   85 KRWEQCLLKMQQTALRMPLGLLFVDKAFPKESRASIEDMSKYIRNSFIDSVDSLPWMDGATKEKAKEKAIAIHESIGYPDYIKDPAKLEAKIQ--NLTFGDRLFENTLSLIKFTVQTDLAQLKKPVNREKWELGPSQVNGYYNSRQNRIVFLAGILQPPFFNPLYPKYLNYGGLGMVIGHEITHGFDGSGRMFDKDGNLNNWWSSEASMNFNSKTQCLVHQYNTYSAFGKNLNGSQTLNENIADNGGIKMAYEGYKAWARENSAEGALPGLGLSVDQLFYVGFARPWCSIYTEQTAILQINTDSHSYPKYRVIGPLQNDPLFSEVFKCKKNSKMNPAKKCAVW 425          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Nematostella
Match: EDO31998 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWD9])

HSP 1 Score: 251.136 bits (640), Expect = 2.660e-79
Identity = 141/356 (39.61%), Postives = 194/356 (54.49%), Query Frame = 1
Query:  382 KGKQEEWKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTF-------KNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLE----VREKLTLPGVD-LSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            +G+   W+ C    S T    +G +FV   F+   K   E MI  I+  F D ++N  WMD  T   A EK +AIR  IGYPD + ++T L  +Y+ + + +       +NLL   VNF+                   W+M    VNAYY+ T N+IVFPA IL+ PFY+   P + NYGGIGMV+GHEI HGFD  G KF+  G L  WWT +S + +  KT C++ QY+SY  + K L  LQT+GE+IADN GI+ S F A  K +    V E+  LPG++ LS +QLFF+   + WCS          ++  VHS  K R+ G +SN  EF++ + C    +MN   KC VW
Sbjct:    5 RGEDPRWQDCTSGVSGTFGMAIGLLFVDQTFKKESKTSAERMIKDIRNVFIDNLQNLNWMDEKTRKVAKEKAEAIRENIGYPDFIKNKTALELEYSGVRVVYTYFRQHSENLLSVIVNFR-------------------WSMNPPTVNAYYSSTDNKIVFPAGILQDPFYEGDHPNSLNYGGIGMVVGHEITHGFDDNGRKFNKDGNLLTWWTNNSIEAFKKKTDCLVKQYSSYEFHGKKLNGLQTLGENIADNGGIKQS-FQAYQKWKKDNNVEEEKRLPGLEKLSHDQLFFLSFAQIWCSAYRPEAAIRAIENGVHSPGKLRVIGSLSNSNEFAEAWKCPVGSRMNPKDKCAVW 340          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Nematostella
Match: EDO35107 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMH5])

HSP 1 Score: 259.225 bits (661), Expect = 1.209e-78
Identity = 138/349 (39.54%), Postives = 197/349 (56.45%), Query Frame = 1
Query:  382 KGKQEEWKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLE----VREKLTLPGVD-LSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            +G+   W+ C    S T    +G +FV   F+   K   E MI  I+  F D ++N  WMD  T   A EK +AIR  IGYPD + ++T L  +Y+ + +       N    ++F  ++ +  +G+ +   +W+M    VNAYY+ T N+IVFPA IL+ PFY+   P + NYGGIGMV+GHEI HGFD  G KF+  G L  WWT +S + +  KT C++ QY+SY  + K L  LQT+GE+IADN GI+ S F A  K +    V E+  LPG++ LS +QLFF+   + WCS          ++  VHS  K R+ G +SN  EF++ + C    +MN   KC VW
Sbjct:  325 RGEDPRWQDCTSGVSGTFGMAIGLLFVDQTFKKESKTSAERMIKDIRNVFIDNLQNLNWMDEKTRKVAKEKAEAIRENIGYPDFIKNKTALELEYSGVRVDKTKYFWNQYERRKFYNQKNIDELGKPVDKTKWSMNPPTVNAYYSSTDNKIVFPAGILQDPFYEGDHPNSLNYGGIGMVVGHEITHGFDDNGRKFNKDGNLLTWWTNNSIEAFKKKTDCLVKQYSSYEFHGKKLNGLQTLGENIADNGGIKQS-FQAYQKWKKDNNVEEEKRLPGLEKLSHDQLFFLSFAQIWCSAYRPEAAIRAIENGVHSPGKLRVIGSLSNSNEFAEAWKCPVGSRMNPKDKCAVW 672          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Nematostella
Match: EDO41501 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4D9])

HSP 1 Score: 238.81 bits (608), Expect = 1.218e-70
Identity = 120/340 (35.29%), Postives = 192/340 (56.47%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSAL-EKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVREKL-TLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            WK CV  T + L    G+++VK       K+  + +I  IK AF   +   TWMD  T + A  EK++++   IGYPD ++    L   Y  + +T +    N++N + F  ++ ++  G+ +   EW M   +VNAYY+  +N I FP+ IL+ PF+D   P   NYG +GMV+GHE+ HGFD++G  FD  G L  WW   S + +     C++ QY+++ + +  +   QT+ E+IADN G+R+++ A     +  EK   LPG++LS +QLFF+G  + WCS  TK+ +   L  D HS  + R++  +SN  +F++ ++C  +  MN  KKC VW
Sbjct:  371 WKSCVTKTDTVLGYATGHLYVKQHDGKDVKEKAKQVIQSIKEAFISNLPTVTWMDEGTKTKARGEKMESVLDLIGYPDWIMDVAQLNAYYVNLVITPEMSFENHLNARRFVHQQTMEKRGKAVDRKEWHMTPVDVNAYYSLPNNYIAFPSGILQRPFFDPEFPQAMNYGAVGMVMGHELTHGFDSKGRLFDKNGNLESWWKNQSVEAFEEHVSCMVEQYSNFTVADVKVDGKQTLDENIADNGGLRLAFQAHRQWDKENEKQPRLPGLELSRDQLFFLGFAQLWCSSSTKNSMHHPLLTDSHSPDRIRVHAAVSNSEQFAEAYDCPLDTPMNPAKKCRVW 710          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Nematostella
Match: EDO41736 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3J6])

HSP 1 Score: 230.335 bits (586), Expect = 9.621e-68
Identity = 128/353 (36.26%), Postives = 193/353 (54.67%), Query Frame = 1
Query:  382 KGKQEEWKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLT---KKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFP-FYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLL--REWWTKSSRDEYLSKTQCIINQYASYVINNK-PLPSLQTVGEDIADNAGIRMSYFAANSKLEVR--EKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            KG ++ WK CV  T+  + +++G  +++  F    K     MI  ++ AFKD + +  WMD  T  +  EK  +++ ++GYP  L          KKY  + M    L  N +   + A +  LK + + +  +EW M  Q +NA Y+   NE++ PAAIL+ P FY  G P + ++G IG ++GHE+ HGFD  G KF+  G L    WW+  S   +  K +CI NQY+ Y ++ K PL    T+GE+IADN G + SY A ++ L+ +  E  +LPG++L+ EQLF+VG G+ +CS    +        D HS  K+R+ G +SN  EFSK F C     MN + KC VW
Sbjct:  328 KGHKKRWKTCVMYTNELVGDVLGAAYIQHHFDQHSKNIARDMIKEVRQAFKDNVNSIPWMDKTTKIAVSEKADSMKDEVGYPAYLKGGKKFIKRFKKYKGVTMKNNALFANRIAILKMAHKRMLKKLRKPVDKEEWPMDPQTINAMYSFNENEMIIPAAILQPPFFYPKGSPSSLSFGAIGSILGHEMTHGFDNTGRKFNKNGELTTSNWWSDGSLKGFDEKAKCIENQYSQYKVDGKYPLNGKLTLGENIADNGGFKSSYRAYHNWLKKKGDETWSLPGLNLTSEQLFYVGFGQAYCSNSRSTEQYLATLSDRHSEEKFRVIGTLSNSYEFSKAFGCRPEAPMNPVTKCSVW 680          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Medaka
Match: ece2b (endothelin-converting enzyme 2 [Source:NCBI gene;Acc:101164289])

HSP 1 Score: 267.7 bits (683), Expect = 1.260e-80
Identity = 132/339 (38.94%), Postives = 197/339 (58.11%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVR-EKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            W+ C+  T  TL   +G +FVK+ F    K+  E MI+ I++AFK  ++  +WMD  T  +A EK  +I   IG+P+ ++    L   Y   E++  +   N +NF  F+       + +  + D+W+M    VNAYY PT N IVFPA IL+ PFY    P   N+GGIG+V+GHE+ H FD QG ++D +G LR WW  SS + +  +T+C++ QY  Y +N + +   QT+GE+IADN G++ +Y A  S ++   ++  LP V+L+ +QLFFVG  + WCS+ T     E L  D HS  +YR+ G ++N P+FS+ F C     MN  K C VW
Sbjct:  425 WQTCIGNTDDTLGFALGALFVKATFDKLSKEIAEEMINEIRSAFKQALDRLSWMDEQTRKAAKEKADSIYDMIGFPEFILDPKELDDVYDGYEVSDDSFFQNMLNFYNFSARVMADQLRKTPNKDQWSMTPPTVNAYYMPTKNGIVFPAGILQAPFYAHDHPKALNFGGIGVVMGHELTHAFDDQGREYDKEGNLRPWWQNSSVEAFRVRTECMMEQYNRYTVNGEHVNGKQTLGENIADNGGLKAAYHAYQSWIQRNGQEKRLPAVNLTNDQLFFVGFAQVWCSVRTPESAHEGLMTDPHSPPRYRVIGTLANSPDFSRHFGCPEGTPMNSGKPCEVW 763          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Medaka
Match: ece2b (endothelin-converting enzyme 2 [Source:NCBI gene;Acc:101164289])

HSP 1 Score: 266.544 bits (680), Expect = 6.048e-80
Identity = 132/339 (38.94%), Postives = 197/339 (58.11%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVR-EKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            W+ C+  T  TL   +G +FVK+ F    K+  E MI+ I++AFK  ++  +WMD  T  +A EK  +I   IG+P+ ++    L   Y   E++  +   N +NF  F+       + +  + D+W+M    VNAYY PT N IVFPA IL+ PFY    P   N+GGIG+V+GHE+ H FD QG ++D +G LR WW  SS + +  +T+C++ QY  Y +N + +   QT+GE+IADN G++ +Y A  S ++   ++  LP V+L+ +QLFFVG  + WCS+ T     E L  D HS  +YR+ G ++N P+FS+ F C     MN  K C VW
Sbjct:  451 WQTCIGNTDDTLGFALGALFVKATFDKLSKEIAEEMINEIRSAFKQALDRLSWMDEQTRKAAKEKADSIYDMIGFPEFILDPKELDDVYDGYEVSDDSFFQNMLNFYNFSARVMADQLRKTPNKDQWSMTPPTVNAYYMPTKNGIVFPAGILQAPFYAHDHPKALNFGGIGVVMGHELTHAFDDQGREYDKEGNLRPWWQNSSVEAFRVRTECMMEQYNRYTVNGEHVNGKQTLGENIADNGGLKAAYHAYQSWIQRNGQEKRLPAVNLTNDQLFFVGFAQVWCSVRTPESAHEGLMTDPHSPPRYRVIGTLANSPDFSRHFGCPEGTPMNSGKPCEVW 789          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Medaka
Match: MME (membrane metalloendopeptidase [Source:NCBI gene;Acc:101170860])

HSP 1 Score: 262.307 bits (669), Expect = 1.325e-79
Identity = 132/346 (38.15%), Postives = 206/346 (59.54%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPI----EMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASY---VINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVR-EKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            W++C    ++ +   VG ++V+  F    K   ELMI  I+  F   +++ +WMD+ T  +A EK +AIR +IGY D+++ + +L  +Y  +    E  F+N+L N     E+ +++ L+ +  K++ DEW  G+  VNA+Y+ + N+IVFPA IL+ PF+  G   + NYGGIGMVIGHEI HGFD  G  +D  G L++WWT  S   +L ++ CI++QY+++   + N   L    T+GE+IADN GIR +Y A  + ++   E+  LPG+DLS +QLFF+   + WC           +K DVHS  K+R+ G + N PEF+K F+C+++  M     C VW
Sbjct:  305 WRQCALYVNNNMDNAVGRLYVQEAFSEKSK---ELMIKDIREVFISNMDDLSWMDAETKKAAEEKARAIRERIGYSDTIMDDEHLNNEYKDLSYNAEKYFENILQNL----EYVQKKRLRKLRVKVNKDEWVTGAAVVNAFYSASKNQIVFPAGILQPPFFSKGQAKSLNYGGIGMVIGHEITHGFDDNGRNYDKDGDLKDWWTPDSTRRFLEQSNCIVDQYSNFSWELANGLHLNGNNTLGENIADNGGIRQAYQAYRNHVKDHGEEPPLPGIDLSHDQLFFLNFAQVWCGTHRPEQAVNSIKVDVHSPGKFRVLGSLQNFPEFAKAFSCNKSSYMIPDNVCRVW 643          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Medaka
Match: MME (membrane metalloendopeptidase [Source:NCBI gene;Acc:101170860])

HSP 1 Score: 263.462 bits (672), Expect = 5.608e-79
Identity = 131/346 (37.86%), Postives = 207/346 (59.83%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPI----EMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASY---VINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVR-EKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            W++C    ++ +   VG ++V+  F    K+ +E MI  I+  F   +++ +WMD+ T  +A EK +AIR +IGY D+++ + +L  +Y  +    E  F+N+L N     E+ +++ L+ +  K++ DEW  G+  VNA+Y+ + N+IVFPA IL+ PF+  G   + NYGGIGMVIGHEI HGFD  G  +D  G L++WWT  S   +L ++ CI++QY+++   + N   L    T+GE+IADN GIR +Y A  + ++   E+  LPG+DLS +QLFF+   + WC           +K DVHS  K+R+ G + N PEF+K F+C+++  M     C VW
Sbjct:  428 WRQCALYVNNNMDNAVGRLYVQEAFSEKSKELMEEMIKDIREVFISNMDDLSWMDAETKKAAEEKARAIRERIGYSDTIMDDEHLNNEYKDLSYNAEKYFENILQNL----EYVQKKRLRKLRVKVNKDEWVTGAAVVNAFYSASKNQIVFPAGILQPPFFSKGQAKSLNYGGIGMVIGHEITHGFDDNGRNYDKDGDLKDWWTPDSTRRFLEQSNCIVDQYSNFSWELANGLHLNGNNTLGENIADNGGIRQAYQAYRNHVKDHGEEPPLPGIDLSHDQLFFLNFAQVWCGTHRPEQAVNSIKVDVHSPGKFRVLGSLQNFPEFAKAFSCNKSSYMIPDNVCRVW 769          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Medaka
Match: ece1 (endothelin converting enzyme 1 [Source:NCBI gene;Acc:101158602])

HSP 1 Score: 255.373 bits (651), Expect = 4.648e-76
Identity = 139/343 (40.52%), Postives = 198/343 (57.73%), Query Frame = 1
Query:  400 WKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMT----FKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFA-ANSKLEVREKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            WK CV  T S L   +G MFVK  F    K   E M+  IK AF+D +++ +WMD+ T  +A EK  AI + +GYP+ +++ T L K +   E+     F+N++  Y NF      + L+    +   ++W+M    VNAYYNPT NE+V PA IL+ PFY    P   N+GGIG+V+GHE+ H FD QG ++D  G LR WW  SS + +  + QC++ QY +Y IN +PL    T+GE+IADN G++ +Y A  N   +  E+  LP + ++  QLFFVG  + WCS+ T     E +  D HS  ++R+ G +SN  EFSK F C  N  MN   KC +W
Sbjct:  415 WKLCVSDTDSALGFALGAMFVKDTFAEDSKDIAEEMVGEIKWAFEDSLKDVSWMDAETKKAAKEKADAIYNMVGYPEFIMNATKLDKVFNDFEVVSELYFQNVM-QYYNFSARVTADQLRKAPNR---NQWSMTPPTVNAYYNPTKNEMVLPAGILQAPFYSRSWPKALNFGGIGVVMGHELTHAFDDQGREYDKDGNLRPWWKNSSVEAFKRQAQCMVEQYGNYSINQEPLNGKHTLGENIADNGGLKAAYKAYVNWIQKNGEEPMLPALGMTNHQLFFVGFAQVWCSVRTPESSHEGVITDPHSPSRFRVIGTISNSREFSKHFGCRANAPMNPKHKCELW 753          
BLAST of Endothelin-converting enzyme 1 vs. Planmine SMEST
Match: SMESG000003235.1 (SMESG000003235.1)

HSP 1 Score: 715.687 bits (1846), Expect = 0.000e+0
Identity = 339/350 (96.86%), Postives = 344/350 (98.29%), Query Frame = 1
Query:  364 AHNYLLKGKQEEWKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVREKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            +  + +KGKQEEWKKCVQITSSTLQEIVGNMFVKSQFQPS+KKDIELMIDYIKAA KDVIEN TWMDSNT SSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNY+NFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVREKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW
Sbjct:  341 SEGFGIKGKQEEWKKCVQITSSTLQEIVGNMFVKSQFQPSQKKDIELMIDYIKAALKDVIENLTWMDSNTKSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYINFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVREKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 690          

HSP 2 Score: 236.113 bits (601), Expect = 0.000e+0
Identity = 117/118 (99.15%), Postives = 118/118 (100.00%), Query Frame = 2
Query:    2 RLAKALPSIADQSDPEKYTNKLSIRNMQQKFPSISWIRVINEVLENSDKKLKEDDKLVAFSLEYFDSLIKILKEYLGDSQKKQILQRDLEWAVISSLVPLGSDSLIEANEEFMSEGFG 355
            RLAKALPSIADQSDPEKYTNKLSIRNMQQKFPSISWIRVINEVLENSDKKLKEDDKLVAFSLEYFDSLIKILKEYLGDSQKKQILQRDLEWAVISSLVPLGSD+LIEANEEFMSEGFG
Sbjct:  228 RLAKALPSIADQSDPEKYTNKLSIRNMQQKFPSISWIRVINEVLENSDKKLKEDDKLVAFSLEYFDSLIKILKEYLGDSQKKQILQRDLEWAVISSLVPLGSDALIEANEEFMSEGFG 345          
BLAST of Endothelin-converting enzyme 1 vs. Planmine SMEST
Match: SMESG000003230.1 (SMESG000003230.1)

HSP 1 Score: 656.751 bits (1693), Expect = 0.000e+0
Identity = 309/345 (89.57%), Postives = 327/345 (94.78%), Query Frame = 1
Query:  379 LKGKQEEWKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVREKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            +KGKQEEWKKCVQ+TSSTLQEIVGNMFVKSQFQPS+KKDIE MIDYIKAA K+VIEN TWMDSNT SSALEKLKAIRHKIGYPDSLISETYLTKKYAP EM+  N LGNY+ F EF+ EEYLK VG+KISPDEWAMGSQEVNAYYNP SNEIVFPAAILRFPFYDIGLPITYNYGGIG+VIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAG+RMSYFAANSKLEVREKLTLP V LSPEQLFFVG+GR+WC+IVTK++ID++LK DVHSVWKYRINGPMSNMPEFSK+FNCDRNK MNR KKCLVW
Sbjct:  347 VKGKQEEWKKCVQMTSSTLQEIVGNMFVKSQFQPSQKKDIESMIDYIKAALKNVIENLTWMDSNTKSSALEKLKAIRHKIGYPDSLISETYLTKKYAPTEMSGNNFLGNYLTFLEFSTEEYLKTVGKKISPDEWAMGSQEVNAYYNPLSNEIVFPAAILRFPFYDIGLPITYNYGGIGVVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGMRMSYFAANSKLEVREKLTLPRVALSPEQLFFVGMGRSWCAIVTKNYIDDQLKEDVHSVWKYRINGPMSNMPEFSKVFNCDRNKNMNRQKKCLVW 691          

HSP 2 Score: 199.519 bits (506), Expect = 0.000e+0
Identity = 99/118 (83.90%), Postives = 108/118 (91.53%), Query Frame = 2
Query:    2 RLAKALPSIADQSDPEKYTNKLSIRNMQQKFPSISWIRVINEVLENSDKKLKEDDKLVAFSLEYFDSLIKILKEYLGDSQKKQILQRDLEWAVISSLVPLGSDSLIEANEEFMSEGFG 355
            RLAKALPSIADQSDPEKYTNKLSIR+MQ+KFPSISWIRVINEV EN+  KLKEDDKLVAFSLEY DS IKILK YLGD +K++ILQ+DLEWAVISSLV LGS++LIEANEEFMSE  G
Sbjct:  229 RLAKALPSIADQSDPEKYTNKLSIRDMQKKFPSISWIRVINEVFENTGIKLKEDDKLVAFSLEYLDSSIKILKVYLGDRKKREILQKDLEWAVISSLVSLGSNALIEANEEFMSESLG 346          
BLAST of Endothelin-converting enzyme 1 vs. Planmine SMEST
Match: SMESG000003230.1 (SMESG000003230.1)

HSP 1 Score: 656.751 bits (1693), Expect = 0.000e+0
Identity = 309/345 (89.57%), Postives = 327/345 (94.78%), Query Frame = 1
Query:  379 LKGKQEEWKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVREKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            +KGKQEEWKKCVQ+TSSTLQEIVGNMFVKSQFQPS+KKDIE MIDYIKAA K+VIEN TWMDSNT SSALEKLKAIRHKIGYPDSLISETYLTKKYAP EM+  N LGNY+ F EF+ EEYLK VG+KISPDEWAMGSQEVNAYYNP SNEIVFPAAILRFPFYDIGLPITYNYGGIG+VIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAG+RMSYFAANSKLEVREKLTLP V LSPEQLFFVG+GR+WC+IVTK++ID++LK DVHSVWKYRINGPMSNMPEFSK+FNCDRNK MNR KKCLVW
Sbjct:  308 VKGKQEEWKKCVQMTSSTLQEIVGNMFVKSQFQPSQKKDIESMIDYIKAALKNVIENLTWMDSNTKSSALEKLKAIRHKIGYPDSLISETYLTKKYAPTEMSGNNFLGNYLTFLEFSTEEYLKTVGKKISPDEWAMGSQEVNAYYNPLSNEIVFPAAILRFPFYDIGLPITYNYGGIGVVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGMRMSYFAANSKLEVREKLTLPRVALSPEQLFFVGMGRSWCAIVTKNYIDDQLKEDVHSVWKYRINGPMSNMPEFSKVFNCDRNKNMNRQKKCLVW 652          

HSP 2 Score: 199.134 bits (505), Expect = 0.000e+0
Identity = 99/118 (83.90%), Postives = 108/118 (91.53%), Query Frame = 2
Query:    2 RLAKALPSIADQSDPEKYTNKLSIRNMQQKFPSISWIRVINEVLENSDKKLKEDDKLVAFSLEYFDSLIKILKEYLGDSQKKQILQRDLEWAVISSLVPLGSDSLIEANEEFMSEGFG 355
            RLAKALPSIADQSDPEKYTNKLSIR+MQ+KFPSISWIRVINEV EN+  KLKEDDKLVAFSLEY DS IKILK YLGD +K++ILQ+DLEWAVISSLV LGS++LIEANEEFMSE  G
Sbjct:  190 RLAKALPSIADQSDPEKYTNKLSIRDMQKKFPSISWIRVINEVFENTGIKLKEDDKLVAFSLEYLDSSIKILKVYLGDRKKREILQKDLEWAVISSLVSLGSNALIEANEEFMSESLG 307          
BLAST of Endothelin-converting enzyme 1 vs. Planmine SMEST
Match: SMESG000003218.1 (SMESG000003218.1)

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 303/345 (87.83%), Postives = 321/345 (93.04%), Query Frame = 1
Query:  379 LKGKQEEWKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVREKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            +KGKQEEWKKCVQ+TSSTLQEIVGNMFVKSQFQPS+KKDIE MIDYIKAA K VIEN TWMDSNT SSALEKLK IRHKIGYPDSLISETYLTKKYAP EM+  N LGNY+ F EF+ EEYLK VG+KISPD+WAMG Q+VNAYYN  SNEIVFPAAI RFPFYDIGLPITYNYGGIG+VIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAG+RMSYFAANSKLEVREKLTLP V LSPEQLFFVG+GR+WC+IVTK++ID +LK DVHSVWKYRINGPMSNMPEFSK+FNCDRNK MNR KKCLVW
Sbjct:  308 VKGKQEEWKKCVQMTSSTLQEIVGNMFVKSQFQPSQKKDIESMIDYIKAALKSVIENLTWMDSNTKSSALEKLKTIRHKIGYPDSLISETYLTKKYAPTEMSGNNFLGNYLTFLEFSTEEYLKTVGKKISPDKWAMGPQKVNAYYNALSNEIVFPAAIFRFPFYDIGLPITYNYGGIGVVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGMRMSYFAANSKLEVREKLTLPRVALSPEQLFFVGMGRSWCAIVTKNYIDNQLKEDVHSVWKYRINGPMSNMPEFSKVFNCDRNKNMNRQKKCLVW 652          

HSP 2 Score: 191.815 bits (486), Expect = 0.000e+0
Identity = 96/118 (81.36%), Postives = 105/118 (88.98%), Query Frame = 2
Query:    2 RLAKALPSIADQSDPEKYTNKLSIRNMQQKFPSISWIRVINEVLENSDKKLKEDDKLVAFSLEYFDSLIKILKEYLGDSQKKQILQRDLEWAVISSLVPLGSDSLIEANEEFMSEGFG 355
            RLAKALPSIADQS+PEKYTNKLSIR+MQ+KFPSISWIRVINEV EN+  KLKEDDKLVAFSLEY D  IKILK YLGD +K++ILQ+DLEWAVIS LV LGSD+LIEA EEFMSE  G
Sbjct:  190 RLAKALPSIADQSNPEKYTNKLSIRDMQKKFPSISWIRVINEVFENTGIKLKEDDKLVAFSLEYLDYSIKILKVYLGDRKKREILQKDLEWAVISRLVLLGSDALIEAQEEFMSESLG 307          
BLAST of Endothelin-converting enzyme 1 vs. Planmine SMEST
Match: SMESG000003218.1 (SMESG000003218.1)

HSP 1 Score: 642.884 bits (1657), Expect = 0.000e+0
Identity = 303/345 (87.83%), Postives = 321/345 (93.04%), Query Frame = 1
Query:  379 LKGKQEEWKKCVQITSSTLQEIVGNMFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVREKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 1413
            +KGKQEEWKKCVQ+TSSTLQEIVGNMFVKSQFQPS+KKDIE MIDYIKAA K VIEN TWMDSNT SSALEKLK IRHKIGYPDSLISETYLTKKYAP EM+  N LGNY+ F EF+ EEYLK VG+KISPD+WAMG Q+VNAYYN  SNEIVFPAAI RFPFYDIGLPITYNYGGIG+VIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAG+RMSYFAANSKLEVREKLTLP V LSPEQLFFVG+GR+WC+IVTK++ID +LK DVHSVWKYRINGPMSNMPEFSK+FNCDRNK MNR KKCLVW
Sbjct:  347 VKGKQEEWKKCVQMTSSTLQEIVGNMFVKSQFQPSQKKDIESMIDYIKAALKSVIENLTWMDSNTKSSALEKLKTIRHKIGYPDSLISETYLTKKYAPTEMSGNNFLGNYLTFLEFSTEEYLKTVGKKISPDKWAMGPQKVNAYYNALSNEIVFPAAIFRFPFYDIGLPITYNYGGIGVVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGMRMSYFAANSKLEVREKLTLPRVALSPEQLFFVGMGRSWCAIVTKNYIDNQLKEDVHSVWKYRINGPMSNMPEFSKVFNCDRNKNMNRQKKCLVW 691          

HSP 2 Score: 192.2 bits (487), Expect = 0.000e+0
Identity = 96/118 (81.36%), Postives = 105/118 (88.98%), Query Frame = 2
Query:    2 RLAKALPSIADQSDPEKYTNKLSIRNMQQKFPSISWIRVINEVLENSDKKLKEDDKLVAFSLEYFDSLIKILKEYLGDSQKKQILQRDLEWAVISSLVPLGSDSLIEANEEFMSEGFG 355
            RLAKALPSIADQS+PEKYTNKLSIR+MQ+KFPSISWIRVINEV EN+  KLKEDDKLVAFSLEY D  IKILK YLGD +K++ILQ+DLEWAVIS LV LGSD+LIEA EEFMSE  G
Sbjct:  229 RLAKALPSIADQSNPEKYTNKLSIRDMQKKFPSISWIRVINEVFENTGIKLKEDDKLVAFSLEYLDYSIKILKVYLGDRKKREILQKDLEWAVISRLVLLGSDALIEAQEEFMSESLG 346          
The following BLAST results are available for this feature:
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MME2.208e-7637.79membrane metalloendopeptidase [Source:HGNC Symbol;... [more]
MME2.208e-7637.79membrane metalloendopeptidase [Source:HGNC Symbol;... [more]
MME2.208e-7637.79membrane metalloendopeptidase [Source:HGNC Symbol;... [more]
MME2.208e-7637.79membrane metalloendopeptidase [Source:HGNC Symbol;... [more]
MME2.208e-7637.79membrane metalloendopeptidase [Source:HGNC Symbol;... [more]
back to top
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nep-21.408e-7035.59Neprilysin-2 [Source:UniProtKB/Swiss-Prot;Acc:O44... [more]
nep-12.779e-6837.11Neprilysin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q18... [more]
nep-113.316e-6334.17Neprilysin-11 [Source:UniProtKB/Swiss-Prot;Acc:O1... [more]
nep-211.670e-5832.28Neprilysin-21 [Source:UniProtKB/Swiss-Prot;Acc:Q2... [more]
nep-211.670e-5832.28Neprilysin-21 [Source:UniProtKB/Swiss-Prot;Acc:Q2... [more]
back to top
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nep32.899e-8138.84gene:FBgn0031081 transcript:FBtr0307554[more]
Nep32.899e-8138.84gene:FBgn0031081 transcript:FBtr0070000[more]
Nep32.899e-8138.84gene:FBgn0031081 transcript:FBtr0307555[more]
Nep22.429e-7436.11gene:FBgn0027570 transcript:FBtr0333922[more]
Nep22.429e-7436.11gene:FBgn0027570 transcript:FBtr0078891[more]
back to top
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ece2b1.727e-8440.71endothelin converting enzyme 2b [Source:ZFIN;Acc:Z... [more]
ece18.671e-7739.94endothelin converting enzyme 1 [Source:ZFIN;Acc:ZD... [more]
ece18.671e-7739.94endothelin converting enzyme 1 [Source:ZFIN;Acc:ZD... [more]
mmel15.123e-7134.20membrane metallo-endopeptidase-like 1 [Source:ZFIN... [more]
mmel15.123e-7134.20membrane metallo-endopeptidase-like 1 [Source:ZFIN... [more]
back to top
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhdds4.692e-8341.30dehydrodolichyl diphosphate synthase subunit [Sour... [more]
dhdds5.913e-8341.30dehydrodolichyl diphosphate synthase subunit [Sour... [more]
dhdds7.235e-8341.30dehydrodolichyl diphosphate synthase subunit [Sour... [more]
dhdds1.292e-8141.94dehydrodolichyl diphosphate synthase subunit [Sour... [more]
dhdds2.730e-8141.94dehydrodolichyl diphosphate synthase subunit [Sour... [more]
back to top
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ece22.292e-7739.23endothelin converting enzyme 2 [Source:MGI Symbol;... [more]
Ece23.116e-7739.23endothelin converting enzyme 2 [Source:MGI Symbol;... [more]
Mme5.964e-7738.08membrane metallo endopeptidase [Source:MGI Symbol;... [more]
Mme5.964e-7738.08membrane metallo endopeptidase [Source:MGI Symbol;... [more]
Mme5.964e-7738.08membrane metallo endopeptidase [Source:MGI Symbol;... [more]
back to top
BLAST of Endothelin-converting enzyme 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8IS64|ECE_LOCMI2.665e-8539.08Endothelin-converting enzyme homolog OS=Locusta mi... [more]
sp|Q9W5Y0|NEP3_DROME2.906e-8038.84Neprilysin-3 OS=Drosophila melanogaster OX=7227 GN... [more]
sp|F1N476|ECE2_BOVIN3.535e-7739.53Endothelin-converting enzyme 2 OS=Bos taurus OX=99... [more]
sp|B2RQR8|ECE2_MOUSE2.180e-7639.23Endothelin-converting enzyme 2 OS=Mus musculus OX=... [more]
sp|P0DPE2|EFCE2_BOVIN2.811e-7639.53EEF1AKMT4-ECE2 readthrough transcript protein OS=B... [more]
back to top
BLAST of Endothelin-converting enzyme 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4C1TXN32.178e-8541.16Endothelin-converting enzyme homolog OS=Eumeta var... [more]
A0A4S2K8714.479e-8537.86F-box domain-containing protein OS=Temnothorax lon... [more]
A0A0C9RDQ34.859e-8537.97ECE1_5 protein OS=Fopius arisanus OX=64838 GN=ECE1... [more]
E9HFF55.728e-8540.70Uncharacterized protein OS=Daphnia pulex OX=6669 G... [more]
A0A1I8PTA71.156e-8441.74Uncharacterized protein OS=Stomoxys calcitrans OX=... [more]
back to top
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ece2b5.097e-8540.71endothelin-converting enzyme 2 [Source:NCBI gene;A... [more]
ece2b5.330e-8540.71endothelin-converting enzyme 2 [Source:NCBI gene;A... [more]
ece2b8.020e-8540.71endothelin-converting enzyme 2 [Source:NCBI gene;A... [more]
MME1.425e-8139.47membrane metalloendopeptidase [Source:HGNC Symbol;... [more]
ece2b1.720e-7841.75endothelin-converting enzyme 2 [Source:NCBI gene;A... [more]
back to top
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mmel15.825e-7334.56membrane metallo-endopeptidase-like 1 [Source:ZFIN... [more]
ecel11.392e-6434.31endothelin converting enzyme-like 1 [Source:ZFIN;A... [more]
ENSPMAT00000004622.18.083e-5431.61pep scaffold:Pmarinus_7.0:GL480748:697:25272:-1 ge... [more]
mmel13.133e-5139.21membrane metallo-endopeptidase-like 1 [Source:ZFIN... [more]
mmel13.631e-5139.21membrane metallo-endopeptidase-like 1 [Source:ZFIN... [more]
back to top
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO374872.418e-8039.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319982.660e-7939.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO351071.209e-7839.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO415011.218e-7035.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417369.621e-6836.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ece2b1.260e-8038.94endothelin-converting enzyme 2 [Source:NCBI gene;A... [more]
ece2b6.048e-8038.94endothelin-converting enzyme 2 [Source:NCBI gene;A... [more]
MME1.325e-7938.15membrane metalloendopeptidase [Source:NCBI gene;Ac... [more]
MME5.608e-7937.86membrane metalloendopeptidase [Source:NCBI gene;Ac... [more]
ece14.648e-7640.52endothelin converting enzyme 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Endothelin-converting enzyme 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003235.10.000e+096.86SMESG000003235.1[more]
SMESG000003230.10.000e+089.57SMESG000003230.1[more]
SMESG000003230.10.000e+089.57SMESG000003230.1[more]
SMESG000003218.10.000e+087.83SMESG000003218.1[more]
SMESG000003218.10.000e+087.83SMESG000003218.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014052 ID=SMED30014052|Name=Endothelin-converting enzyme 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1559bp
TAGACTGGCAAAAGCCCTCCCGAGTATTGCTGATCAAAGTGATCCAGAAA
AATACACGAATAAATTATCAATTCGTAACATGCAACAAAAATTTCCTTCG
ATTTCTTGGATCAGGGTTATTAATGAGGTTTTGGAAAATTCGGATAAAAA
ACTGAAAGAAGATGATAAATTGGTAGCATTCTCACTGGAATACTTTGATT
CCTTAATTAAAATTCTAAAAGAATACTTAGGTGATTCGCAAAAGAAACAA
ATTCTACAAAGGGATTTGGAATGGGCAGTGATATCAAGTTTGGTGCCATT
GGGATCTGATTCTCTCATTGAAGCTAATGAAGAATTTATGAGTGAAGGTT
TCGGTAGCAGTGTGCTCATAACTACCTACTAAAAGGAAAACAAGAAGAGT
GGAAAAAATGCGTTCAAATAACTTCATCAACCCTTCAGGAGATTGTAGGA
AATATGTTCGTAAAATCTCAATTTCAACCTTCAAAAAAAAAAGATATTGA
GTTGATGATTGACTATATTAAAGCAGCATTTAAAGATGTGATTGAAAATC
CCACTTGGATGGATTCGAATACAAATTCAAGTGCTTTGGAGAAGTTGAAA
GCAATTCGACACAAAATCGGATATCCGGACTCATTGATATCGGAAACATA
TCTTACAAAAAAATATGCTCCAATTGAAATGACTTTCAAGAATTTACTGG
GGAATTATGTTAACTTCCAAGAGTTTGCTAGAGAGGAGTATTTAAAAGCT
GTTGGGGAAAAGATTTCACCTGATGAATGGGCTATGGGTTCACAAGAGGT
CAATGCCTACTACAATCCAACATCAAATGAAATAGTTTTCCCGGCGGCAA
TTTTGCGTTTTCCATTTTACGACATTGGACTGCCGATAACTTACAATTAC
GGAGGAATCGGAATGGTTATAGGTCATGAGATTCTGCACGGATTTGATAC
TCAAGGATCAAAATTCGATTCCAAAGGTCTTTTGAGAGAATGGTGGACAA
AATCTAGCAGAGATGAATATTTGAGCAAAACTCAGTGCATTATTAACCAA
TATGCCAGTTATGTCATCAATAATAAACCGTTACCTTCATTGCAAACCGT
GGGAGAAGATATTGCTGACAATGCGGGAATCAGGATGTCCTATTTTGCAG
CCAATTCTAAACTGGAAGTGCGAGAGAAGTTAACCCTTCCAGGAGTAGAT
TTGAGTCCTGAACAGTTGTTCTTTGTTGGTGTCGGAAGAACCTGGTGCTC
AATTGTTACTAAAAGTTTCATAGATGAACGATTAAAAGGAGATGTACACA
GCGTTTGGAAATACAGAATTAATGGTCCCATGTCAAACATGCCAGAGTTC
TCCAAGCTTTTCAACTGCGACAGGAATAAAAAAATGAATAGACTAAAGAA
ATGTTTAGTTTGGTGATTCAATATCAAAATTCATAAAAATATTTGATTAA
AAATAATTTTATTTACATTAAATTTCTTTTTGTATTCTTGATTTTATTTA
AAAATGAAGCCAACTAAGAATTAACCCTTAAATAAATACTGTTGCCATTT
GGCAACATA
back to top

protein sequence of SMED30014052-orf-1

>SMED30014052-orf-1 ID=SMED30014052-orf-1|Name=SMED30014052-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=321bp
MFVKSQFQPSKKKDIELMIDYIKAAFKDVIENPTWMDSNTNSSALEKLKA
IRHKIGYPDSLISETYLTKKYAPIEMTFKNLLGNYVNFQEFAREEYLKAV
GEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYG
GIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQY
ASYVINNKPLPSLQTVGEDIADNAGIRMSYFAANSKLEVREKLTLPGVDL
SPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFS
KLFNCDRNKKMNRLKKCLVW*
back to top

protein sequence of SMED30014052-orf-2

>SMED30014052-orf-2 ID=SMED30014052-orf-2|Name=SMED30014052-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=127bp
RLAKALPSIADQSDPEKYTNKLSIRNMQQKFPSISWIRVINEVLENSDKK
LKEDDKLVAFSLEYFDSLIKILKEYLGDSQKKQILQRDLEWAVISSLVPL
GSDSLIEANEEFMSEGFGSSVLITTY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000418head
PLANA:0000420parapharyngeal region
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR008753Peptidase_M13_N
IPR018497Peptidase_M13_C
IPR024079MetalloPept_cat_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
Vocabulary: molecular function
TermDefinition
GO:0004222metalloendopeptidase activity
GO:0008237metallopeptidase activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane