SMED30014049

Overview
NameSMED30014049
Smed IDSMED30014049
Length (bp)1142
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014049

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30014049 SmedASXL_073320SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30014049 dd_Smed_v4_15487_0_2dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30014049 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000042:191746..192888 +5626
Homology
BLAST of SMED30014049 vs. TrEMBL
Match: A0A5S6QH98 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.395e-17
Identity = 56/172 (32.56%), Postives = 85/172 (49.42%), Query Frame = 2
Query:  512 VMPLLALEQVNKGKFQPVMDFRS*ANGLSI--PEIAMSAQK*LVNFDDEGSN-DLHNAYL*ILIEKNLWHYQVVLFVVKTYCLTRLRFGLKSPLESCKRSYRRCVFPILSFLKPSSVIL-MILI*NFMSLPGSGNKLLDSFGLATKNPVPIANSK---ALACHSHRQ--QWA 1000
            ++PL+A+ Q +K K +PV+DFR     +        + A+K L  +   G+N DL  AYL + +EK+LW YQ V+   + YCLTRL FGL       K    R +  + +  K +S  L  IL+   +    +  + L  +GL  K+P  ++N      LA    R   QWA
Sbjct:  145 LIPLMAVVQRSKKKVRPVLDFRELNTYIDTYTARSDVCAEK-LREWRQRGANIDLKKAYLQVRVEKSLWPYQTVVLRGRRYCLTRLGFGLNVAPTIMKAVVDRVLSLVPNISKGTSAYLDDILVDETVVSAHAVKRHLAQYGLECKSPEKVSNGARVLGLAVWGERNTLQWA 315          

HSP 2 Score: 49.2914 bits (116), Expect = 3.395e-17
Identity = 21/52 (40.38%), Postives = 32/52 (61.54%), Query Frame = 3
Query:  987 DNNGLRWRRGNKINEFEAYTPCSR*KLFSVCGHLVGHYPFAKWLRVASSFVK 1142
            + N L+W R  ++ +       ++  +FS CG L+GHYP   WLRVA++FVK
Sbjct:  308 ERNTLQWARSTEVGD--PPRKLTKRSVFSYCGELIGHYPVGNWLRVATAFVK 357          
BLAST of SMED30014049 vs. TrEMBL
Match: A0A5S6QSD9 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 5.266e-17
Identity = 57/158 (36.08%), Postives = 84/158 (53.16%), Query Frame = 2
Query:  512 VMPLLALEQVNKGKFQPVMDFRS*ANGLS--IPEIAMSAQK*LVNFDDEGSN----DLHNAYL*ILIEKNLWHYQVVLFVVKTYCLTRLRFGLK-SPLESCKRSYRRCVFPILSFLKP--SSVILMILI*NFMSLPGSGNKLLDSFGLATKNPVPIAN 958
            ++PL+A+ Q NKGK +PVMDFR     +     +  + AQK L  +  +G+N    DL  AYL I ++++LW YQ V++  + YCLTRL FGL  +PL    ++   CV    S +K   S+ I  IL+   +       + L  FGL  K    +AN
Sbjct:  438 LIPLMAVSQDNKGKVRPVMDFRELNTYIDSFTADSDVCAQK-LCEWRKQGANVSVVDLKRAYLQIHVDRSLWPYQTVMYKERRYCLTRLGFGLNVAPL--IMKAVLNCVLSQDSTVKKGTSAYIDDILVNEDVVKATRVERHLARFGLTCKPHERVAN 592          

HSP 2 Score: 45.0542 bits (105), Expect = 5.266e-17
Identity = 23/53 (43.40%), Postives = 31/53 (58.49%), Query Frame = 3
Query:  987 DNNGLRWRRGNKI-NEFEAYTPCSR*KLFSVCGHLVGHYPFAKWLRVASSFVK 1142
            +   L WRR  ++ N  E  T   R  +FS CG L GH+P   WLRVA++F+K
Sbjct:  604 ERGNLFWRRDAEVCNAPERLT---RRSVFSFCGKLTGHFPVCGWLRVAAAFIK 653          
BLAST of SMED30014049 vs. TrEMBL
Match: A0A5S6Q7P6 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 7.225e-17
Identity = 56/175 (32.00%), Postives = 85/175 (48.57%), Query Frame = 2
Query:  512 VMPLLALEQVNKGKFQPVMDFRS*ANGLSI--PEIAMSAQK*LVNFDDEGSN----DLHNAYL*ILIEKNLWHYQVVLFVVKTYCLTRLRFGLKSPLESCKRSYRRCVFPILSFLKPSSVIL-MILI*NFMSLPGSGNKLLDSFGLATKNPVPIANSK---ALACHSHRQ--QWA 1000
            ++PL+A+ Q +K K +PV+DFR     +        + A+K L  +   G+N    DL  AYL + +EK+LW YQ V+   + YCLTRL FGL       K    R +  + +  K +S  L  IL+   +    +  + L  +GL  K+P  ++N      LA    R   QWA
Sbjct:  145 LIPLMAVVQRSKKKVRPVLDFRELNTYIDTYTARSDVCAEK-LREWRQRGANIAILDLKKAYLQVRVEKSLWPYQTVMLRGRRYCLTRLGFGLNVAPTIMKAVVDRVLSLVPNISKGTSAYLDDILVDETVVSAHAVKRHLAQYGLECKSPEKVSNGARVLGLAVWGERNTLQWA 318          

HSP 2 Score: 48.9062 bits (115), Expect = 7.225e-17
Identity = 21/52 (40.38%), Postives = 32/52 (61.54%), Query Frame = 3
Query:  987 DNNGLRWRRGNKINEFEAYTPCSR*KLFSVCGHLVGHYPFAKWLRVASSFVK 1142
            + N L+W R  ++ +       ++  +FS CG L+GHYP   WLRVA++FVK
Sbjct:  311 ERNTLQWARSTEVGD--PPRRLTKRSVFSYCGELIGHYPVGNWLRVATAFVK 360          
BLAST of SMED30014049 vs. TrEMBL
Match: A0A5S6QHX4 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 7.463e-17
Identity = 56/175 (32.00%), Postives = 85/175 (48.57%), Query Frame = 2
Query:  512 VMPLLALEQVNKGKFQPVMDFRS*ANGLSI--PEIAMSAQK*LVNFDDEGSN----DLHNAYL*ILIEKNLWHYQVVLFVVKTYCLTRLRFGLKSPLESCKRSYRRCVFPILSFLKPSSVIL-MILI*NFMSLPGSGNKLLDSFGLATKNPVPIANSK---ALACHSHRQ--QWA 1000
            ++PL+A+ Q +K K +PV+DFR     +        + A+K L  +   G+N    DL  AYL + +EK+LW YQ V+   + YCLTRL FGL       K    R +  + +  K +S  L  IL+   +    +  + L  +GL  K+P  ++N      LA    R   QWA
Sbjct:  145 LIPLMAVVQRSKKKVRPVLDFRELNTYIDTYTARSDVCAEK-LREWRQRGANIAILDLKKAYLQVRVEKSLWPYQTVMLRGRRYCLTRLGFGLNVAPTIMKAVVDRVLSLVPNISKGTSAYLDDILVDETVVSAHAVKRHLAQYGLECKSPEKVSNGARVLGLAVWGERNTLQWA 318          

HSP 2 Score: 48.9062 bits (115), Expect = 7.463e-17
Identity = 21/52 (40.38%), Postives = 32/52 (61.54%), Query Frame = 3
Query:  987 DNNGLRWRRGNKINEFEAYTPCSR*KLFSVCGHLVGHYPFAKWLRVASSFVK 1142
            + N L+W R  ++ +       ++  +FS CG L+GHYP   WLRVA++FVK
Sbjct:  311 ERNTLQWARSTEVGD--PPRRLTKRSVFSYCGELIGHYPVGNWLRVATAFVK 360          
BLAST of SMED30014049 vs. TrEMBL
Match: A0A5S6QF31 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 8.101e-17
Identity = 56/175 (32.00%), Postives = 85/175 (48.57%), Query Frame = 2
Query:  512 VMPLLALEQVNKGKFQPVMDFRS*ANGLSI--PEIAMSAQK*LVNFDDEGSN----DLHNAYL*ILIEKNLWHYQVVLFVVKTYCLTRLRFGLKSPLESCKRSYRRCVFPILSFLKPSSVIL-MILI*NFMSLPGSGNKLLDSFGLATKNPVPIANSK---ALACHSHRQ--QWA 1000
            ++PL+A+ Q +K K +PV+DFR     +        + A+K L  +   G+N    DL  AYL + +EK+LW YQ V+   + YCLTRL FGL       K    R +  + +  K +S  L  IL+   +    +  + L  +GL  K+P  ++N      LA    R   QWA
Sbjct:  145 LIPLMAVVQRSKKKVRPVLDFRELNTYIDTYTARSDVCAEK-LREWRQRGANIAILDLKKAYLQVRVEKSLWPYQTVMLRGRRYCLTRLGFGLNVAPTIMKAVVDRVLSLVPNISKGTSAYLDDILVDETVVSAHAVKRHLAQYGLECKSPEKVSNGARVLGLAVWGERNTLQWA 318          

HSP 2 Score: 48.9062 bits (115), Expect = 8.101e-17
Identity = 21/52 (40.38%), Postives = 32/52 (61.54%), Query Frame = 3
Query:  987 DNNGLRWRRGNKINEFEAYTPCSR*KLFSVCGHLVGHYPFAKWLRVASSFVK 1142
            + N L+W R  ++ +       ++  +FS CG L+GHYP   WLRVA++FVK
Sbjct:  311 ERNTLQWARSTEVGD--PPRRLTKRSVFSYCGELIGHYPVGNWLRVATAFVK 360          
BLAST of SMED30014049 vs. Planmine SMEST
Match: SMESG000071031.1 (SMESG000071031.1)

HSP 1 Score: 55.4546 bits (132), Expect = 1.430e-9
Identity = 39/104 (37.50%), Postives = 52/104 (50.00%), Query Frame = 2
Query:  662 DLHNAYL*ILIEKNLWHYQVVLFVVKTYCLTRLRFGLKSPLESCKRSYRRCVFPILSFLKPSSVILMILI*NFMSLPGSGNKLLDSFGLATKNPVPIANSKALA 973
            DL NAYL I IEK  W Y VV +  KTYCLTRL FGL   L        R +  I+  +  S++ +     +++         +D   LATK+P+P    KAL 
Sbjct:    8 DLRNAYLRIHIEKYFWCYPVVQYSEKTYCLTRLEFGLNCAL--------RKMLKIMGKVLSSNIAVRYATSSYIDDIAVDTSKVD---LATKDPIPNVILKALG 100          
BLAST of SMED30014049 vs. Planmine SMEST
Match: SMESG000057634.1 (SMESG000057634.1)

HSP 1 Score: 49.6766 bits (117), Expect = 1.335e-7
Identity = 36/93 (38.71%), Postives = 52/93 (55.91%), Query Frame = 2
Query:  512 VMPLLALEQVNKGKFQPVMDFRS*ANGLSIPEIAMSA-----QK*LVNFDDEGSNDLHNAYL*ILIEKNLWHYQVVLFVVKTYCLTRLRFGLK 775
            V+PL+ + Q NK K + V+D+R     +S     + A     +K L   +     DL +AYL I ++K+LW +QVV    KT+ LTRL FGLK
Sbjct:   13 VVPLIEVIQQNKAKVRQVLDYRKINEYVSSHNAQVDACQKKLRKWLTWSEVVVVIDLKSAYLQIRVDKSLWAFQVVKCKGKTFALTRLGFGLK 105          
BLAST of SMED30014049 vs. Planmine SMEST
Match: SMESG000055549.1 (SMESG000055549.1)

HSP 1 Score: 48.521 bits (114), Expect = 4.021e-6
Identity = 29/91 (31.87%), Postives = 51/91 (56.04%), Query Frame = 2
Query:  515 MPLLALEQVNKGKFQPVMDFRS*ANGLSIPEI-AMSAQK*LVNFDDEGSN----DLHNAYL*ILIEKNLWHYQVVLFVVKTYCLTRLRFGL 772
            + L  + Q NK K +PV DF++  + L +    A+   + +  +  +G+N    DL +AY+ I +++N+W YQ  +   + Y LTRL FG+
Sbjct:  113 VTLFPVMQKNKSKIRPVFDFKALNHYLDVSSGEAVVCNETIREWRKKGNNIAILDLSDAYMQIKVDENMWKYQSCIINGRRYALTRLGFGI 203          
BLAST of SMED30014049 vs. Planmine SMEST
Match: SMESG000030048.1 (SMESG000030048.1)

HSP 1 Score: 48.1358 bits (113), Expect = 7.327e-6
Identity = 24/56 (42.86%), Postives = 34/56 (60.71%), Query Frame = 3
Query:  978 ILTDNNGLRWRRGNKIN-EFEAYTPCSR*KLFSVCGHLVGHYPFAKWLRVASSFVK 1142
            +  +NN L+W R N I  EFE     +R +L+S+CG L G  P   WLR+A S++K
Sbjct:  167 VFIENNVLKWNRANSIRYEFEENI-MNRRELYSLCGQLTGILPVTGWLRIACSYLK 221          
BLAST of SMED30014049 vs. Planmine SMEST
Match: SMESG000030048.1 (SMESG000030048.1)

HSP 1 Score: 47.7506 bits (112), Expect = 7.788e-6
Identity = 24/56 (42.86%), Postives = 34/56 (60.71%), Query Frame = 3
Query:  978 ILTDNNGLRWRRGNKIN-EFEAYTPCSR*KLFSVCGHLVGHYPFAKWLRVASSFVK 1142
            +  +NN L+W R N I  EFE     +R +L+S+CG L G  P   WLR+A S++K
Sbjct:  175 VFIENNVLKWNRANSIRYEFEENI-MNRRELYSLCGQLTGILPVTGWLRIACSYLK 229          
The following BLAST results are available for this feature:
BLAST of SMED30014049 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014049 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014049 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014049 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014049 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014049 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014049 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014049 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5S6QH983.395e-1732.56Uncharacterized protein OS=Trichuris muris OX=7041... [more]
A0A5S6QSD95.266e-1736.08Uncharacterized protein OS=Trichuris muris OX=7041... [more]
A0A5S6Q7P67.225e-1732.00Uncharacterized protein OS=Trichuris muris OX=7041... [more]
A0A5S6QHX47.463e-1732.00Uncharacterized protein OS=Trichuris muris OX=7041... [more]
A0A5S6QF318.101e-1732.00Uncharacterized protein OS=Trichuris muris OX=7041... [more]
back to top
BLAST of SMED30014049 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014049 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014049 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014049 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014049 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014049 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071031.11.430e-937.50SMESG000071031.1[more]
SMESG000057634.11.335e-738.71SMESG000057634.1[more]
SMESG000055549.14.021e-631.87SMESG000055549.1[more]
SMESG000030048.17.327e-642.86SMESG000030048.1[more]
SMESG000030048.17.788e-642.86SMESG000030048.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014049 ID=SMED30014049|Name=SMED30014049|organism=Schmidtea mediterranea sexual|type=transcript|length=1142bp
TTTCTTGTATGGGTTCAAACACTCTGGCCTACCATCTTTATTATTGCTAG
AACTTTCCGAAATTGCCGGATCGTTGGAAACTGTGAGCTCCGACCGTTTC
CTTCAAAACCATGCGGTGTCAAAAATCAAAAATATCGCAGTAAAAATCAA
CGGGAGATTAGGTCAAGGATTTATTGATTCAGGTAGCTCTCGGTCGATGC
TTGCAAGGAAATGGCACTCGGGTACAGTGGATGGCAGAAAACTCAAGTGT
TGCAAATCATCTGAGATCCAGTTCATGATTAAGGATGAGGTAGTTGCTTT
GTAGTGCCTCGTTATGAACGAACTACCATAGGGAATTATTCTAGTTCTTA
GCACGGATCTAATTTCACAAATGGAGGAGTCTTTTTCGACGGAAATACAG
TATCTTTTGGAAATTATGTCGGATTGTACGCAGTAGTGTATCCTGCTGAT
CAAATCGCTGATGAGGATTTCGAAGCTACATTTGACGGATCAAAATGAAT
CATATGATAGGGTCATGCCTCTTTTGGCATTGGAACAAGTTAACAAAGGA
AAGTTTCAACCAGTCATGGACTTCCGGAGCTGAGCAAATGGGTTGAGTAT
ACCGGAGATAGCGATGTCTGCTCAAAAATGATTGGTCAATTTTGATGATG
AAGGAAGCAATGATTTGCATAACGCTTATTTATAGATCCTTATTGAAAAG
AACTTGTGGCACTACCAGGTAGTACTGTTTGTCGTAAAGACATACTGTTT
GACTCGGTTAAGATTTGGCCTTAAATCGCCCCTAGAATCATGTAAAAGAT
CCTATAGAAGGTGCGTTTTTCCGATACTGTCATTCCTGAAGCCAAGCTCA
GTTATATTGATGATATTGATTTGAAACTTCATGAGTTTACCCGGAAGCGG
TAATAAGCTACTTGATTCGTTTGGTTTAGCAACTAAGAATCCAGTTCCTA
TCGCGAACTCAAAAGCGTTGGCCTGTCATTCTCACAGACAACAATGGGCT
GCGATGGAGAAGAGGAAATAAAATAAATGAGTTTGAAGCCTATACTCCCT
GTTCACGTTGAAAGTTGTTTTCCGTTTGTGGGCACTTGGTCGGACATTAT
CCATTTGCAAAGTGGCTAAGAGTGGCTAGTAGCTTTGTTAAG
back to top

protein sequence of SMED30014049-orf-1

>SMED30014049-orf-1 ID=SMED30014049-orf-1|Name=SMED30014049-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=101bp
FLYGFKHSGLPSLLLLELSEIAGSLETVSSDRFLQNHAVSKIKNIAVKIN
GRLGQGFIDSGSSRSMLARKWHSGTVDGRKLKCCKSSEIQFMIKDEVVAL
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0008270zinc ion binding
Vocabulary: biological process
TermDefinition
GO:0015074DNA integration