Tetraspanin

Overview
NameTetraspanin
Smed IDSMED30014051
Length (bp)889
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tetraspanin (SMED30014051) t-SNE clustered cells

Violin plots show distribution of expression levels for Tetraspanin (SMED30014051) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tetraspanin (SMED30014051) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tetraspanin (SMED30014051) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Tetraspanin vs. Ensembl Human
Match: CD82 (CD82 molecule [Source:HGNC Symbol;Acc:HGNC:6210])

HSP 1 Score: 75.8702 bits (185), Expect = 2.290e-15
Identity = 65/260 (25.00%), Postives = 125/260 (48.08%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFE-----KETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAKR 833
            GAVILG G+W+  DKS+   +++             T+SS   + A + I +GA T + GF GC GA+ E  CLL +Y   +  +++AQV  G        K +  +   + +++ +D+N   SS        +  +  ++KCCG    + +N   +A  + +N  +  +P  C           +E  +L+V +   E P    +     ++  + Q+GC+  +   ++ +L I++GV +G+ + E+L +V + C+ + 
Sbjct:   24 GAVILGFGVWILADKSSFISVLQ-------------TSSSSLRMGAYVFIGVGAVTMLMGFLGCIGAVNEVRCLLGLYFAFLLLILIAQVTAGALFYFNMGKLKQEMGGIVTELI-RDYN---SSREDSLQDAWDYVQAQVKCCGWV--SFYNWTDNA--ELMNRPEVTYPCSC-------EVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRH 255          
BLAST of Tetraspanin vs. Ensembl Human
Match: CD82 (CD82 molecule [Source:HGNC Symbol;Acc:HGNC:6210])

HSP 1 Score: 67.781 bits (164), Expect = 1.262e-12
Identity = 62/263 (23.57%), Postives = 115/263 (43.73%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVA---KDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFE-----KETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAKR 833
            GAVILG G+W+  DKS+   +++             T+SS   + A + I +GA T + GF GC GA+ E  CLL +                             L++ +  IV    +D+N   SS        +  +  ++KCCG    + +N   +A  + +N  +  +P  C           +E  +L+V +   E P    +     ++  + Q+GC+  +   ++ +L I++GV +G+ + E+L +V + C+ + 
Sbjct:   24 GAVILGFGVWILADKSSFISVLQ-------------TSSSSLRMGAYVFIGVGAVTMLMGFLGCIGAVNEVRCLLGL-----------------------------LKQEMGGIVTELIRDYN---SSREDSLQDAWDYVQAQVKCCGWV--SFYNWTDNA--ELMNRPEVTYPCSC-------EVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRH 230          
BLAST of Tetraspanin vs. Ensembl Human
Match: TSPAN3 (tetraspanin 3 [Source:HGNC Symbol;Acc:HGNC:17752])

HSP 1 Score: 67.0106 bits (162), Expect = 2.631e-12
Identity = 56/216 (25.93%), Postives = 99/216 (45.83%), Query Frame = 3
Query:  198 IVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFAC---CVAKRD 836
            I A+++I +GA  FI G  GCC  I+ES C L  +  ++  V V +V V +   V + K +  +++S+ K V K +NG   +NP   ++    +  ++ CCG+   +D+    D +K+T N   Q  P+ CC+                    T  + N      + L  +GC   ++ K++  +  VI   +     ++L ++ AC   C   RD
Sbjct:   52 IPAVVIIAVGALLFIIGLIGCCATIRESRCGLATFVIILLLVFVTEVVVVVLGYVYRAKVENEVDRSIQK-VYKTYNG---TNPDAASRAIDYVQRQLHCCGIHNYSDWENT-DWFKETKN---QSVPLSCCR-------------------ETASNCNGSLAHPSDLYAEGCEALVVKKLQEIMMHVIWAALAFAAIQLLGMLCACIVLCRRSRD 240          
BLAST of Tetraspanin vs. Ensembl Human
Match: CD37 (CD37 molecule [Source:HGNC Symbol;Acc:HGNC:1666])

HSP 1 Score: 65.4698 bits (158), Expect = 1.151e-11
Identity = 65/258 (25.19%), Postives = 113/258 (43.80%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNP--SMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGR---KQIH--PIGCCKLKNSFHFNSKEKLNLT-------VVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEIL 800
            G++I   GIW+ +DK++               SF         I + +L I G FT      GC GA+KE  CLL +Y  ++  +   Q+ +GI  S Q+    A+LE+SL  +V K       +NP  +   + +  + F+++CCG     D       W Q +  R    + H  P  C  L  +      +K+ L        +  +      C    E+ + ++GC   L   + ++L  ++G+C+G+GL E++
Sbjct:   26 GSLIFCFGIWILIDKTSFV-------------SFVGLAFVPLQIWSKVLAISGIFTMGIALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQR----AQLERSLRDVVEKTIQ-KYGTNPEETAAEESWDYVQFQLRCCGWHYPQD-------WFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHNNLISIVGICLGVGLLEVI 258          
BLAST of Tetraspanin vs. Ensembl Human
Match: CD37 (CD37 molecule [Source:HGNC Symbol;Acc:HGNC:1666])

HSP 1 Score: 64.6994 bits (156), Expect = 1.970e-11
Identity = 65/257 (25.29%), Postives = 112/257 (43.58%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNP--SMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGR---KQIH--PIGCCKLKNSFHFNSKEKLNLT-------VVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEI 797
            G++I   GIW+ +DK++               SF         I + +L I G FT      GC GA+KE  CLL +Y  ++  +   Q+ +GI  S Q    +A+LE+SL  +V K       +NP  +   + +  + F+++CCG     D       W Q +  R    + H  P  C  L  +      +K+ L        +  +      C    E+ + ++GC   L   + ++L  ++G+C+G+GL E+
Sbjct:   26 GSLIFCFGIWILIDKTSFV-------------SFVGLAFVPLQIWSKVLAISGIFTMGIALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQ----RAQLERSLRDVVEKTIQ-KYGTNPEETAAEESWDYVQFQLRCCGWHYPQD-------WFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHNNLISIVGICLGVGLLEL 257          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-11 (Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q17526])

HSP 1 Score: 60.8474 bits (146), Expect = 1.841e-10
Identity = 68/263 (25.86%), Postives = 108/263 (41.06%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNL----FEMMRNINLDETAKSFS-STNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYS----FLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPS---MFTKVFTALMFEMKCCGVKGE-ADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSL---IDKIKSHLKIVIGVCIGLGLFEILCIV 809
            G + LG+G+W+ +DK  +    F   +    D+ A     +T  +       +L + G    +  F GCCGA KE   LL  YS     ++A  I A +   +++ + +N F+  L  SL      D N  +S+NP    +    +  +M E  CCGV  +  +FN  G  W Q  +GR Q  P  CC                   E+    P C        +  GC   +    +++ SH KIV    +   L +++ IV
Sbjct:   33 GLICLGIGLWLVLDKYAIDNLAFATAKVQGYDQDAGLRDLATKPTAVRQFGYLLFVGGFIVIVVAFLGCCGAAKEWRPLLCCYSSCLMLILAIQIAATIYAFLHSHMFENDFRDILHSSLKMYNGTD-NMKVSNNPQDGLLVKTAWDKIMIEKSCCGVDSKIGEFNNSG--WYQLNHGRYQFPP-ACCPPD----------------EHGRLRPYC---NTIMRHSHGCYAKIAESFEEVTSHFKIVSWTVVLFALIQVVGIV 272          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-11 (Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q17526])

HSP 1 Score: 60.8474 bits (146), Expect = 1.841e-10
Identity = 68/263 (25.86%), Postives = 108/263 (41.06%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNL----FEMMRNINLDETAKSFS-STNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYS----FLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPS---MFTKVFTALMFEMKCCGVKGE-ADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSL---IDKIKSHLKIVIGVCIGLGLFEILCIV 809
            G + LG+G+W+ +DK  +    F   +    D+ A     +T  +       +L + G    +  F GCCGA KE   LL  YS     ++A  I A +   +++ + +N F+  L  SL      D N  +S+NP    +    +  +M E  CCGV  +  +FN  G  W Q  +GR Q  P  CC                   E+    P C        +  GC   +    +++ SH KIV    +   L +++ IV
Sbjct:   33 GLICLGIGLWLVLDKYAIDNLAFATAKVQGYDQDAGLRDLATKPTAVRQFGYLLFVGGFIVIVVAFLGCCGAAKEWRPLLCCYSSCLMLILAIQIAATIYAFLHSHMFENDFRDILHSSLKMYNGTD-NMKVSNNPQDGLLVKTAWDKIMIEKSCCGVDSKIGEFNNSG--WYQLNHGRYQFPP-ACCPPD----------------EHGRLRPYC---NTIMRHSHGCYAKIAESFEEVTSHFKIVSWTVVLFALIQVVGIV 272          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-17 (Tetraspanin-17 [Source:UniProtKB/Swiss-Prot;Acc:Q11098])

HSP 1 Score: 57.3806 bits (137), Expect = 2.445e-9
Identity = 62/256 (24.22%), Postives = 100/256 (39.06%), Query Frame = 3
Query:   87 VGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPS--MFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQ-----IHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAKR 833
            +G+W+ +D        RN  LD       S N  L    A + ++ G    + GF G CGA+  S  LL  +   +    +A VA+G  +   ++K  +  E   ++ + K   G ++S P   M T+    L F  KCCG  G  D+  I   W Q+ N   +     + P+ CC             LN   +  +      I       +  GC   L+      + I +G   G  L  +L I  +CC+  +
Sbjct:   32 LGLWMLLDPK------RNYILDLV---HFSENDPLLKASAYVSLVCGCAQLLVGFLGLCGAVNRSRFLLLAFVMFLIGTFLADVAMGTLSLFYKDKVYSVKEN--VREIVKSKYGVMTSEPENKMVTEFIDKLQFYEKCCGSLGPTDY--ISSRWSQSTNQDSEEIESPLFPVSCCT-----QITGASALN--PLAKSYARCQQIGANRQWRHAVGCSERLMSWFNEQIWIFVGFGFGSALTMMLGICLSCCLISK 267          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-17 (Tetraspanin-17 [Source:UniProtKB/Swiss-Prot;Acc:Q11098])

HSP 1 Score: 55.4546 bits (132), Expect = 1.139e-8
Identity = 57/255 (22.35%), Postives = 96/255 (37.65%), Query Frame = 3
Query:   87 VGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEK------ETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAKR 833
            +G+W+ +D        RN  LD       S N  L    A + ++ G    + GF G CGA+  S  LL  +   +    +A VA+G  +   ++KF      + + +  K+      S       +   + F  +CCG +G  D+         T+ G +   P  CCK        +   +          DP C   +      +T +N  GC   L+      + I +G   G  L  +L I  +CC+  +
Sbjct:   32 LGLWMLLDPK------RNYILDLVH---FSENDPLLKASAYVSLVCGCAQLLVGFLGLCGAVNRSRFLLLAFVMFLIGTFLADVAMGTLSLFYKDKF----SNNYMGVYLKNLTYNRYSRDRWVLPLMDTIQFYHQCCGGEGPLDYKDSFWYITNTLRGTRSFVPPSCCKQAQVGRAWAPVPI----------DPMCTTYRYLTTAFDTSVNTVGCSERLMSWFNEQIWIFVGFGFGSALTMMLGICLSCCLISK 263          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-6 (Tetraspanin [Source:UniProtKB/TrEMBL;Acc:G4RWX0])

HSP 1 Score: 52.373 bits (124), Expect = 9.200e-8
Identity = 39/156 (25.00%), Postives = 71/156 (45.51%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIG 536
            GA+I+G+ IW+ VDK++L  +   + +D  ++  S  N    +    + I++G    + GF GCCG+  ES C + +Y  LV  + V +V   +   V +   Q   +      +   +N           +V   +   ++CCG  G +D+   G
Sbjct:   25 GAIIVGLSIWMLVDKNSLNTVASTVKVD-LSQILSQVNIQQLNSFLYVAIVIGGALLVLGFFGCCGSCCESICAISIYFILVLILFVVEVVAIVLYFVNKTNLQQGFQTIWRDELVSKYN-----TQQQIHQVLDQIQSSLQCCGASGCSDYIPYG 174          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp66E (gene:FBgn0035936 transcript:FBtr0076507)

HSP 1 Score: 76.2554 bits (186), Expect = 8.247e-16
Identity = 68/262 (25.95%), Postives = 125/262 (47.71%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGR-KQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIV--FACC--VAKRDD 839
            G +I GVG+W+ VDK +L  +++   L E+ +    T     + +A +L+++GA  F   F G  GA++ES CLL  Y   +  +++A++  G   +  ++K +A   K+ ++     +  +L  N    + ++  LM    CCG+    DF+    AW   +NG+  +  P  CC LK+      ++       E+   +P+          +KGC     + +    ++VI V I +G+  ++ I+  FA C   AK +D
Sbjct:   25 GTIIFGVGLWLAVDKHSLIALLK---LVESERIEQFTQPQAIEQLAYVLLVIGAVMFFMSFLGYLGAMRESRCLLSTYGTFLILLLIAEIVAGGLGAFFKDKVRAE-SKNFLQTTITSY--SLGENVDATSLMWNQLMGNFGCCGINDYHDFDA-SPAW---VNGKGNRTIPDACCILKDVAKLVPRD-------EDCTTNPS----DSNSFYKKGCYEVFTEWLIRQRELVI-VAIAVGIVHLVLIILAFALCKAFAKYND 264          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp66E (gene:FBgn0035936 transcript:FBtr0076506)

HSP 1 Score: 76.2554 bits (186), Expect = 8.247e-16
Identity = 68/262 (25.95%), Postives = 125/262 (47.71%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGR-KQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIV--FACC--VAKRDD 839
            G +I GVG+W+ VDK +L  +++   L E+ +    T     + +A +L+++GA  F   F G  GA++ES CLL  Y   +  +++A++  G   +  ++K +A   K+ ++     +  +L  N    + ++  LM    CCG+    DF+    AW   +NG+  +  P  CC LK+      ++       E+   +P+          +KGC     + +    ++VI V I +G+  ++ I+  FA C   AK +D
Sbjct:   25 GTIIFGVGLWLAVDKHSLIALLK---LVESERIEQFTQPQAIEQLAYVLLVIGAVMFFMSFLGYLGAMRESRCLLSTYGTFLILLLIAEIVAGGLGAFFKDKVRAE-SKNFLQTTITSY--SLGENVDATSLMWNQLMGNFGCCGINDYHDFDA-SPAW---VNGKGNRTIPDACCILKDVAKLVPRD-------EDCTTNPS----DSNSFYKKGCYEVFTEWLIRQRELVI-VAIAVGIVHLVLIILAFALCKAFAKYND 264          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp66E (gene:FBgn0035936 transcript:FBtr0076508)

HSP 1 Score: 76.2554 bits (186), Expect = 8.247e-16
Identity = 68/262 (25.95%), Postives = 125/262 (47.71%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGR-KQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIV--FACC--VAKRDD 839
            G +I GVG+W+ VDK +L  +++   L E+ +    T     + +A +L+++GA  F   F G  GA++ES CLL  Y   +  +++A++  G   +  ++K +A   K+ ++     +  +L  N    + ++  LM    CCG+    DF+    AW   +NG+  +  P  CC LK+      ++       E+   +P+          +KGC     + +    ++VI V I +G+  ++ I+  FA C   AK +D
Sbjct:   25 GTIIFGVGLWLAVDKHSLIALLK---LVESERIEQFTQPQAIEQLAYVLLVIGAVMFFMSFLGYLGAMRESRCLLSTYGTFLILLLIAEIVAGGLGAFFKDKVRAE-SKNFLQTTITSY--SLGENVDATSLMWNQLMGNFGCCGINDYHDFDA-SPAW---VNGKGNRTIPDACCILKDVAKLVPRD-------EDCTTNPS----DSNSFYKKGCYEVFTEWLIRQRELVI-VAIAVGIVHLVLIILAFALCKAFAKYND 264          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp39D (gene:FBgn0032943 transcript:FBtr0273404)

HSP 1 Score: 68.9366 bits (167), Expect = 1.883e-13
Identity = 55/210 (26.19%), Postives = 91/210 (43.33%), Query Frame = 3
Query:  207 IILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSS--NPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAK 830
            IIL+I+GA   +  F GCCGA+KESSC++  ++ L   + + ++ +G+   V+             +I+   FN  +      + +   +T L  E+ CCG+ G  D       W+     R    P  CC                  V N  E   C     T   Q GC+  L++ + S   I+  V +G+   ++L I+FACC+ +
Sbjct:   54 IILMIVGAAVAVICFLGCCGALKESSCMILSFALLAVVIFLFEIGLGLAGYVKHTGLH--------QIMESQFNSTMQHYKERADYRDAWTLLQTELDCCGINGPND-------WETVY--RNSTLPAACCS-----------------VINLSEAKEC---TNTHATQHGCLQKLLEILDSKTLILASVVLGVAGIQMLTILFACCLYR 226          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp42Ed (gene:FBgn0029507 transcript:FBtr0345536)

HSP 1 Score: 58.5362 bits (140), Expect = 7.795e-10
Identity = 60/228 (26.32%), Postives = 102/228 (44.74%), Query Frame = 3
Query:  153 ETAKSFSSTNSSLF-DIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAKR 833
             T K FS    +   + VAII+++LG   F+  F GCCGAI+E+SC L  YS ++  ++V+Q+A+ IY  V   + Q  LEK +  I  +    AL         +   L    KCCG+ G AD+ GI              +P  CC                    ++  +  C   +   + +  C+ ++     +++ I+    +G+   E++  +FACC+A +
Sbjct:   35 STIKDFSGVGETFTANSVAIIILVLGCVVFLVAFMGCCGAIRENSCALTSYSVVMLVLLVSQLALIIYVWVDHVQIQQSLEKIVQTIWDQRKTDAL---------LMDTLQRSFKCCGLNGFADY-GI-------------TYPASCC--------------------DSPSNGTCALTQ--VMTRSSCLKAVDSFWDTNVSIIKYAGLGVTAVELVAFIFACCLANQ 217          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: cd151l (CD151 antigen, like [Source:ZFIN;Acc:ZDB-GENE-040426-1868])

HSP 1 Score: 81.2629 bits (199), Expect = 1.322e-17
Identity = 63/254 (24.80%), Postives = 115/254 (45.28%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAK 830
            G  ++ VGIW  ++KS+   ++               +S ++ + A ILI+ G    ITG  GCC   KE   LL +Y  L+  + + ++  G+ A +   +    L+++L + + + +N    S     TK    L  E KCCG    +D+  +  AW ++     ++ P  CCK      F  +            + P+ I++ E      GC+  L + I +HL+I+  V +G+   +I+ + F CC+ +
Sbjct:   31 GVAVMAVGIWTVIEKSDYISLL---------------SSKIYAVSAYILIMAGVIVMITGVLGCCATFKEQRRLLRVYFVLLLCIFLLEILAGVLAYIYYQQLNDELKENLRETMVQKYN---QSEQEHVTKAVDKLQQEFKCCGSNSSSDW--VDSAWIRSSEADGRLVPDSCCK-SPVRKFCGRR-----------DHPSNIYKVEG-----GCITKLENFILNHLQIIGAVGVGVASVQIVGMFFTCCLYR 247          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: cd82b (CD82 molecule b [Source:ZFIN;Acc:ZDB-GENE-030131-2857])

HSP 1 Score: 79.7221 bits (195), Expect = 5.858e-17
Identity = 68/257 (26.46%), Postives = 123/257 (47.86%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTI---NGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAK 830
            GAVI+G G+WV++D  +   +++              +S+   + A ILI +G+ + + GF GC GAI E  CLL +Y   +  +++AQV   +    Q++  +      + KI+  ++ G  S+N S     +  +   MKCCG  G++D       WK+ +   N  K ++P   C  +N    +  +K      E            +  +  KGC+ SL D I  +  +++GVC+G+ + E+L ++ + C+ K
Sbjct:   24 GAVIMGFGLWVRLDSQSFLTVLQE-------------SSTSLKVGAYILIGIGSLSMLMGFLGCIGAIYEIRCLLGLYFTCLLLILIAQVTAAVLIYFQRDLLKGETYNIVNKILV-NYTG--SNNTS--EDAWDYIQRTMKCCGWSGQSD-------WKENVMIKNNSKILYP---CSCRNE-SISGSDKQEKGFCEG--------LSPQWPVFTKGCISSLEDWILRNCGVILGVCVGIAVIELLGMILSMCLCK 243          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: cd82b (CD82 molecule b [Source:ZFIN;Acc:ZDB-GENE-030131-2857])

HSP 1 Score: 79.7221 bits (195), Expect = 5.858e-17
Identity = 68/257 (26.46%), Postives = 123/257 (47.86%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTI---NGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAK 830
            GAVI+G G+WV++D  +   +++              +S+   + A ILI +G+ + + GF GC GAI E  CLL +Y   +  +++AQV   +    Q++  +      + KI+  ++ G  S+N S     +  +   MKCCG  G++D       WK+ +   N  K ++P   C  +N    +  +K      E            +  +  KGC+ SL D I  +  +++GVC+G+ + E+L ++ + C+ K
Sbjct:   24 GAVIMGFGLWVRLDSQSFLTVLQE-------------SSTSLKVGAYILIGIGSLSMLMGFLGCIGAIYEIRCLLGLYFTCLLLILIAQVTAAVLIYFQRDLLKGETYNIVNKILV-NYTG--SNNTS--EDAWDYIQRTMKCCGWSGQSD-------WKENVMIKNNSKILYP---CSCRNE-SISGSDKQEKGFCEG--------LSPQWPVFTKGCISSLEDWILRNCGVILGVCVGIAVIELLGMILSMCLCK 243          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: tspan34 (tetraspanin 34 [Source:ZFIN;Acc:ZDB-GENE-060825-202])

HSP 1 Score: 73.9442 bits (180), Expect = 4.133e-15
Identity = 68/250 (27.20%), Postives = 112/250 (44.80%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKI---VAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIV 809
            GA +L VGIWV VD+ +L   + +I  D   +     N      +  +LI +GAF  I GF GCCGA+KES C+L  +  +V  + + +VA  +   V    F+  ++++L +I   VAK        +   F+ ++   M E+KCCG     DF+G              ++P  CC        +  ++ +    E   ED              GC  +L+  I+ +  ++ GV +G+   EI  +V
Sbjct:   13 GAAVLAVGIWVAVDRVSLLGFLEHIE-DAPPELAQLAN------IGYLLIGVGAFLAIMGFLGCCGAVKESKCMLLTFFIIVLIIFLVEVAAAVVLFV----FEPVVQETLNEIGQKVAKSIKDNYGKDEP-FSSIWNTTMNELKCCGYNNYTDFSG------SNFVEETSMYPEKCCS-------SGSQRCD----ERAAEDAVI----------AGCFRTLVKLIEDNALLLAGVALGIAALEIAAMV 223          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: cd151 (CD151 molecule [Source:ZFIN;Acc:ZDB-GENE-041010-137])

HSP 1 Score: 71.633 bits (174), Expect = 3.373e-14
Identity = 63/254 (24.80%), Postives = 111/254 (43.70%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAK 830
            G  ++ VGIW  +DKS+   ++               +S+ + + A ILI  GA    TG  GCC  I+E   LL ++  L+  + + ++  G+ A V   +  A L   L + + +++           T+    L  ++KCCG    AD+     AW +    R+ + P  CCK               +V     + P+ I++ E      GC+  L + I  HL I+  V +G+   +I+ ++F CC+ +
Sbjct:   31 GGAVMAVGIWTLLDKSDYISLL---------------SSNTYMVAAFILIGAGAVVVFTGILGCCATIREQRSLLIVFLILLLLIFLLEITAGVLAYVYYQELNAELRADLKERMVENYQ---QPGQEHITRAIDNLQQDLKCCGSNSSADWR--DGAWIRNYADRRLV-PDSCCKTP-------------SVGCGVRDHPSNIYKVE-----GGCISKLEEFILQHLLILGSVGLGIAFVQIVGMIFTCCLYR 245          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: cd82 (CD82 molecule [Source:NCBI gene;Acc:394799])

HSP 1 Score: 82.4185 bits (202), Expect = 7.617e-18
Identity = 70/256 (27.34%), Postives = 124/256 (48.44%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIK-IVAKDF-NGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAK 830
            GAVILG GIW+ VDK++   +++             T+SS     + ILI +G FT + GF GC GA+ E  CLL +Y   +  +++AQVA GI   +Q++  +  +   + + IV  D+ +G  +S  + +  + T L    +CCG     ++          +      +P  C  +KN    N   + N TV              E+ + Q GC+  +   ++ +L I++GVC+G+ + E+L ++ + C+ +
Sbjct:   25 GAVILGFGIWILVDKTSFIAVLQ-------------TSSSYLRTGSYILIAVGGFTMVMGFLGCLGAVNEIRCLLGLYFSFLLIILIAQVAAGILIYLQRDTLKTEMSSIIHELIVTYDYEDGKNTSAETTWDYIQTNL----RCCGWTNYQNWTA-----NTVVQNSTNQYPCSC--MKNQSSPNGFCQYNGTV--------------ESAVYQTGCMQGVESWLQDNLGIILGVCVGVAVIELLGLILSMCLCR 242          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: cd82 (CD82 molecule [Source:NCBI gene;Acc:394799])

HSP 1 Score: 82.0333 bits (201), Expect = 1.254e-17
Identity = 70/256 (27.34%), Postives = 124/256 (48.44%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIK-IVAKDF-NGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAK 830
            GAVILG GIW+ VDK++   +++             T+SS     + ILI +G FT + GF GC GA+ E  CLL +Y   +  +++AQVA GI   +Q++  +  +   + + IV  D+ +G  +S  + +  + T L    +CCG     ++          +      +P  C  +KN    N   + N TV              E+ + Q GC+  +   ++ +L I++GVC+G+ + E+L ++ + C+ +
Sbjct:   38 GAVILGFGIWILVDKTSFIAVLQ-------------TSSSYLRTGSYILIAVGGFTMVMGFLGCLGAVNEIRCLLGLYFSFLLIILIAQVAAGILIYLQRDTLKTEMSSIIHELIVTYDYEDGKNTSAETTWDYIQTNL----RCCGWTNYQNWTA-----NTVVQNSTNQYPCSC--MKNQSSPNGFCQYNGTV--------------ESAVYQTGCMQGVESWLQDNLGIILGVCVGVAVIELLGLILSMCLCR 255          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: cd151 (CD151 molecule (Raph blood group) [Source:NCBI gene;Acc:100144686])

HSP 1 Score: 80.1073 bits (196), Expect = 4.700e-17
Identity = 65/254 (25.59%), Postives = 106/254 (41.73%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAK 830
            G  ++ VGIW  + KS+   ++                S+ +   A IL+I GA   ITG  GCC   KE   LL +Y  L+  + + +V  GI A +   +  A L++SL + +   +           T     L  E KCCG     D+      W  +    K++ P  CCK              +T      + P+ I++ E      GC+  L   I++HL I+  V IG+   ++  ++F CC+ +
Sbjct:   31 GLAVMAVGIWTLIQKSDYISLL---------------PSNTYAATAYILVIAGAIVMITGILGCCATFKERKSLLKVYFILLLCIFILEVLAGILAYIYYQQLNAELKQSLKQTMTTKYK---QPGEEKVTNAVDKLQQEFKCCGSNNSEDWR--DSIWINSPEAEKRLVPDSCCK-------------TVTQRCGIRDHPSNIYKTE-----GGCITKLETFIRAHLLIIGAVGIGIACVQLFGMIFTCCLYR 246          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: tspan8 (tetraspanin 8 [Source:NCBI gene;Acc:496915])

HSP 1 Score: 76.6406 bits (187), Expect = 6.442e-16
Identity = 73/249 (29.32%), Postives = 112/249 (44.98%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFA 815
            G VILGV IWV+V KS    + + +N+D           SL   V + +I +GA   + GF GCCGAI+ES CLL ++   +  ++  Q+  G+  +V + K +A+L ++  K++       LS     F   F  +  E +CCG+      NG  D W   I       P  C                  +   T    NCI+       ++ C+  + D  K+HL I+IG+  GL   EI  +VF+
Sbjct:   23 GCVILGVSIWVRVSKS----VQQELNID---------GGSLLSAVDL-MIAVGAIIMVLGFFGCCGAIRESRCLLLLFFIGLFLILALQITAGVLGAVYKPKIEAQLNQTFYKLL------PLSGQDESFKTSFENIQKESQCCGL-----VNGYTD-WGANI-------PASC------------------ICPTTSRTNNCIYFAGKNYYKETCLGVISDFFKNHLVIIIGIAFGLAAVEIFGLVFS 220          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: gpr88 (G protein-coupled receptor 88 [Source:Xenbase;Acc:XB-GENE-984668])

HSP 1 Score: 75.0998 bits (183), Expect = 3.305e-15
Identity = 61/248 (24.60%), Postives = 112/248 (45.16%), Query Frame = 3
Query:   93 IWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLL-FMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLI-KIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAK 830
            +WV VD +   E++             +T   LF + A +++ +G   F+ GF GCCGAI+E+ CLL F + F++   +    A  +    ++N     L K    + V K ++G   ++  +F+  + ++M    CCGV G  DFN   DA +          P  CC+ +             +     +    C+   E   N++GC   +++ ++ ++ I   + IG+   E+L +VFA C+ +
Sbjct:   32 VWVFVDPTGFREII-------------ATTPLLF-MGAYLVLAMGGMLFLLGFLGCCGAIRENKCLLVFFFMFILVIFLAELSAAILAFLFREN-----LSKDFFAREVKKHYHG--DNSTEVFSSTWNSIMITFGCCGVNGPEDFN---DAHRFRAMHPFAPVPEACCRREVQ-----------SRAGKIVSRAECLTGGENYQNRQGCYSVIVNSVEPYVYIAGALAIGVLAIELLSMVFAMCLFR 244          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Cd82 (CD82 antigen [Source:MGI Symbol;Acc:MGI:104651])

HSP 1 Score: 77.7962 bits (190), Expect = 3.265e-16
Identity = 69/259 (26.64%), Postives = 120/259 (46.33%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLK---NSFHFNSK--EKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAK 830
            GAVILG G+W+  DK++   +++             T+SS   + A + I +GA T + GF GC GA+ E  CLL +Y   +  +++AQV VG+      +K +  +  +++ I+      A SS    +  V      ++KCCG     ++       ++ +   K  +P  C K+K   N         E  N TV EN  ED          +N +GC+      ++ +  I++GVC G+ + E+L +  + C+ +
Sbjct:   24 GAVILGFGVWILADKNSFISVLQ-------------TSSSSLQVGAYVFIGVGAITIVMGFLGCIGAVNEVRCLLGLYFVFLLLILIAQVTVGVLFYFNADKLKKEMGNTVMDIIRNYTANATSSREEAWDYV----QAQVKCCGWVSHYNWTEN----EELMGFTKTTYPCSCEKIKEEDNQLIVKKGFCEADNSTVSENNPED--------WPVNTEGCMEKAQAWLQENFGILLGVCAGVAVIELLGLFLSICLCR 253          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Cd82 (CD82 antigen [Source:MGI Symbol;Acc:MGI:104651])

HSP 1 Score: 77.7962 bits (190), Expect = 3.265e-16
Identity = 69/259 (26.64%), Postives = 120/259 (46.33%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLK---NSFHFNSK--EKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAK 830
            GAVILG G+W+  DK++   +++             T+SS   + A + I +GA T + GF GC GA+ E  CLL +Y   +  +++AQV VG+      +K +  +  +++ I+      A SS    +  V      ++KCCG     ++       ++ +   K  +P  C K+K   N         E  N TV EN  ED          +N +GC+      ++ +  I++GVC G+ + E+L +  + C+ +
Sbjct:   24 GAVILGFGVWILADKNSFISVLQ-------------TSSSSLQVGAYVFIGVGAITIVMGFLGCIGAVNEVRCLLGLYFVFLLLILIAQVTVGVLFYFNADKLKKEMGNTVMDIIRNYTANATSSREEAWDYV----QAQVKCCGWVSHYNWTEN----EELMGFTKTTYPCSCEKIKEEDNQLIVKKGFCEADNSTVSENNPED--------WPVNTEGCMEKAQAWLQENFGILLGVCAGVAVIELLGLFLSICLCR 253          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Cd82 (CD82 antigen [Source:MGI Symbol;Acc:MGI:104651])

HSP 1 Score: 77.7962 bits (190), Expect = 3.265e-16
Identity = 69/259 (26.64%), Postives = 120/259 (46.33%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLK---NSFHFNSK--EKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAK 830
            GAVILG G+W+  DK++   +++             T+SS   + A + I +GA T + GF GC GA+ E  CLL +Y   +  +++AQV VG+      +K +  +  +++ I+      A SS    +  V      ++KCCG     ++       ++ +   K  +P  C K+K   N         E  N TV EN  ED          +N +GC+      ++ +  I++GVC G+ + E+L +  + C+ +
Sbjct:   24 GAVILGFGVWILADKNSFISVLQ-------------TSSSSLQVGAYVFIGVGAITIVMGFLGCIGAVNEVRCLLGLYFVFLLLILIAQVTVGVLFYFNADKLKKEMGNTVMDIIRNYTANATSSREEAWDYV----QAQVKCCGWVSHYNWTEN----EELMGFTKTTYPCSCEKIKEEDNQLIVKKGFCEADNSTVSENNPED--------WPVNTEGCMEKAQAWLQENFGILLGVCAGVAVIELLGLFLSICLCR 253          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Cd82 (CD82 antigen [Source:MGI Symbol;Acc:MGI:104651])

HSP 1 Score: 77.7962 bits (190), Expect = 3.265e-16
Identity = 69/259 (26.64%), Postives = 120/259 (46.33%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLK---NSFHFNSK--EKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAK 830
            GAVILG G+W+  DK++   +++             T+SS   + A + I +GA T + GF GC GA+ E  CLL +Y   +  +++AQV VG+      +K +  +  +++ I+      A SS    +  V      ++KCCG     ++       ++ +   K  +P  C K+K   N         E  N TV EN  ED          +N +GC+      ++ +  I++GVC G+ + E+L +  + C+ +
Sbjct:   24 GAVILGFGVWILADKNSFISVLQ-------------TSSSSLQVGAYVFIGVGAITIVMGFLGCIGAVNEVRCLLGLYFVFLLLILIAQVTVGVLFYFNADKLKKEMGNTVMDIIRNYTANATSSREEAWDYV----QAQVKCCGWVSHYNWTEN----EELMGFTKTTYPCSCEKIKEEDNQLIVKKGFCEADNSTVSENNPED--------WPVNTEGCMEKAQAWLQENFGILLGVCAGVAVIELLGLFLSICLCR 253          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Tspan1 (tetraspanin 1 [Source:MGI Symbol;Acc:MGI:1914055])

HSP 1 Score: 65.855 bits (159), Expect = 3.730e-12
Identity = 61/229 (26.64%), Postives = 98/229 (42.79%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAI--ILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSH 749
            GA +L VGIWV VD ++              K F S +SS    V +   LI  GA  FI GF GC GA  E+ C+L M+  ++  + +A++A  + A V     +  L   ++  + KD+        + FT+V+   M E+ CCG     DFN              ++ P  CC    +               +T+E   C  EK   +  +GC   ++ +I+++
Sbjct:   22 GAALLAVGIWVSVDGTSFL------------KVFGSLSSSAMQFVNVGYFLIAAGAVLFILGFLGCYGAHSENKCVLMMFFSILLIIFIAEIAGAVVALVYTTLAEQFLTLLVVPAIEKDY-----GYQTDFTQVWNTTMEELHCCGFNNYTDFNA------SRFVKENKVFPPPCCANPGN---------------HTVEP--CTEEKAKSMKVQGCFKEILHRIRAN 210          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|O70352|CD82_RAT (CD82 antigen OS=Rattus norvegicus OX=10116 GN=Cd82 PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.681e-15
Identity = 70/262 (26.72%), Postives = 118/262 (45.04%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTI---NGRKQIHPIGCCKLK---NSFHFNSK--EKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAK 830
            GAVILG G+W+  DKS+   +++             T+SS   + A + I +GA T + GF GC GA+ E  CLL +Y   +  +++AQV V +      NK +  +  +++ I+      A SS    +  V      ++KCCG    ++       W +     N  K  +P  C K K   N         E  N T  EN+ ED          ++ +GC+      ++ +  I++GVC G+ + E+L +  + C+ +
Sbjct:   24 GAVILGFGVWILADKSSFISVLQ-------------TSSSSLQVGAYVFIGVGAITMLMGFLGCIGAVNEVRCLLGLYFVFLLLILIAQVTVEVLFYFNANKLKQEMGNTVMDIIQNYSVNASSSREEAWDYV----QAQVKCCGWVSPSN-------WTRNPVLKNSTKTTYPCSCEKTKEEDNQLIVKKGFCESDNSTASENSPED--------WPVHPEGCMEKAQAWLQENFGILLGVCAGVAVIELLGLFLSICLCR 253          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|P40237|CD82_MOUSE (CD82 antigen OS=Mus musculus OX=10090 GN=Cd82 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 2.284e-15
Identity = 69/259 (26.64%), Postives = 120/259 (46.33%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLK---NSFHFNSK--EKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAK 830
            GAVILG G+W+  DK++   +++             T+SS   + A + I +GA T + GF GC GA+ E  CLL +Y   +  +++AQV VG+      +K +  +  +++ I+      A SS    +  V      ++KCCG     ++       ++ +   K  +P  C K+K   N         E  N TV EN  ED          +N +GC+      ++ +  I++GVC G+ + E+L +  + C+ +
Sbjct:   24 GAVILGFGVWILADKNSFISVLQ-------------TSSSSLQVGAYVFIGVGAITIVMGFLGCIGAVNEVRCLLGLYFVFLLLILIAQVTVGVLFYFNADKLKKEMGNTVMDIIRNYTANATSSREEAWDYV----QAQVKCCGWVSHYNWTEN----EELMGFTKTTYPCSCEKIKEEDNQLIVKKGFCEADNSTVSENNPED--------WPVNTEGCMEKAQAWLQENFGILLGVCAGVAVIELLGLFLSICLCR 253          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|P27701|CD82_HUMAN (CD82 antigen OS=Homo sapiens OX=9606 GN=CD82 PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.100e-14
Identity = 65/260 (25.00%), Postives = 125/260 (48.08%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFE-----KETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAKR 833
            GAVILG G+W+  DKS+   +++             T+SS   + A + I +GA T + GF GC GA+ E  CLL +Y   +  +++AQV  G        K +  +   + +++ +D+N   SS        +  +  ++KCCG    + +N   +A  + +N  +  +P  C           +E  +L+V +   E P    +     ++  + Q+GC+  +   ++ +L I++GV +G+ + E+L +V + C+ + 
Sbjct:   24 GAVILGFGVWILADKSSFISVLQ-------------TSSSSLRMGAYVFIGVGAVTMLMGFLGCIGAVNEVRCLLGLYFAFLLLILIAQVTAGALFYFNMGKLKQEMGGIVTELI-RDYN---SSREDSLQDAWDYVQAQVKCCGWV--SFYNWTDNA--ELMNRPEVTYPCSC-------EVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRH 255          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|P28648|CD63_RAT (CD63 antigen OS=Rattus norvegicus OX=10116 GN=Cd63 PE=1 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 2.964e-13
Identity = 61/227 (26.87%), Postives = 108/227 (47.58%), Query Frame = 3
Query:  153 ETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFE-KETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAK 830
            + A +  +T  SL  +V   +I +GAF F+  F GCCGA KE+ CL+  ++  ++ +++ +VAV I   V +++ ++   KS      K     L+ N +    +   L  E KCCG     D       W++     K   P  CC             +N+TV         C  + KE+ ++ +GCV ++   ++ ++ +V G  +G+   E+L I+F+CC+ K
Sbjct:   40 KQAITHETTAGSLLPVV---IIAVGAFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAVAIAGYVFRDQVKSEFSKSF----QKQMQNYLTDNKT--ATILDKLQKENKCCGASNYTD-------WERIPGMAKDRVPDSCC-------------INITV--------GCGNDFKESTIHTQGCVETIAAWLRKNVLLVAGAALGIAFVEVLGIIFSCCLVK 229          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|Q6AYR9|TSN1_RAT (Tetraspanin-1 OS=Rattus norvegicus OX=10116 GN=Tspan1 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.536e-12
Identity = 63/229 (27.51%), Postives = 98/229 (42.79%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAI--ILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSH 749
            GA +L VGIWV VD ++              K+F S +SS    V +   LI  GA  FI GF GC GA  E+ C+L M+  ++  + +A++A  + A V     +  L   ++  + KD+        + FT+V+ + M  + CCG     DFN              ++ P  CC      H           VE   ED      K   +N +GC   ++ KI+++
Sbjct:   22 GAALLAVGIWVSVDGTSFL------------KAFGSLSSSAMQFVNVGYFLIAAGAVLFILGFLGCYGAHSENKCVLMMFFSILLIIFIAEIAGAVVALVYTTMAEQFLTFLVVPAIEKDY-----GYQTEFTQVWNSTMEGLHCCGFNNYTDFN------SSRFVKENKVFPPFCCANNTDSH----------TVEPCTED------KAKSMNVQGCFKQILQKIRTN 211          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A1I8GD10 (Tetraspanin OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006680g1 PE=3 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 3.228e-35
Identity = 96/277 (34.66%), Postives = 141/277 (50.90%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINL-----DETAKSFSSTNSS-LFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDF-------NGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAW---KQTINGRKQIHPIGCCKLKN-------SFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAK 830
            GA  +GVGIWV V+KS+LF ++  I+      D   +  S  N + L  +   ILI +GAFT + GFCGCCGA+KES CLL MY+FLV  V+  +V   I A+V Q + +   E  +  +  K F       + + S N    T +   L     CCG K   D      +W    ++  GR+   PI CC+++        +  +N   KLN T+V     DP+C F   T+ + K C   ++D I      +IGVC G+ +FE+ CI+ ACC+ +
Sbjct:   23 GAASVGVGIWVAVNKSDLFRVINLIDARVDQGDNKGQIDSVANQNGLVTVAGFILIGIGAFTLVVGFCGCCGAVKESKCLLGMYAFLVGLVLAVEVTAAILAAVYQARIRTAAEDGMYGLQEKMFVAMTDYLSDSTSDNNKTVTTLINYLQMSFDCCGAKKPGDIAN-SSSWLLSNRSWEGRELQTPITCCQIRQDQKTAAAAPGYNWVSKLNGTLV-----DPSCPFTGTTQ-HTKTCYSGIMDFIGKFAGPLIGVCAGIAVFELFCIIVACCLVR 292          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A267ERG2 (Tetraspanin OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023279g1 PE=3 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 6.910e-35
Identity = 98/277 (35.38%), Postives = 143/277 (51.62%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINL-----DETAKSFSSTNSSLFDIVA-IILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDF-------NGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAW---KQTINGRKQIHPIGCCKLKN-------SFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAK 830
            GA  +GVGIWV V+KS+LF ++  I+      D   +  S  N +   +VA  ILI +GAFT + GFCGCCGA+KES CLL MY+FLV  V+  +VA  I A+V Q + +   E  +  +  K F       + + S N    T +   L     CCG K   D      +W    ++  GR+   PI CC+++        +  +N   KLN T+V     DP+C F   T+ + K C   ++D I      +IGVC G+ +FE+ CI+ ACC+ +
Sbjct:   23 GAASVGVGIWVAVNKSDLFRVINLIDARVDQGDNKGQIDSVANQNGLVMVAGFILIGIGAFTLVVGFCGCCGAVKESKCLLGMYAFLVGLVLAVEVAAAILAAVYQARIRTAAEDGMYGLQEKMFVAMTDYLSDSTSDNNKTVTTLINYLQMSFDCCGAKKPGDIAN-SSSWLLSNRSWEGRELQTPITCCQIRQDQKTAAAAPGYNWVSKLNGTLV-----DPSCPFTGTTQ-HTKTCYSGIMDFIGKFAGPLIGVCAGIAVFELFCIIVACCLVR 292          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A267EG05 (Tetraspanin OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020731g1 PE=3 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 2.271e-34
Identity = 100/292 (34.25%), Postives = 167/292 (57.19%), Query Frame = 3
Query:    9 FCESISKXXXXXXXXXXXXXGAVILGVGIWVKVDKSNLFEMMR-------NINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDF---NGALS--SNP-SMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQT---INGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFE-KETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAKR 833
             C  I+KL+L+I NI F + GA I+GV IWV V   ++F+++        NIN +ET  S+ S+ S+L    A ++++ GA +F+ GFCGCCGAI+ESSCLL +Y+  V+ V++ ++A GI A V + +    +  +L ++ A  +   N A+S  SNP ++F+ +       M CCGV   +D  G+   W  +    NG+  + P+ CCK+       S +  N T +++ + D NC +    +++N++GC   L   I  +   +I V I +G+FEI+C+V AC + ++
Sbjct:    1 MCHCINKLVLVIVNIVFLLAGAAIVGVSIWVIVSADSMFKLVHLATQGSDNIN-NETLMSYKSSTSTLVA-AAYVILVFGALSFLIGFCGCCGAIRESSCLLSIYAGAVSIVLIVEIAGGIAAGVFRAQIGTEMLPTLRRLEATRYLPINLAVSNDSNPNAVFSSLVNYAQVSMSCCGVSSMSDITGVNTLWTNSSRQYNGKTIVVPVTCCKMNKKDELLSHQ--NWTRIDDYLIDRNCPYNASSSQINKEGCYDKLNSYIDRYTLAIIVVGILVGMFEIICVVMACSMVQK 288          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A267FTC4 (Tetraspanin OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020731g3 PE=3 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 2.497e-34
Identity = 100/292 (34.25%), Postives = 167/292 (57.19%), Query Frame = 3
Query:    9 FCESISKXXXXXXXXXXXXXGAVILGVGIWVKVDKSNLFEMMR-------NINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDF---NGALS--SNP-SMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQT---INGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFE-KETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAKR 833
             C  I+KL+L+I NI F + GA I+GV IWV V   ++F+++        NIN +ET  S+ S+ S+L    A ++++ GA +F+ GFCGCCGAI+ESSCLL +Y+  V+ V++ ++A GI A V + +    +  +L ++ A  +   N A+S  SNP ++F+ +       M CCGV   +D  G+   W  +    NG+  + P+ CCK+       S +  N T +++ + D NC +    +++N++GC   L   I  +   +I V I +G+FEI+C+V AC + ++
Sbjct:    1 MCHCINKLVLVIVNIVFLLAGAAIVGVSIWVIVSADSMFKLVHLATQGSDNIN-NETLMSYKSSTSTLVA-AAYVILVFGALSFLIGFCGCCGAIRESSCLLSIYAGAVSIVLIVEIAGGIAAGVFRAQIGTEMLPTLKRLEATRYLPINLAVSNDSNPNAVFSSLVNYAQVSMSCCGVSSMSDITGVNTLWTNSSRQYNGKTIVVPVTCCKMNKKDELLSHQ--NWTRIDDYLIDRNCPYNASSSQINKEGCYDKLNSYIDRYTLAIIVVGILVGMFEIICVVMACSMVQK 288          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A1I8GBP6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010912g1 PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 3.130e-30
Identity = 93/280 (33.21%), Postives = 136/280 (48.57%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFS---------STNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSL--------IKIVAKDFNGALSSNPSMFTKVFTALM----FEMKCCGVKGEADFNGIGDAWKQT---INGRKQIHPIGCCKLKNSFHFNS--KEKLNLTVVENTMEDPNCIFEKETK-LNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVA 827
            G   L VGIWV   K  LF   R INL +   S           +  S L  I A +LI +G FT + GFCGCCGAIKES+CLL+ Y+ L+  V+  ++   I A+V QN+ +   EK+L        + I   +   A ++         T L+        CCG +   D      +W  +     GR  ++P+ CC+LK+S           N T  ++ ++D NC F   +  LNQK C   L+D I  +   +IGVC+ +GL E++ I+ ACC+A
Sbjct:   23 GVASLAVGIWVTASKDELF---RFINLLDGQISAGDGKEQIDTVANQSGLIVIAAYVLIGVGVFTLLVGFCGCCGAIKESTCLLYTYAALIGIVLTIEIVTAILAAVFQNRIRGTAEKALFDLQNNYFVSIPTYEATKAKTTGNDAAKAAVTYLLNLAQISFDCCGAQQVNDIKN-SSSWLGSDLKFKGRTLVNPMTCCQLKSSSLKTEIKSPAFNWTNFDSYLQDSNCPFTANSPALNQKTCYQGLLDYINKYSLPLIGVCVAIGLIELVGILLACCLA 298          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan11 (tetraspanin-11-like [Source:NCBI gene;Acc:103024246])

HSP 1 Score: 82.4185 bits (202), Expect = 4.414e-18
Identity = 64/255 (25.10%), Postives = 110/255 (43.14%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAKR 833
            G V++ VGIW  +DK     ++                SS F + A ILI+ GA   +TGF GCC  I+E   LL  Y   +  + + ++  G+ A V   +    L++ L K + ++++          T+    L  + KCCG    +D+      + Q+   + ++ P  CCK              +T      + P+ I++ E      GC+  L   +  HL I+  V IG+   +I  +VF CC+ ++
Sbjct:   32 GGVVMAVGIWTLIDKGEYLSLL---------------ASSTFAVSAYILILAGALVMVTGFLGCCAVIREQRSLLSTYFSCLLLIFLIELVAGVLAYVYYQRLSEELKQHLSKTMTENYD---QLGKEGITRAVDRLQQDFKCCGSNNSSDWK--HSVYVQSPEAQGRVVPDSCCK-------------TITPECGRRDHPSNIYKVE-----GGCITKLEHFLADHLLIIGAVGIGVACLQICGMVFTCCLHRQ 248          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan18a (tetraspanin 18 [Source:NCBI gene;Acc:103047105])

HSP 1 Score: 75.485 bits (184), Expect = 9.284e-16
Identity = 67/258 (25.97%), Postives = 117/258 (45.35%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSC-LLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGR---KQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAK 830
            GA +LGVGIWV VD +   E++             + N  LF  V +IL  +G   F+ GF GCCGAI+E+ C LLF+ +FL               +++ + F   L+          + G  S++  +FT  +  +M   +CCGV    DF+      +Q++  R    ++ P  CC+ +N    N +E L                +   ++  KGC  +++D  ++++ +   + I +   E+  +VFA C+ +
Sbjct:   24 GAFLLGVGIWVLVDPTGFREIV-------------AANPLLFTGVYVILA-MGGMLFLLGFLGCCGAIRENKCLLLFVSTFL------------KPENLRLDYFTKELKTY--------YQG--SNSTDVFTATWNTIMTTFECCGVNSADDFD------QQSLFRRLYPSRLVPEECCQ-RNDLLMNKEECL----------------KGIMQIRNKGCYSAVVDYFETYIYMAGALAIVVLTIELFAMVFAMCLFR 222          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan18b (tetraspanin-18-like [Source:NCBI gene;Acc:103035514])

HSP 1 Score: 74.7146 bits (182), Expect = 2.991e-15
Identity = 70/255 (27.45%), Postives = 116/255 (45.49%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKS-LIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAK 830
            G+ +LGVG+W+ VD ++  E++             + N  LF  V IIL  +G   F+ GF GCCGA++E+ CL           I+      +  ++    F+  L K    K + K + G  +S+  + T  + A+M    CCGV    DF    ++    +N   Q+ P  CC+ KNS         +L  V  + +D  C+       N KGC  S++D  + ++ I   + I +   E+  ++FA C+ K
Sbjct:   36 GSFLLGVGVWMLVDPTDFREIV-------------AANPLLFTGVYIILA-MGGMLFLLGFLGCCGALRENKCL----LLFFFMFILVIFLAELATAILAFIFREHLTKEYFTKELRKHYQGYNTSD--VLTTTWNAIMKTFDCCGVNSPEDFE---ESLFHVLN-PSQVVPEACCR-KNS---------HLGDVSFSNKD-ECLSGNMLYRNNKGCYSSVVDYFEMYIYIAGALAIVVLTIELFAMIFAMCLFK 255          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan11 (tetraspanin-11-like [Source:NCBI gene;Acc:103024246])

HSP 1 Score: 74.3294 bits (181), Expect = 4.208e-15
Identity = 61/251 (24.30%), Postives = 104/251 (41.43%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACC 821
            G V++ VGIW  +DK     ++                SS F + A ILI+ GA   +TGF GCC  I+E   LL  Y   +  + + ++  G+ A V   +    L++ L K + ++++          T+    L  + KCCG    +D+      + Q+   + ++ P  CCK              +T      + P+ I++ E      GC+  L   +  HL I+  V IG+   ++   V   C
Sbjct:   32 GGVVMAVGIWTLIDKGEYLSLL---------------ASSTFAVSAYILILAGALVMVTGFLGCCAVIREQRSLLSTYFSCLLLIFLIELVAGVLAYVYYQRLSEELKQHLSKTMTENYD---QLGKEGITRAVDRLQQDFKCCGSNNSSDWK--HSVYVQSPEAQGRVVPDSCCK-------------TITPECGRRDHPSNIYKVE-----GGCITKLEHFLADHLLIIGAVGIGVACLQLAGAVLTAC 244          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan35 (tetraspanin-1-like [Source:NCBI gene;Acc:103021497])

HSP 1 Score: 72.4034 bits (176), Expect = 1.482e-14
Identity = 71/246 (28.86%), Postives = 113/246 (45.93%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIV---AKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEI 797
            GA IL VGIWVKVD  ++   ++N+N +   +     N      V  +LI LG+   + GF GCCGA++ES C+L ++  ++  V +A+VA  I   V +   Q  + +  + IV    KD+      NP + T +    M  +KCCG      FN   D    T +     +P  CC              N+T+      + N I  K       GC ++L+  + S+  I++GV +G+   E+
Sbjct:   22 GAGILAVGIWVKVDSGSILNFLQNLN-NAPGELKQVLN------VGYLLIALGSVLMVMGFLGCCGAVRESRCMLLLFFVILLIVFIAEVAGAIVLLVFKGVVQQLITEVGVIIVNSIKKDY----GKNPDI-TGLLNTTMNTLKCCG------FNNYTDFRNSTFSNNGTTYPPYCC--------------NVTIC----NEGNAIIAK-----VPGCFLALVSLVNSNASIIVGVALGIAALEL 226          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: CD151 (CD151 molecule (Raph blood group) [Source:HGNC Symbol;Acc:HGNC:1630])

HSP 1 Score: 67.781 bits (164), Expect = 1.552e-13
Identity = 57/254 (22.44%), Postives = 100/254 (39.37%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAK 830
            GA ++ VG+W  V+K +   ++                SS F   A ILI+ G+   +TG  GCC  ++E    L  Y  L+  + + +V  GI A + + +    L+  + K + + +      +    T     L  E KCCG     D+      W +      ++ P  CCK   +         N+  VE                   GC+  L   ++ HL ++  V IG+   ++L ++  CC+ +
Sbjct:   32 GAGVMAVGVWTLVEKGDYLSLL---------------ASSTFAATAYILILAGSVVMLTGLLGCCAVVRERRGCLAAYCGLLLLIFLLEVIAGILAYLYRQQLSEELKSHMNKTIVESYG---QPDQQRVTDAMDKLQQEFKCCGSHDWNDWQ--RSDWVKVAAAEGRLVPDSCCKSPTTRCGRRDHPSNINRVEG------------------GCITKLEVILQEHLLLIGAVGIGVACLQVLGMILTCCLYR 247          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009492.1 (pep scaffold:Pmarinus_7.0:GL476618:258874:270129:-1 gene:ENSPMAG00000008573.1 transcript:ENSPMAT00000009492.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 1.007e-11
Identity = 47/212 (22.17%), Postives = 93/212 (43.87%), Query Frame = 3
Query:  198 IVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAKR 833
            + A+ +I+ GA   + G  GC  A++ES C L  ++ L+  +   +VA      +   K +  +++ +     K F   +  +    ++    +  E++CCG    +D+N    A +   N      P+ CCK                    + ++   +     KL Q+GC++ L D+++  L  +IGV +G    +++ +V AC +A R
Sbjct:   52 LPALAIIVAGAVLLLIGVIGCWAAVRESRCALASFALLLLIIFSLEVAAVALGYIYHGKVEVEVQQKM----HKAFQNYMGPDYDPESRAVDYMQKELQCCGFANYSDWNTTEWARRHKYNSV----PLSCCK-------------------RSAKNCTGLLSLPAKLYQQGCLLKLGDEVQQILTYLIGVAVGFAFLQVMGLVAACVIACR 236          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: cd82b (CD82 molecule b [Source:ZFIN;Acc:ZDB-GENE-030131-2857])

HSP 1 Score: 58.9214 bits (141), Expect = 1.775e-10
Identity = 55/249 (22.09%), Postives = 112/249 (44.98%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQ------IHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEI 797
            G +I+G G+W+  D+ +    +  + +D   +           I A  L+ +G+ T +    GC GA KE  CLL +Y   +  ++VAQVA+G    + + K   +L      I+   +N + + +P    +++ ++  +  CCG+ G  D       WK  +    Q       +P  C        FN+      +V ++      CI      + ++GC + + D +++++ +++ VC+ + +FE+
Sbjct:    3 GLIIMGFGLWIVYDQQSF---INTVVIDGNVE---------LTIPAYALVGIGSITCLVSLFGCLGASKEVRCLLAVYFICLVGLLVAQVAIGTVVYINKEKINNKLNGVAFNIIKSYWNLS-TEDPLHTWRLWDSIQQKFNCCGLNGTED-------WKDNVYICDQATYPDITYPCSC--------FNNSS----SVQKDHNNTQFCISSPTFAIAEQGCEMHIKDWLQANMSVILAVCVAIAVFEV 219          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: tspan18b (tetraspanin 18b [Source:ZFIN;Acc:ZDB-GENE-040718-137])

HSP 1 Score: 55.8398 bits (133), Expect = 2.349e-9
Identity = 35/130 (26.92%), Postives = 62/130 (47.69%), Query Frame = 3
Query:  453 MFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGR---KQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAKR 833
            +F++ + + M    CCGV+G +DF      W+ T+  +    +I P  CCK     H  S+          TM+   C+       N++GC   ++  + +++  V GV IGL L ++L + F  C+ +R
Sbjct:  151 VFSRFWNSAMKTFGCCGVRGPSDF------WEGTLFWQLSSGKIIPEACCK--GDIHEESQA---------TMDRLRCLLGDPRHRNEQGCYTKIMQSLHNYILTVGGVVIGLLLIQLLAMSFTLCLFRR 263          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000426.1 (pep scaffold:Pmarinus_7.0:GL477652:123953:135969:-1 gene:ENSPMAG00000000383.1 transcript:ENSPMAT00000000426.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 5.690e-9
Identity = 35/140 (25.00%), Postives = 68/140 (48.57%), Query Frame = 3
Query:  411 VAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAK 830
            + K + G   +N  +F+K +  +M  +KCCGV G  DF G    + +    + Q  P  CCK +     N +E  ++       +DP+         N++GC ++++   + ++ +V  V IG+   E+  ++FA C+ +
Sbjct:   19 LKKQYRG--DNNTDVFSKTWNTIMISLKCCGVSGVDDF-GKDSVFHELY--QMQPMPEACCKRQ----MNGQEGHSINKTRCFSQDPDF-------YNKEGCYLTMLKSFQMYVYVVGAVGIGVLAIELFAMIFAICLFR 142          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO30837 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZN5])

HSP 1 Score: 75.485 bits (184), Expect = 4.662e-16
Identity = 67/255 (26.27%), Postives = 115/255 (45.10%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSM-FTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEK-LNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVA 827
            G  +L VGIW ++  S+  ++                +S  +   A ILI +G    I GF GCCGA+KE +CLL  +  ++  + + ++   I   + +++ +  L   L        + AL   P   F   +  +   +KCCG +   D+  +  A   T NG     P  CCK       ++K K  NL V+ +           ET  +++GC  + +   +  L I+ GV +GL +F+++ I F+CC+A
Sbjct:   28 GLSVLAVGIWARIQFSDYMKL----------------SSHDYATAAYILIGIGFLIAIIGFIGCCGALKEHTCLLKTFGVILGLLFLVELGTAITGYIFRSEIKTGLSDGL--------DTALKDYPEQGFKDAWNDMQKNLKCCGSRNYTDWFMVAWAGPNTKNGSV---PESCCK-------DTKVKSCNLEVLSH----------PETINSEQGCYGAAVKYFEDKLVIIGGVALGLAVFQLIGIAFSCCLA 238          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO35938 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK25])

HSP 1 Score: 73.9442 bits (180), Expect = 1.352e-15
Identity = 70/261 (26.82%), Postives = 109/261 (41.76%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSS-TNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSL--------IKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCV 824
            G  +LG+GIW KVD                A  F S   SS + I A  +I  GAF    GF GCCGA+KES C+L  +       +   + + +  S Q N F+  L+  L        IKI   +         S        L   +KCCG  GE   + +G  WK+ +N + +I P+ CC           E  N T             +   ++   GCV  L   +  H+ ++  + +G+ + ++L ++F+CC+
Sbjct:   22 GLAVLGIGIWTKVD----------------AGQFDSFLGSSGYSIPAWTMIGAGAFVTFVGFFGCCGAVKESRCMLATW-------LKYLLTILLSLSKQVNLFELYLKFFLLWHQVQEEIKINLDEQIRNTYGYDSEVESHINNLQIRLKCCG--GERPGDWLGSKWKRDLN-KDKIVPLSCC----------TENANKTTCYKD--------DTYKEVYSSGCVNELKTFVDKHMILIGAIAVGISIVQLLGMIFSCCL 238          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO35917 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK24])

HSP 1 Score: 67.3958 bits (163), Expect = 2.780e-13
Identity = 74/253 (29.25%), Postives = 115/253 (45.45%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGV-KGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCV 824
            G  ++ VGIW +V  +    +M                 S F   A I+I  GA     GF GCCGA+KE+ C L +Y FL+  + V ++A GI A  +++K  + +EK+L + ++ D+     SN    TK         KCCG  +G  D+     AW ++     Q  P  CCK K +                   D +  +       QKGC   L D IKSH+K + G+ +G+ + +IL ++F+ C+
Sbjct:   24 GIAVMSVGIWTRVSANEYASLM---------------GQSGFTAAANIMIAAGALVMFIGFVGCCGAVKENKCFLLLYFFLLLVIFVLEIASGILAYTKRDKVISSVEKALNQSISLDYG---QSNKEKATKAVDRAQSIFKCCGATQGPKDW--ANTAWAKS--NTNQTVPESCCKKKAA------------GCNGAPADSDTYY-------QKGCSQGLQDFIKSHMKTLGGIGLGIAIIQILGMIFSLCL 235          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO46887 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNN8])

HSP 1 Score: 64.6994 bits (156), Expect = 2.924e-12
Identity = 67/253 (26.48%), Postives = 111/253 (43.87%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSL-FDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCV 824
            G  I  +G+W+   K            DE A  +S    ++ +    I+ I++G  T I  F  CCGA+KES C+L  Y  LV A+   +V   + A V    ++ R+EK+L   +    N    S     T+    +  + KCCG     D+      W +T      + P  CCK        S  K N    EN  +DP       TK+ ++GC + +   + ++L ++ G  I + + +++ I+FA C+
Sbjct:   13 GCAIFAIGVWIISSK------------DEVAGDYSRLTGTINYKTAPILCIVIGIVTVIVAFLACCGALKESQCMLGTYFGLVTAIFCLEVTAIVLAYV----YRERIEKNLHGDIRSTMNEYHLSGHDAVTRAIDEIHRDFKCCGNAQYRDW--FETKWAKT---HPDMVPRSCCKDP------SDSKCN----ENISKDP-------TKIYRRGCYMFVKKYLSNNLHVISGFGIWIAVIQLMGIIFATCL 227          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO34309 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPQ7])

HSP 1 Score: 62.7734 bits (151), Expect = 1.326e-11
Identity = 53/228 (23.25%), Postives = 95/228 (41.67%), Query Frame = 3
Query:  147 LDETAKSFSSTNSSLFDIV-AIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIH-PIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCV 824
            L ++  ++S   S  + IV A I++ +G    +T   G CG  +ES C L ++  L+  V   ++  G+  ++ +N+ +  ++  L   +        S     F K    L   + CCG  G  D       W  +   +++ H P  CC                        D +  F  +   N KGC  +L+DK   +L  +IG+ IG  + +++ ++ ACCV
Sbjct:   29 LMQSYGNYSKITSDTYTIVPAGIIVGVGCLVLVTALVGICGTCRESKCCLSIFFILLLVVFSLEITAGVLGAIYKNQAKDEVKNGLTDAIDH-----YSKEEQGFQKAVDKLQENLDCCGSTGPND-------WVNSTFWKEKHHLPKSCCT----------------------HDSDVCFPYDKFHNTKGCYTTLLDKFNKNLSYIIGIGIGFAVLQLIGMLSACCV 222          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: tspan11 (tetraspanin 11 [Source:NCBI gene;Acc:101168088])

HSP 1 Score: 84.7297 bits (208), Expect = 6.497e-19
Identity = 64/255 (25.10%), Postives = 112/255 (43.92%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAKR 833
            GA +LGVG+W  V+KS+   ++                SS F + A ILI+ G+   +TGF GCC  I+E    L +Y F +  + + ++  G+ A V   +    L++ L + +++++           T     L  + KCCG     D+      +  +I   +++ P  CCK              +T      + P+ I++ E      GC+  L   +  HL ++  V IG+   +I  +VF CC+ +R
Sbjct:   32 GAAVLGVGVWTLVEKSDYLSLL---------------ASSTFAVSAYILILAGSLVVVTGFLGCCAVIRERRRCLSVYFFFLLVIFLIELVAGVLAYVYYQRLSEELKQHLNQTMSENYA---QPGKEAITAAVDRLQQDFKCCGSNNSQDWA--HSVYISSIAAEQRVVPDSCCK-------------TITHACGKRDHPSNIYKVE-----GGCITKLEQFLADHLLVIGAVGIGVACLQICGMVFTCCLYRR 248          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: tspan11 (tetraspanin 11 [Source:NCBI gene;Acc:101168088])

HSP 1 Score: 73.559 bits (179), Expect = 8.030e-15
Identity = 58/243 (23.87%), Postives = 104/243 (42.80%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEI 797
            GA +LGVG+W  V+KS+   ++                SS F + A ILI+ G+   +TGF GCC  I+E    L +Y F +  + + ++  G+ A V   +    L++ L + +++++           T     L  + KCCG     D+      +  +I   +++ P  CCK              +T      + P+ I++ E      GC+  L   +  HL ++  V IG+   ++
Sbjct:   32 GAAVLGVGVWTLVEKSDYLSLL---------------ASSTFAVSAYILILAGSLVVVTGFLGCCAVIRERRRCLSVYFFFLLVIFLIELVAGVLAYVYYQRLSEELKQHLNQTMSENYA---QPGKEAITAAVDRLQQDFKCCGSNNSQDWA--HSVYISSIAAEQRVVPDSCCK-------------TITHACGKRDHPSNIYKVE-----GGCITKLEQFLADHLLVIGAVGIGVACLQV 236          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: tspan11 (tetraspanin 11 [Source:NCBI gene;Acc:101168088])

HSP 1 Score: 73.559 bits (179), Expect = 8.030e-15
Identity = 58/243 (23.87%), Postives = 104/243 (42.80%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEI 797
            GA +LGVG+W  V+KS+   ++                SS F + A ILI+ G+   +TGF GCC  I+E    L +Y F +  + + ++  G+ A V   +    L++ L + +++++           T     L  + KCCG     D+      +  +I   +++ P  CCK              +T      + P+ I++ E      GC+  L   +  HL ++  V IG+   ++
Sbjct:   32 GAAVLGVGVWTLVEKSDYLSLL---------------ASSTFAVSAYILILAGSLVVVTGFLGCCAVIRERRRCLSVYFFFLLVIFLIELVAGVLAYVYYQRLSEELKQHLNQTMSENYA---QPGKEAITAAVDRLQQDFKCCGSNNSQDWA--HSVYISSIAAEQRVVPDSCCK-------------TITHACGKRDHPSNIYKVE-----GGCITKLEQFLADHLLVIGAVGIGVACLQV 236          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: tspan11 (tetraspanin 11 [Source:NCBI gene;Acc:101168088])

HSP 1 Score: 73.1738 bits (178), Expect = 9.044e-15
Identity = 59/251 (23.51%), Postives = 106/251 (42.23%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACC 821
            GA +LGVG+W  V+KS+   ++                SS F + A ILI+ G+   +TGF GCC  I+E    L +Y F +  + + ++  G+ A V   +    L++ L + +++++           T     L  + KCCG     D+      +  +I   +++ P  CCK              +T      + P+ I++ E      GC+  L   +  HL ++  V IG+   +++      C
Sbjct:   32 GAAVLGVGVWTLVEKSDYLSLL---------------ASSTFAVSAYILILAGSLVVVTGFLGCCAVIRERRRCLSVYFFFLLVIFLIELVAGVLAYVYYQRLSEELKQHLNQTMSENYA---QPGKEAITAAVDRLQQDFKCCGSNNSQDWA--HSVYISSIAAEQRVVPDSCCK-------------TITHACGKRDHPSNIYKVE-----GGCITKLEQFLADHLLVIGAVGIGVACLQLVGAFLTAC 244          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: ENSORLT00000000775.2 (CD82 antigen [Source:NCBI gene;Acc:101156312])

HSP 1 Score: 72.7886 bits (177), Expect = 1.172e-14
Identity = 70/275 (25.45%), Postives = 136/275 (49.45%), Query Frame = 3
Query:   12 CESISKXXXXXXXXXXXXXGAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFE-KETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAKR 833
            C + SK  L + N+ FF++G VILG G+W+ +D  +   ++ N              S+   +   +LI +GAF+ + G  GC GAI +  CLL +Y   +  ++VAQ+A G+   +Q+ K   ++ K + K++     G+ + N S   + +  +  +M+CCG  G+ D+N         +N  + + P  C            + L LT V+N  +   C  +  +  +   GC  S+ + + +++ +V+G+C+ + L E+L ++ + C+ + 
Sbjct:    5 CMTASKYFLFLLNLIFFLLGGVILGFGLWLLLDNQSFIVIINN--------------STDVKVACYVLISVGAFSMLLGLFGCLGAIFQIKCLLGLYFTCLLVILVAQIAAGVLVYLQKEKVNEQMSKIVDKVL-----GSYAGNSSRTEQAWDLIQKKMQCCGWMGQEDWNNNA----VILNSSQLLFPCSC------------QNLTLT-VQNRSDSGFCEAQTPDWPVYNVGCSASVENWLITNIGVVLGICLTVALIELLGMILSICLCRN 243          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000019444.1 (SMESG000019444.1)

HSP 1 Score: 448.743 bits (1153), Expect = 7.096e-161
Identity = 240/243 (98.77%), Postives = 243/243 (100.00%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEI 797
            GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLVAAVIVAQVAVGIYASVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTI+GRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENT+EDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFE+
Sbjct:   23 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLVAAVIVAQVAVGIYASVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTISGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTIEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEV 265          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000019444.1 (SMESG000019444.1)

HSP 1 Score: 452.595 bits (1163), Expect = 1.057e-157
Identity = 242/243 (99.59%), Postives = 243/243 (100.00%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEI 797
            GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLVAAVIVAQVAVGIYASVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFE+
Sbjct:  336 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLVAAVIVAQVAVGIYASVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEV 578          

HSP 2 Score: 448.743 bits (1153), Expect = 3.161e-156
Identity = 240/243 (98.77%), Postives = 243/243 (100.00%), Query Frame = 3
Query:   69 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEI 797
            GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLVAAVIVAQVAVGIYASVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTI+GRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENT+EDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFE+
Sbjct:   23 GAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLVAAVIVAQVAVGIYASVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTISGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTIEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEV 265          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000019443.1 (SMESG000019443.1)

HSP 1 Score: 341.658 bits (875), Expect = 2.268e-118
Identity = 185/279 (66.31%), Postives = 226/279 (81.00%), Query Frame = 3
Query:    3 MGFCESISKXXXXXXXXXXXXXGAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAKRDD 839
            M FCESI+KLLLIIFNICFF+IGA+ILG+GIWVK+DKSNLFEM+RNI L+ETA SF +TNSSLFD +AI LI+LGA TFITGFCGCCGAIKES CLLF+YS  V  VIV Q+ VGIYA VQ+NK Q  LE SL+ ++  +FNG +S NPSMFTK  TA+MFEMKCCG++ E DF      WKQTI G+ Q+HPIGCCK+K SF F+S+ KLN T++ + + DP C   K TKLN +GC+  LI+KI+++L IVI VC+GLGLFE+LCIVFACCVA+R++
Sbjct:    1 MSFCESIAKLLLIIFNICFFLIGALILGIGIWVKIDKSNLFEMLRNIKLEETASSFDNTNSSLFDTIAIFLIVLGAITFITGFCGCCGAIKESQCLLFLYSLFVTVVIVGQIGVGIYAGVQKNKVQYYLESSLVSVLENEFNGIISPNPSMFTKALTAIMFEMKCCGIRNENDFKITKQNWKQTIQGQNQVHPIGCCKIKQSFSFDSENKLNYTILSDILVDPLCPVTKATKLNYEGCISVLIEKIRNNLTIVISVCVGLGLFEMLCIVFACCVARRNN 279          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000019419.1 (SMESG000019419.1)

HSP 1 Score: 274.248 bits (700), Expect = 6.981e-92
Identity = 153/278 (55.04%), Postives = 209/278 (75.18%), Query Frame = 3
Query:    3 MGFCESISKXXXXXXXXXXXXXGAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAKRD 836
            MGFC S+ ++LL+I   C F+IG +ILGVGIW+KV+KSNLF++M   NL++TA SF S ++SLF+++ I LI++G FTF+TGF GCCGA+ E+ C L  Y+ +V+ +I+ Q+AVGIYA  Q++K+     K L+K++ KDFNG LS NPSMFTKVFTA MFE++ CG++GEADF      W+Q+I G  QIHP+ CC+LK  F +NSK+KLN + + N MEDP+C     TKLN  GC+++LI K+KS+L  VIG+C+GL LFEILC+V AC + KRD
Sbjct:    1 MGFCSSLGQVLLVIVTSCLFVIGGIILGVGIWIKVNKSNLFQIMSKTNLEQTAASFGSMDNSLFEVMGITLIVVGTFTFVTGFLGCCGALTENHCYLKTYAIIVSFIIICQIAVGIYAGTQKSKY-----KVLLKVLIKDFNGMLSPNPSMFTKVFTATMFELEYCGIRGEADFGQTSQKWQQSIQGLTQIHPVACCELKEPFPYNSKDKLNYSALANIMEDPSCPVRLVTKLNSIGCILALIQKLKSNLSFVIGICVGLSLFEILCVVCACSIIKRD 273          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000019440.1 (SMESG000019440.1)

HSP 1 Score: 270.396 bits (690), Expect = 2.357e-90
Identity = 155/278 (55.76%), Postives = 206/278 (74.10%), Query Frame = 3
Query:    3 MGFCESISKXXXXXXXXXXXXXGAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLXXXXXXXXXXXXXXXSVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEILCIVFACCVAKRD 836
            MGFC S+ ++LL+I   C F+IG +ILGVGIW+KV+KSNLF++M   NLD+TA SF   NS +F+++ I LI++GA  F+TGF GCCGA+ E+ C L  Y+ +V  +IV Q+AVGIYA VQ++KFQ +LE SL K +  DFNG LS+NPS FTK F+  MF+++CCGVKGE DF      W+Q+I G  QIHP+ CCKLK  F +++ EKLN +V+ N MEDP+C  +  TKLN  GC  + ID IKS+L +VIG+C+GLGLFEILC+VFAC + KR+
Sbjct:    1 MGFCSSLGQVLLVIVTSCLFVIGGIILGVGIWIKVNKSNLFQVMNKTNLDKTAVSFDYMNS-IFEVMGITLIVVGAIIFVTGFLGCCGALTENHCYLQTYAIIVCFIIVCQIAVGIYAGVQKSKFQPQLESSLFKALINDFNGLLSANPSDFTKAFSVTMFDLECCGVKGETDFTKTTQKWQQSIQGLTQIHPVACCKLKEPFSYDTDEKLNYSVLANIMEDPSCPVKLITKLNSIGCFQTTIDIIKSNLSLVIGICVGLGLFEILCVVFACSIIKRN 277          
The following BLAST results are available for this feature:
BLAST of Tetraspanin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CD822.290e-1525.00CD82 molecule [Source:HGNC Symbol;Acc:HGNC:6210][more]
CD821.262e-1223.57CD82 molecule [Source:HGNC Symbol;Acc:HGNC:6210][more]
TSPAN32.631e-1225.93tetraspanin 3 [Source:HGNC Symbol;Acc:HGNC:17752][more]
CD371.151e-1125.19CD37 molecule [Source:HGNC Symbol;Acc:HGNC:1666][more]
CD371.970e-1125.29CD37 molecule [Source:HGNC Symbol;Acc:HGNC:1666][more]
back to top
BLAST of Tetraspanin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tsp-111.841e-1025.86Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q17526][more]
tsp-111.841e-1025.86Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q17526][more]
tsp-172.445e-924.22Tetraspanin-17 [Source:UniProtKB/Swiss-Prot;Acc:Q... [more]
tsp-171.139e-822.35Tetraspanin-17 [Source:UniProtKB/Swiss-Prot;Acc:Q... [more]
tsp-69.200e-825.00Tetraspanin [Source:UniProtKB/TrEMBL;Acc:G4RWX0][more]
back to top
BLAST of Tetraspanin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tsp66E8.247e-1625.95gene:FBgn0035936 transcript:FBtr0076507[more]
Tsp66E8.247e-1625.95gene:FBgn0035936 transcript:FBtr0076506[more]
Tsp66E8.247e-1625.95gene:FBgn0035936 transcript:FBtr0076508[more]
Tsp39D1.883e-1326.19gene:FBgn0032943 transcript:FBtr0273404[more]
Tsp42Ed7.795e-1026.32gene:FBgn0029507 transcript:FBtr0345536[more]
back to top
BLAST of Tetraspanin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cd151l1.322e-1724.80CD151 antigen, like [Source:ZFIN;Acc:ZDB-GENE-0404... [more]
cd82b5.858e-1726.46CD82 molecule b [Source:ZFIN;Acc:ZDB-GENE-030131-2... [more]
cd82b5.858e-1726.46CD82 molecule b [Source:ZFIN;Acc:ZDB-GENE-030131-2... [more]
tspan344.133e-1527.20tetraspanin 34 [Source:ZFIN;Acc:ZDB-GENE-060825-20... [more]
cd1513.373e-1424.80CD151 molecule [Source:ZFIN;Acc:ZDB-GENE-041010-13... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cd827.617e-1827.34CD82 molecule [Source:NCBI gene;Acc:394799][more]
cd821.254e-1727.34CD82 molecule [Source:NCBI gene;Acc:394799][more]
cd1514.700e-1725.59CD151 molecule (Raph blood group) [Source:NCBI gen... [more]
tspan86.442e-1629.32tetraspanin 8 [Source:NCBI gene;Acc:496915][more]
gpr883.305e-1524.60G protein-coupled receptor 88 [Source:Xenbase;Acc:... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cd823.265e-1626.64CD82 antigen [Source:MGI Symbol;Acc:MGI:104651][more]
Cd823.265e-1626.64CD82 antigen [Source:MGI Symbol;Acc:MGI:104651][more]
Cd823.265e-1626.64CD82 antigen [Source:MGI Symbol;Acc:MGI:104651][more]
Cd823.265e-1626.64CD82 antigen [Source:MGI Symbol;Acc:MGI:104651][more]
Tspan13.730e-1226.64tetraspanin 1 [Source:MGI Symbol;Acc:MGI:1914055][more]
back to top
BLAST of Tetraspanin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O70352|CD82_RAT1.681e-1526.72CD82 antigen OS=Rattus norvegicus OX=10116 GN=Cd82... [more]
sp|P40237|CD82_MOUSE2.284e-1526.64CD82 antigen OS=Mus musculus OX=10090 GN=Cd82 PE=1... [more]
sp|P27701|CD82_HUMAN1.100e-1425.00CD82 antigen OS=Homo sapiens OX=9606 GN=CD82 PE=1 ... [more]
sp|P28648|CD63_RAT2.964e-1326.87CD63 antigen OS=Rattus norvegicus OX=10116 GN=Cd63... [more]
sp|Q6AYR9|TSN1_RAT3.536e-1227.51Tetraspanin-1 OS=Rattus norvegicus OX=10116 GN=Tsp... [more]
back to top
BLAST of Tetraspanin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GD103.228e-3534.66Tetraspanin OS=Macrostomum lignano OX=282301 GN=BO... [more]
A0A267ERG26.910e-3535.38Tetraspanin OS=Macrostomum lignano OX=282301 GN=BO... [more]
A0A267EG052.271e-3434.25Tetraspanin OS=Macrostomum lignano OX=282301 GN=BO... [more]
A0A267FTC42.497e-3434.25Tetraspanin OS=Macrostomum lignano OX=282301 GN=BO... [more]
A0A1I8GBP63.130e-3033.21Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tspan114.414e-1825.10tetraspanin-11-like [Source:NCBI gene;Acc:10302424... [more]
tspan18a9.284e-1625.97tetraspanin 18 [Source:NCBI gene;Acc:103047105][more]
tspan18b2.991e-1527.45tetraspanin-18-like [Source:NCBI gene;Acc:10303551... [more]
tspan114.208e-1524.30tetraspanin-11-like [Source:NCBI gene;Acc:10302424... [more]
tspan351.482e-1428.86tetraspanin-1-like [Source:NCBI gene;Acc:103021497... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CD1511.552e-1322.44CD151 molecule (Raph blood group) [Source:HGNC Sym... [more]
ENSPMAT00000009492.11.007e-1122.17pep scaffold:Pmarinus_7.0:GL476618:258874:270129:-... [more]
cd82b1.775e-1022.09CD82 molecule b [Source:ZFIN;Acc:ZDB-GENE-030131-2... [more]
tspan18b2.349e-926.92tetraspanin 18b [Source:ZFIN;Acc:ZDB-GENE-040718-1... [more]
ENSPMAT00000000426.15.690e-925.00pep scaffold:Pmarinus_7.0:GL477652:123953:135969:-... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO308374.662e-1626.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359381.352e-1526.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359172.780e-1329.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468872.924e-1226.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343091.326e-1123.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tspan116.497e-1925.10tetraspanin 11 [Source:NCBI gene;Acc:101168088][more]
tspan118.030e-1523.87tetraspanin 11 [Source:NCBI gene;Acc:101168088][more]
tspan118.030e-1523.87tetraspanin 11 [Source:NCBI gene;Acc:101168088][more]
tspan119.044e-1523.51tetraspanin 11 [Source:NCBI gene;Acc:101168088][more]
ENSORLT00000000775.21.172e-1425.45CD82 antigen [Source:NCBI gene;Acc:101156312][more]
back to top
BLAST of Tetraspanin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000019444.17.096e-16198.77SMESG000019444.1[more]
SMESG000019444.11.057e-15799.59SMESG000019444.1[more]
SMESG000019443.12.268e-11866.31SMESG000019443.1[more]
SMESG000019419.16.981e-9255.04SMESG000019419.1[more]
SMESG000019440.12.357e-9055.76SMESG000019440.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014051 ID=SMED30014051|Name=Tetraspanin|organism=Schmidtea mediterranea sexual|type=transcript|length=889bp
AAATGGGTTTCTGCGAATCAATCTCAAAATTACTGTTGATCATTTTCAAC
ATTTGTTTCTTTATAATTGGAGCGGTAATTCTCGGTGTCGGAATTTGGGT
AAAAGTTGACAAGTCGAATTTATTTGAAATGATGCGCAATATCAATCTCG
ACGAAACCGCTAAATCATTCAGCAGCACAAATTCTTCACTATTCGATATT
GTTGCAATAATTCTGATAATTTTGGGAGCATTCACATTTATCACTGGTTT
CTGTGGTTGTTGTGGAGCTATTAAAGAAAGCTCATGTTTATTATTCATGT
ACTCATTCCTCGTAGCCGCTGTCATTGTTGCTCAAGTCGCAGTCGGAATA
TATGCAAGTGTTCAACAAAATAAATTCCAAGCTCGTTTAGAGAAGAGTTT
AATCAAAATAGTGGCTAAAGATTTCAATGGAGCTCTCTCTTCAAATCCGT
CGATGTTTACTAAAGTGTTCACGGCTCTGATGTTCGAGATGAAATGTTGT
GGTGTCAAAGGTGAGGCTGACTTCAATGGCATCGGAGATGCATGGAAACA
AACTATTAACGGTCGAAAACAAATCCATCCAATCGGATGTTGTAAATTGA
AGAATTCATTCCATTTCAATTCCAAAGAGAAATTGAATTTAACCGTAGTT
GAAAATACCATGGAAGACCCGAATTGTATATTTGAAAAAGAAACAAAACT
TAATCAAAAAGGCTGCGTTGTGTCTTTGATCGATAAAATCAAAAGCCATT
TGAAGATTGTTATCGGTGTTTGCATTGGTTTGGGATTATTTGAGATTCTC
TGCATCGTGTTCGCTTGTTGTGTTGCGAAAAGGGATGATTAAATTCTGTG
AGCAGAAATCAATTAAAACAATAGCTTCGTTCATATCAG
back to top

protein sequence of SMED30014051-orf-1

>SMED30014051-orf-1 ID=SMED30014051-orf-1|Name=SMED30014051-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=108bp
MTAATRNEYMNNKHELSLIAPQQPQKPVINVNAPKIIRIIATISNSEEFV
LLNDLAVSSRLILRIISNKFDLSTFTQIPTPRITAPIIKKQMLKMINSNF
EIDSQKPI
back to top

protein sequence of SMED30014051-orf-2

>SMED30014051-orf-2 ID=SMED30014051-orf-2|Name=SMED30014051-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=280bp
MGFCESISKLLLIIFNICFFIIGAVILGVGIWVKVDKSNLFEMMRNINLD
ETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMY
SFLVAAVIVAQVAVGIYASVQQNKFQARLEKSLIKIVAKDFNGALSSNPS
MFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLK
NSFHFNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHL
KIVIGVCIGLGLFEILCIVFACCVAKRDD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000101muscle cell
PLANA:0000204ovary
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000301Tetraspanin
IPR018499Tetraspanin/Peripherin
IPR008952Tetraspanin_EC2_sf
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000301TetraspaninPRINTSPR00259TMFOURcoord: 10..33
score: 38.65
coord: 252..278
score: 25.37
coord: 64..90
score: 38.53
coord: 91..119
score: 27.37
IPR000301TetraspaninPIRSFPIRSF002419Tetraspanincoord: 1..278
e-value: 4.8E-41
score: 138.2
IPR018499Tetraspanin/PeripherinPFAMPF00335Tetraspanincoord: 9..275
e-value: 2.5E-43
score: 148.4
NoneNo IPR availablePANTHERPTHR19282:SF283TETRASPANIN-21coord: 9..274
NoneNo IPR availablePANTHERPTHR19282TETRASPANINcoord: 9..274
NoneNo IPR availableTMHMMTMhelixcoord: 252..274
NoneNo IPR availableTMHMMTMhelixcoord: 67..89
NoneNo IPR availableTMHMMTMhelixcoord: 11..33
NoneNo IPR availableTMHMMTMhelixcoord: 96..118
IPR008952Tetraspanin, EC2 domain superfamilySUPERFAMILYSSF48652Tetraspanincoord: 128..249