Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A

Overview
NamePhosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A
Smed IDSMED30014043
Length (bp)1303
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A (SMED30014043) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A (SMED30014043) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A (SMED30014043) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A (SMED30014043) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014043

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30014043SMESG000037747.1 SMESG000037742.1 dd_Smed_v4_7130_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014043SMESG000037747.1 SMESG000037742.1 dd_Smed_v4_7130_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30014043SMESG000037747.1 SMESG000037742.1 dd_Smed_v4_7130_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Human
Match: PLA2G15 (phospholipase A2 group XV [Source:HGNC Symbol;Acc:HGNC:17163])

HSP 1 Score: 182.57 bits (462), Expect = 1.886e-52
Identity = 133/381 (34.91%), Postives = 218/381 (57.22%), Query Frame = 1
Query:  124 PIVLVPGNGGSR-AYNYQKNDLI---CKEDL-----IWINYYYLLFPKKLNRIF---KLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISYILPKNAKY-FRELERTFPSIAFLLP-----KPE-VFGKDPLVVSSKRSYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKYSSFPDSEPVVVKGDGDGTVNLESLQVCRNWKNTK-YLVLEKE----QHIDILKSSKLIKFLIEIL 1194
            P+VLVPG+ G++      K  ++   C +       IW+N   LL P  ++      +L+YN  +R+T      ++  PG+G T ++E L         YF ++VE LV   Y  R + VRGAPYD+RRAPNEN  +F  L+++IEE +   G   VVL+ HS+G++Y+LYFL++   +WK K++R+F+S+  P+ G  + L     G +  +P       RE +R+  S ++LLP      PE VF + P +     +Y+  DY++ F+D+  E G +M +DT+ L+ A+  P G+ +++C+Y  G+ TP    Y SFPD +P +  GDGDGTVNL+S   C+ W++ + + VL +E    +HI++L ++  + +L  +L
Sbjct:   39 PVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTIWLNLE-LLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGY-TRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGG-PVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTI-----NYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEAT-MPPGV-QLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVL 409          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Human
Match: LCAT (lecithin-cholesterol acyltransferase [Source:HGNC Symbol;Acc:HGNC:6522])

HSP 1 Score: 128.257 bits (321), Expect = 3.783e-32
Identity = 100/379 (26.39%), Postives = 189/379 (49.87%), Query Frame = 1
Query:  124 PIVLVPGNGGSR-AYNYQKNDLI---C---KEDL--IWINYYYLLFPKKLNRIF---KLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMK-YFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISYILP-KNAKYFRELERTFPSIAFLLPKPEVFGKDPLVVSSKR-SYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKY-SSFPDSEPV-VVKGDGDGTVNLESLQVCRNWKNTK-----YLVLEKEQHIDILKSSKLIKFLIEIL 1194
            P++LVPG  G++      K D++   C    ED   IW++    L P  ++      +++YN  +    + P   I  PG+G T ++E   YL   ++  Y  +LV+ LV    YVR++TVR APYD+R  P + ++++  L  L+EE     G    ++           + L++   +WK +F+  F+S+  P+ G+++ +     G +  +P  ++   +E +R   +  ++ P    + +D + +S+   +Y+  D++  F D+  E G  M+  +++L+     P    E+YC+Y  G+ TP+   Y   FP ++PV V+  DGD TV   S ++C  W+  +      L L   QH++++ S+  ++ +  IL
Sbjct:   48 PVILVPGCLGNQLEAKLDKPDVVNWMCYRKTEDFFTIWLDLNMFL-PLGVDCWIDNTRVVYNRSSGLVSNAPGVQIRVPGFGKTYSVE---YLDSSKLAGYLHTLVQNLVNN-GYVRDETVRAAPYDWRLEPGQQEEYYRKLAGLVEEMHAAYGKPVFLIGHSLGCLHLLYFLLRQPQ-AWKDRFIDGFISLGAPWGGSIKPMLVLASGDNQGIPIMSSIKLKEEQRITTTSPWMFPSRMAWPEDHVFISTPSFNYTGRDFQRFFADLHFEEGWYMWLQSRDLLAGLPAPG--VEVYCLYGVGLPTPRTYIYDHGFPYTDPVGVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPLHGIQHLNMVFSNLTLEHINAIL 418          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Human
Match: PLA2G15 (phospholipase A2 group XV [Source:HGNC Symbol;Acc:HGNC:17163])

HSP 1 Score: 117.472 bits (293), Expect = 3.654e-29
Identity = 68/208 (32.69%), Postives = 120/208 (57.69%), Query Frame = 1
Query:  607 KKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISYILPKNAKY-FRELERTFPSIAFLLP-----KPE-VFGKDPLVVSSKRSYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKYSSFPDSEPVVVKGDGDGTVNLESLQVCRNWKNTK-YLVLEKE----QHIDILKSSKLIKFLIEIL 1194
            ++   +WK K++R+F+S+  P+ G  + L     G +  +P       RE +R+  S ++LLP      PE VF + P +     +Y+  DY++ F+D+  E G +M +DT+ L+ A+  P G+ +++C+Y  G+ TP    Y SFPD +P +  GDGDGTVNL+S   C+ W++ + + VL +E    +HI++L ++  + +L  +L
Sbjct:  115 QRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTI-----NYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEAT-MPPGV-QLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVL 315          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Human
Match: PLA2G15 (phospholipase A2 group XV [Source:HGNC Symbol;Acc:HGNC:17163])

HSP 1 Score: 99.3673 bits (246), Expect = 1.786e-23
Identity = 57/161 (35.40%), Postives = 97/161 (60.25%), Query Frame = 1
Query:  745 FRELERTFPSIAFLLP-----KPE-VFGKDPLVVSSKRSYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKYSSFPDSEPVVVKGDGDGTVNLESLQVCRNWKNTK-YLVLEKE----QHIDILKSSKLIKFLIEIL 1194
             RE +R+  S ++LLP      PE VF + P +     +Y+  DY++ F+D+  E G +M +DT+ L+ A+  P G+ +++C+Y  G+ TP    Y SFPD +P +  GDGDGTVNL+S   C+ W++ + + VL +E    +HI++L ++  + +L  +L
Sbjct:   56 IREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTI-----NYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEAT-MPPGV-QLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVL 209          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Human
Match: LCAT (lecithin-cholesterol acyltransferase [Source:HGNC Symbol;Acc:HGNC:6522])

HSP 1 Score: 88.1965 bits (217), Expect = 3.526e-19
Identity = 56/227 (24.67%), Postives = 116/227 (51.10%), Query Frame = 1
Query:  259 KLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMK-YFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISYILP-KNAKYFRELERTFPSIAFLLPKPEVFGKDPLVVSSKR-SYSAYDYKELFKDMDMEYGNMMYEDTKNLI 930
            +++YN  +    + P   I  PG+G T ++E   YL   ++  Y  +LV+ LV   Y VR++TVR APYD+R  P + ++++  L  L+EE     G    ++           + L++   +WK +F+  F+S+  P+ G+++ +     G +  +P  ++   +E +R   +  ++ P    + +D + +S+   +Y+  D++  F D+  E G  M+  +++L+
Sbjct:   32 RVVYNRSSGLVSNAPGVQIRVPGFGKTYSVE---YLDSSKLAGYLHTLVQNLVNNGY-VRDETVRAAPYDWRLEPGQQEEYYRKLAGLVEEMHAAYGKPVFLIGHSLGCLHLLYFLLRQPQ-AWKDRFIDGFISLGAPWGGSIKPMLVLASGDNQGIPIMSSIKLKEEQRITTTSPWMFPSRMAWPEDHVFISTPSFNYTGRDFQRFFADLHFEEGWYMWLQSRDLL 253          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Celegans
Match: M05B5.4 (pep chromosome:WBcel235:I:7188465:7190581:1 gene:WBGene00010872.1 transcript:M05B5.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M05B5.4)

HSP 1 Score: 176.022 bits (445), Expect = 2.163e-50
Identity = 134/408 (32.84%), Postives = 222/408 (54.41%), Query Frame = 1
Query:   73 LLLSMMLIGTIDSQTFS----------PIVLVPGNGGSRAYNYQKN-----DLICKEDL-----IWINYYYLLFPKKLNRI---FKLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKK-MDISWKRKFLRSFLSVNGPFAGAVQA--LYSETHGISY---ILPKNAKYFRELERTFPSIAFLLPKPEVFG-KDPLVVSSKRSYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKYSS--FPDSEPVVVKGDGDGTVNLESLQVCRNW--KNTKYLVLEKE----QHIDILKSSKLIKFL 1182
            L + ++LIG  D++ F           P++LVPG+GGS+  +           +C +       +W+N   L  P  ++      +L++N  T  + ++P  +I   G+G+TE++E L      + +YF  +V+ +V   Y  R K V GAP+D+R++PNE  D+   LK LIE T+  + N K+VL+GHS+G+  SLYFL   +D +WK K++ SF+S+  P+AG++Q   L++  + ++Y   ILP ++   R ++R+F S AFL P P  +   + L  ++ ++Y+  + KE F+D++   G   Y+    L N + +  G+  ++CIY  G+ TP++  ++   FPD  P    GDGDGTVN +S  VC NW   N  Y V   E     H+ ILK    I+ +
Sbjct:    8 LCIFLVLIGKSDTKWFGKFGRSQAKGLPVILVPGDGGSQLESNLTGKPSVVHYVCSKQTADYFDLWLNLQ-LFTPLVIDCWADNMQLVFNTTTGLSENMPGVDIRVAGFGATESVEWLDKSKASQGRYFFDIVDSMVSWGYR-RGKNVIGAPFDWRKSPNELNDYLIQLKSLIETTYRWNDNQKIVLVGHSMGNPLSLYFLNNYVDQAWKDKYISSFVSLAAPWAGSMQIVRLFASGYNMNYYRVILPPSS--LRAMQRSFSSSAFLFPSPVAWKPHEILATTADKNYTVGNIKEFFQDINYMVGWEQYKQAARL-NGNLSSPGV-PVHCIYGTGVPTPEKFSWAPGYFPDYPPTEFMGDGDGTVNKKSATVCTNWIGNNNGYKVTVHEVFQADHMAILKHPNAIELV 409          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Fly
Match: CG18858 (gene:FBgn0042175 transcript:FBtr0332971)

HSP 1 Score: 184.496 bits (467), Expect = 2.100e-53
Identity = 128/382 (33.51%), Postives = 211/382 (55.24%), Query Frame = 1
Query:  118 FSPIVLVPGNGGSR--AYNYQKND--LICKEDLIWINYYY----LLFPKKLNRI--FKLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHG---ISYILPKNAKYFRELERTFPSIAFLLPKPEVFGK--DPLVVSSKRSYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKY--SSFPDSEPVVVKGDGDGTVNLESLQVCRNWKN-----TKYLVLEKEQHIDILKSSKLIKFLIEILH 1197
             SP++ VPG+GGS+  A   + N   LIC++   W N +     L+ P     I   KL Y+ +TR+T + P      PGWG+ E +E +         YF+ +  +LVK+ Y +R + + GAPYDFR+APNEN+ FF +LK+L+E+++  +  + V  + HS+GSL +L FL++  + WK K+++  +S+ G +AG+ +A+     G    S+ L  +AK  +  + T PS A+LLP P +F K  + L ++  R+Y+    +E FKD+D   G  M +DT       + P    E++C+Y +GI T ++L+Y  S      P ++ G GDGTVN  SL+ C+ W          L L+   H+ IL +  ++K++  ++ 
Sbjct:   44 LSPVIFVPGDGGSQMDARLNKPNSPYLICQKTHDWYNLWLDLEQLVIPMVYCWIDNVKLYYDKVTRTTHNTPGVETRIPGWGNPEVVEWIDPTKNSAGAYFKDIANELVKLGY-IRKQNIHGAPYDFRKAPNENQQFFIDLKQLVEDSYEANNQSAVTFISHSMGSLMTLVFLQEQTLQWKAKYVKRMISLAGVWAGSFKAVKVFAMGDDLDSFAL--SAKILKAEQITHPSTAWLLPSP-LFWKPSEVLAMTPSRNYTMAQLEEFFKDLDYMTGWEMRKDTIRYNRNFDPPNV--ELHCLYGEGIDTVERLQYKKSDISGETPKLIMGLGDGTVNQRSLRACKYWAGYSKAPINTLALQNVDHLHILSNPDVLKYIRTVMQ 419          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Fly
Match: CG18858 (gene:FBgn0042175 transcript:FBtr0081364)

HSP 1 Score: 184.496 bits (467), Expect = 2.100e-53
Identity = 128/382 (33.51%), Postives = 211/382 (55.24%), Query Frame = 1
Query:  118 FSPIVLVPGNGGSR--AYNYQKND--LICKEDLIWINYYY----LLFPKKLNRI--FKLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHG---ISYILPKNAKYFRELERTFPSIAFLLPKPEVFGK--DPLVVSSKRSYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKY--SSFPDSEPVVVKGDGDGTVNLESLQVCRNWKN-----TKYLVLEKEQHIDILKSSKLIKFLIEILH 1197
             SP++ VPG+GGS+  A   + N   LIC++   W N +     L+ P     I   KL Y+ +TR+T + P      PGWG+ E +E +         YF+ +  +LVK+ Y +R + + GAPYDFR+APNEN+ FF +LK+L+E+++  +  + V  + HS+GSL +L FL++  + WK K+++  +S+ G +AG+ +A+     G    S+ L  +AK  +  + T PS A+LLP P +F K  + L ++  R+Y+    +E FKD+D   G  M +DT       + P    E++C+Y +GI T ++L+Y  S      P ++ G GDGTVN  SL+ C+ W          L L+   H+ IL +  ++K++  ++ 
Sbjct:   44 LSPVIFVPGDGGSQMDARLNKPNSPYLICQKTHDWYNLWLDLEQLVIPMVYCWIDNVKLYYDKVTRTTHNTPGVETRIPGWGNPEVVEWIDPTKNSAGAYFKDIANELVKLGY-IRKQNIHGAPYDFRKAPNENQQFFIDLKQLVEDSYEANNQSAVTFISHSMGSLMTLVFLQEQTLQWKAKYVKRMISLAGVWAGSFKAVKVFAMGDDLDSFAL--SAKILKAEQITHPSTAWLLPSP-LFWKPSEVLAMTPSRNYTMAQLEEFFKDLDYMTGWEMRKDTIRYNRNFDPPNV--ELHCLYGEGIDTVERLQYKKSDISGETPKLIMGLGDGTVNQRSLRACKYWAGYSKAPINTLALQNVDHLHILSNPDVLKYIRTVMQ 419          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Fly
Match: CG31683 (gene:FBgn0051683 transcript:FBtr0330662)

HSP 1 Score: 183.726 bits (465), Expect = 3.815e-53
Identity = 128/382 (33.51%), Postives = 211/382 (55.24%), Query Frame = 1
Query:  118 FSPIVLVPGNGGSR--AYNYQKND--LICKEDLIWINYYY----LLFPKKLNRI--FKLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHG---ISYILPKNAKYFRELERTFPSIAFLLPKPEVFGK--DPLVVSSKRSYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKY--SSFPDSEPVVVKGDGDGTVNLESLQVCRNWKN-----TKYLVLEKEQHIDILKSSKLIKFLIEILH 1197
             SP++ VPG+GGS+  A   + N   LIC++   W N +     L+ P     I   KL Y+ +TR+T + P      PGWG+ E +E +         YF+ +  +LVK+ Y +R + + GAPYDFR+APNEN+ FF +LK+L+E+++  +  + V  + HS+GSL +L FL++  + WK K+++  +S+ G +AG+ +A+     G    S+ L  +AK  +  + T PS A+LLP P +F K  + L ++  R+Y+    +E FKD+D   G  M +DT       + P    E++C+Y +GI T ++L+Y  S      P ++ G GDGTVN  SL+ C+ W          L L+   H+ IL +  ++K++  ++ 
Sbjct:   44 LSPVIFVPGDGGSQMDARLNKPNSPYLICQKTHDWYNLWLDLEQLVIPIVYCWIDNVKLYYDKVTRTTHNTPGVETRIPGWGNPEVVEWIDPTKNSAGAYFKDIANELVKLGY-IRKQNIHGAPYDFRKAPNENQQFFIDLKQLVEDSYEANNQSAVTFISHSMGSLMTLVFLQEQTLQWKAKYVKRMISLAGVWAGSFKAVKVFAMGDDLDSFAL--SAKILKAEQITHPSTAWLLPSP-LFWKPTEVLAMTPSRNYTMAQLEEFFKDLDYMTGWEMRKDTIRYNRNFDPPNV--ELHCLYGEGIDTVERLQYKKSDISGETPKLIMGLGDGTVNQRSLRACKYWAGYSKAPINTLALQNVDHLHILSNPDVLKYIRTVMQ 419          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Fly
Match: CG31683 (gene:FBgn0051683 transcript:FBtr0081365)

HSP 1 Score: 183.726 bits (465), Expect = 3.815e-53
Identity = 128/382 (33.51%), Postives = 211/382 (55.24%), Query Frame = 1
Query:  118 FSPIVLVPGNGGSR--AYNYQKND--LICKEDLIWINYYY----LLFPKKLNRI--FKLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHG---ISYILPKNAKYFRELERTFPSIAFLLPKPEVFGK--DPLVVSSKRSYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKY--SSFPDSEPVVVKGDGDGTVNLESLQVCRNWKN-----TKYLVLEKEQHIDILKSSKLIKFLIEILH 1197
             SP++ VPG+GGS+  A   + N   LIC++   W N +     L+ P     I   KL Y+ +TR+T + P      PGWG+ E +E +         YF+ +  +LVK+ Y +R + + GAPYDFR+APNEN+ FF +LK+L+E+++  +  + V  + HS+GSL +L FL++  + WK K+++  +S+ G +AG+ +A+     G    S+ L  +AK  +  + T PS A+LLP P +F K  + L ++  R+Y+    +E FKD+D   G  M +DT       + P    E++C+Y +GI T ++L+Y  S      P ++ G GDGTVN  SL+ C+ W          L L+   H+ IL +  ++K++  ++ 
Sbjct:   44 LSPVIFVPGDGGSQMDARLNKPNSPYLICQKTHDWYNLWLDLEQLVIPIVYCWIDNVKLYYDKVTRTTHNTPGVETRIPGWGNPEVVEWIDPTKNSAGAYFKDIANELVKLGY-IRKQNIHGAPYDFRKAPNENQQFFIDLKQLVEDSYEANNQSAVTFISHSMGSLMTLVFLQEQTLQWKAKYVKRMISLAGVWAGSFKAVKVFAMGDDLDSFAL--SAKILKAEQITHPSTAWLLPSP-LFWKPTEVLAMTPSRNYTMAQLEEFFKDLDYMTGWEMRKDTIRYNRNFDPPNV--ELHCLYGEGIDTVERLQYKKSDISGETPKLIMGLGDGTVNQRSLRACKYWAGYSKAPINTLALQNVDHLHILSNPDVLKYIRTVMQ 419          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Zebrafish
Match: pla2g15 (phospholipase A2, group XV [Source:ZFIN;Acc:ZDB-GENE-030131-6948])

HSP 1 Score: 187.578 bits (475), Expect = 5.235e-54
Identity = 133/376 (35.37%), Postives = 215/376 (57.18%), Query Frame = 1
Query:  124 PIVLVPGNGGSR-AYNYQKNDL---IC---KED--LIWINYYYLLFPKKLNRI---FKLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISYILPKNAKY-FRELERTFPSIAFLLPKPEVFGKD-PLVVSSKRSYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKYSSFPDSEPVVVKGDGDGTVNLESLQVCRNWKNTK-----YLVLEKEQHIDILKSSKLIKFLIEIL 1194
            P+VL+PG+ G++      K  +   IC    ED   +W+N   LL P  ++      +L+YN     +   P  +I  PG+G T ++E L         YF ++V+ LV    Y RN  VRGAPYD+R+APNENK++F  L+++IEE    +G   VVL+ HS+G++Y+LYFL     +WK +++++++S+  P+AG  + L     G +  +P  +    R  +RT  S  +LLP    + KD  LV +   +Y+  DY+  FKD+D E G  M +DT+ L++A + P G+  ++C+Y  GI TP+   Y++FPD++P V+ GDGDGTVNL S   C+ WK  +     +L L   +H+ +L +S  + ++ ++L
Sbjct:   96 PVVLIPGDLGNQLEAKLDKPSVVHYICYKKTEDYFTLWLNLE-LLVPVAIDCWIDNMRLLYNRTNHLSEPPPGVDIRVPGFGETYSLEYLDPSKRSVGMYFFTIVQSLVDW-GYTRNDDVRGAPYDWRKAPNENKEYFLRLQQMIEEMAHKAGG-PVVLIAHSMGNMYTLYFLNHQPQAWKDRYIKAYVSLGPPWAGVAKTLRVMATGDNNRIPVISPLKIRTQQRTAVSTTWLLPYAHTWPKDMVLVYTPNTTYTVQDYQRFFKDIDYEDGWAMRQDTEPLVSALQPP-GV-PVHCLYGTGIPTPQGYNYTNFPDTDPAVINGDGDGTVNLISAIQCKRWKGQQKQAVEWLELPGNEHVAMLLNSTTVDYIKKVL 466          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Zebrafish
Match: lcat (lecithin-cholesterol acyltransferase [Source:ZFIN;Acc:ZDB-GENE-010716-3])

HSP 1 Score: 166.392 bits (420), Expect = 2.385e-46
Identity = 131/382 (34.29%), Postives = 213/382 (55.76%), Query Frame = 1
Query:  124 PIVLVPGNGGSR-AYNYQKNDLI---C---KEDL--IWINYYYLLFPKKLNRIF---KLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMK-YFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALY----SETHGISYILPKNAKYFRELERTFPSIAFLLPKPEVFGKDPLVVSSK-RSYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKYS-SFPDSEPV-VVKGDGDGTVNLESLQVCRNWKNTKYLVLEKEQ-----HIDILKSSKLIKFLIEIL 1194
            P+++VPGN G+R      K  L+   C    ED   +WI+   +  P  ++      +++YN  TR T + P  ++  PG+G T  IE   +L + ++  YF ++V+ LV I Y VRN+TVRGAPYD+R APNE +++F+ LK L+EE   +     V LLGHS+GS Y LYFL +    WK  +++ F+S+  P+ GAV+ L      E  GI ++   N K  RE +R   +  +++P  E + KD   +S+   +Y+  DY + FKD++ E G  M++DT+NL      P G+ E+YC+Y  G+ TP    Y   FP+++P+ ++  DGD TV+  S+ +C+ W   +   +   +     H+D++ + K +  +  IL
Sbjct:   49 PLIIVPGNLGNRLEAKIDKPTLVHWMCYKKSEDWFPLWIDLN-MFMPIGVDCWIDNIRIVYNRTTRKTSNAPGVDVRVPGFGQTHPIE---FLDLNKLTGYFHTMVQHLVSIGY-VRNETVRGAPYDWRIAPNEQEEYFSRLKNLVEE-MHDEYKQPVYLLGHSMGSNYILYFLNQQTQDWKDHYIKGFISLGAPWGGAVKPLRVLASGENDGIPFV--SNIK-IREEQRMTTTNPWMIPSEETWPKDHTFISTPFFNYTNQDYMQFFKDINFEDGWYMWDDTRNLTAGLPAP-GV-EVYCLYGVGLPTPVTYIYDEQFPNADPIDILYDDGDDTVDSRSMSLCKRWIGKQEQAVHVTEFRGMPHLDMVFNHKSLTTVQRIL 419          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Xenopus
Match: PLA2G15 (phospholipase A2 group XV [Source:NCBI gene;Acc:100124780])

HSP 1 Score: 174.096 bits (440), Expect = 4.992e-49
Identity = 129/385 (33.51%), Postives = 207/385 (53.77%), Query Frame = 1
Query:  124 PIVLVPGNGGSRAYNYQKNDLICKEDLIWINYYYLLFPKKLNRIF---------------------KLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISYILPK-NAKYFRELERTFPSIAFLLPKPEVFGKDPLVVSS-KRSYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKYSSFPDSEPVVVKGDGDGTVNLESLQVCRNWKNTK-----YLVLEKEQHIDILKSSKLIKFLIEIL 1194
            P+VLVPG+ G        N L  K D   + +Y  +  KK N  F                     +L+YN  +++T      +I  PG+G T ++E L         YF +LV+ LV   Y  R++ VRGAPYD+R+APNEN D+F  L+KL+E  F  S  + VVL+ HS+G+LY+LYFL +    WK K++ SF+++  P+ G  + L+    G +  +P  ++   R+ +R+  S  +LLP    + ++ + V +  ++Y+  DY+  ++D+  + G  M ++T+ LI +S  P G+ E++C+Y  G+ TP    Y SFPD +P  V G GDGTVNLES   C  W+N +      + L   +HI +L +   I ++ ++L
Sbjct:   60 PVVLVPGDLG--------NQLEAKLDKPAVVHY--MCSKKTNYYFTLWLNLELLLPVVIDCWIDNIRLVYNKTSKTTAPPEGVDIRVPGFGQTYSLEFLDPSKRSVGSYFYTLVQSLVDWGY-TRDENVRGAPYDWRKAPNENSDYFVALRKLVESMF-ESYQSPVVLVAHSMGNLYTLYFLNQQTQDWKDKYIHSFVALGAPWGGVSKTLHVLASGDNNRIPVISSLRIRDQQRSAVSTNWLLPYNNTWPQEKVFVRTPNKNYTIKDYRVFYEDIGFQDGWEMRQETEGLI-SSLNPPGV-EVHCLYGTGVDTPDSFLYDSFPDKDPTTVYGGGDGTVNLESALQCGKWRNQQRQKVSLVELPGNEHIAMLSNISTISYVKKVL 430          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Xenopus
Match: fam53c (family with sequence similarity 53 member C [Source:Xenbase;Acc:XB-GENE-988933])

HSP 1 Score: 161.384 bits (407), Expect = 2.185e-44
Identity = 134/387 (34.63%), Postives = 208/387 (53.75%), Query Frame = 1
Query:  124 PIVLVPGNGGSRAYNYQKNDLICKEDLI-WINYY----YLLFPKKLNRIF-----------KLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMK-YFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALY----SETHGISYILPKNAKYFRELERTFPSIAFLLPKPEVFGKDPLVVSS-KRSYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKYS-SFPDSEPVVVK-GDGDGTVNLESLQVCRNW-----KNTKYLVLEKEQHIDILKSSKLIKFLIEILH 1197
            P+VLVPG  G+     Q    + KED++ W+ Y     Y      LN              +++YN  TR   + P  ++  PG+G T ++E   YL   ++  YF +LV+ LV   Y VR++TVR APYD+R APN  K++F  LK LIEE   N  N  V ++GHSLG+LY LYFL      WK K+++ F+S+  P+ GAV+ L      + HGI  +   N K  RE +R   +  ++LP    + +  + +S+  R+Y+  +Y++LF D+  E G  M+EDTK L+     P G+ E+YCIY  GI TP+   Y   FP+   + +K  DGD TV+  S+++C+ W     +      L   QH++++ S++ +  + +IL 
Sbjct:   50 PVVLVPGCFGN-----QLEAKVDKEDVVNWMCYRKTDDYFTIWLNLNMFLPLGIDCWIDNIRVVYNKTTRMASNAPGVDVHVPGFGKTYSVE---YLDKSKLAGYFHTLVQNLVNNGY-VRDQTVRAAPYDWRIAPNGQKEYFEKLKSLIEE-MSNKYNESVFIIGHSLGNLYLLYFLNHQPQEWKDKYVKGFISLGAPWGGAVKPLLVLMSGDNHGIPMV--SNIK-IREEQRMTTTNPWMLPTNLGWPESHVFISTPSRNYTYKNYRKLFHDIGFEDGWYMWEDTKGLLEGLP-PPGV-EVYCIYGTGIPTPETYIYGEGFPNEPAIDIKYSDGDDTVHTRSMELCKRWISQQKQKVHIHELPGIQHLNMVFSNETLTLINDILQ 421          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Mouse
Match: Pla2g15 (phospholipase A2, group XV [Source:MGI Symbol;Acc:MGI:2178076])

HSP 1 Score: 181.415 bits (459), Expect = 4.317e-52
Identity = 122/393 (31.04%), Postives = 197/393 (50.13%), Query Frame = 1
Query:  100 TIDSQTFSPIVLVPGNGGSRAYNYQKNDLICKEDLIWINYYYLLFPKKLNRIF---------------------KLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISYILPKNAKY-FRELERTFPSIAFLLPKPEVFGKDPLVV-SSKRSYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKYSSFPDSEPVVVKGDGDGTVNLESLQVCRNWKNTK-----YLVLEKEQHIDILKSSKLIKFLIEIL 1194
            T+ +Q   P+VLVPG+ G        N L  K D   + +Y  L  KK +  F                     +L+YN  +R+T      ++  PG+G T ++E L         YF ++VE LV   Y  R + VRGAPYD+RRAPNEN  +F  L+++IEE +   G   V++           +  ++  + WK K++ +F+S+  P+ G  + L     G +  +P       RE +R+  S ++LLP    +  + + V +   +Y+  DY   F+D+  E G  M +DT+ L+ A  TP G+ E++C+Y  G+ TP    Y SFPD +P +  GDGDGTVNLES+  C+ W++ +        L   +HI++L ++  + +L  +L
Sbjct:   31 TLPAQRHPPVVLVPGDLG--------NQLEAKLDKPKVVHY--LCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGY-TRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQV-WKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAM-TPPGV-ELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVL 409          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Mouse
Match: Lcat (lecithin cholesterol acyltransferase [Source:MGI Symbol;Acc:MGI:96755])

HSP 1 Score: 143.665 bits (361), Expect = 6.562e-38
Identity = 108/380 (28.42%), Postives = 196/380 (51.58%), Query Frame = 1
Query:  124 PIVLVPGNGGSR-AYNYQKNDLI---C---KEDL--IWINYYYLLFPKKLNRIF---KLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMK-YFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISYILP--KNAKYFRELERTFPSIAFLLPKPEVFGKDPLVVSSKR-SYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKY-SSFPDSEPV-VVKGDGDGTVNLESLQVCRNWKNTK-----YLVLEKEQHIDILKSSKLIKFLIEIL 1194
            P++LVPG  G+R      K D++   C    ED   IW+++  L  P  ++      +++YN  +    + P   I  PG+G TE++E   Y+   ++  Y  +LV+ LV   Y VR++TVR APYD+R AP++  +++  L  L+EE +   G    ++           + L++   SWK  F+  F+S+  P+ G+++A+     G +  +P   N K  +E +R   +  ++LP P V+ +D + +S+   +Y+  D++  F D+  E G  M+  +++L+     P G+ E+YC+Y  G  TP    Y  +FP  +PV  +  DGD TV   S ++C  W+  +      L + +  H++++ S+K ++ +  IL
Sbjct:   48 PVILVPGCLGNRLEAKLDKPDVVNWMCYRKTEDFFTIWLDFN-LFLPLGVDCWIDNTRIVYNHSSGRVSNAPGVQIRVPGFGKTESVE---YVDDNKLAGYLHTLVQNLVNNGY-VRDETVRAAPYDWRLAPHQQDEYYKKLAGLVEEMYAAYGKPVFLIGHSLGCLHVLHFLLRQPQ-SWKDHFIDGFISLGAPWGGSIKAMRILASGDNQGIPILSNIK-LKEEQRITTTSPWMLPAPHVWPEDHVFISTPNFNYTVQDFERFFTDLHFEEGWHMFLQSRDLLERLPAP-GV-EVYCLYGVGRPTPHTYIYDHNFPYKDPVAALYEDGDDTVATRSTELCGQWQGRQSQPVHLLPMNETDHLNMVFSNKTLEHINAIL 418          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Mouse
Match: Pla2g15 (phospholipase A2, group XV [Source:MGI Symbol;Acc:MGI:2178076])

HSP 1 Score: 57.7658 bits (138), Expect = 4.761e-9
Identity = 48/149 (32.21%), Postives = 68/149 (45.64%), Query Frame = 1
Query:  100 TIDSQTFSPIVLVPGNGGSRAYNYQKNDLICKEDLIWINYYYLLFPKKLNRIF---------------------KLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPN 483
            T+ +Q   P+VLVPG+ G        N L  K D   + +Y  L  KK +  F                     +L+YN  +R+T      ++  PG+G T ++E L         YF ++VE LV    Y R + VRGAPYD+RRAP 
Sbjct:   31 TLPAQRHPPVVLVPGDLG--------NQLEAKLDKPKVVHY--LCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGW-GYTRGEDVRGAPYDWRRAPT 168          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. UniProt/SwissProt
Match: sp|Q8NCC3|PAG15_HUMAN (Phospholipase A2 group XV OS=Homo sapiens OX=9606 GN=PLA2G15 PE=1 SV=2)

HSP 1 Score: 182.57 bits (462), Expect = 9.056e-52
Identity = 133/381 (34.91%), Postives = 218/381 (57.22%), Query Frame = 1
Query:  124 PIVLVPGNGGSR-AYNYQKNDLI---CKEDL-----IWINYYYLLFPKKLNRIF---KLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISYILPKNAKY-FRELERTFPSIAFLLP-----KPE-VFGKDPLVVSSKRSYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKYSSFPDSEPVVVKGDGDGTVNLESLQVCRNWKNTK-YLVLEKE----QHIDILKSSKLIKFLIEIL 1194
            P+VLVPG+ G++      K  ++   C +       IW+N   LL P  ++      +L+YN  +R+T      ++  PG+G T ++E L         YF ++VE LV   Y  R + VRGAPYD+RRAPNEN  +F  L+++IEE +   G   VVL+ HS+G++Y+LYFL++   +WK K++R+F+S+  P+ G  + L     G +  +P       RE +R+  S ++LLP      PE VF + P +     +Y+  DY++ F+D+  E G +M +DT+ L+ A+  P G+ +++C+Y  G+ TP    Y SFPD +P +  GDGDGTVNL+S   C+ W++ + + VL +E    +HI++L ++  + +L  +L
Sbjct:   39 PVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTIWLNLE-LLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGY-TRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGG-PVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTI-----NYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEAT-MPPGV-QLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVL 409          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. UniProt/SwissProt
Match: sp|Q8VEB4|PAG15_MOUSE (Phospholipase A2 group XV OS=Mus musculus OX=10090 GN=Pla2g15 PE=1 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 3.020e-51
Identity = 122/393 (31.04%), Postives = 197/393 (50.13%), Query Frame = 1
Query:  100 TIDSQTFSPIVLVPGNGGSRAYNYQKNDLICKEDLIWINYYYLLFPKKLNRIF---------------------KLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISYILPKNAKY-FRELERTFPSIAFLLPKPEVFGKDPLVV-SSKRSYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKYSSFPDSEPVVVKGDGDGTVNLESLQVCRNWKNTK-----YLVLEKEQHIDILKSSKLIKFLIEIL 1194
            T+ +Q   P+VLVPG+ G        N L  K D   + +Y  L  KK +  F                     +L+YN  +R+T      ++  PG+G T ++E L         YF ++VE LV   Y  R + VRGAPYD+RRAPNEN  +F  L+++IEE +   G   V++           +  ++  + WK K++ +F+S+  P+ G  + L     G +  +P       RE +R+  S ++LLP    +  + + V +   +Y+  DY   F+D+  E G  M +DT+ L+ A  TP G+ E++C+Y  G+ TP    Y SFPD +P +  GDGDGTVNLES+  C+ W++ +        L   +HI++L ++  + +L  +L
Sbjct:   31 TLPAQRHPPVVLVPGDLG--------NQLEAKLDKPKVVHY--LCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGY-TRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQV-WKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAM-TPPGV-ELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVL 409          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. UniProt/SwissProt
Match: sp|Q675A5|PAG15_RAT (Phospholipase A2 group XV OS=Rattus norvegicus OX=10116 GN=Pla2g15 PE=1 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 3.902e-49
Identity = 129/394 (32.74%), Postives = 207/394 (52.54%), Query Frame = 1
Query:  109 SQTFSPIVLVPGNGGSRAYNYQKNDLICKEDLIWINYYYLLFPKKLNRIF---------------------KLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISYILPKNAKY-FRELERTFPSIAFLLPKPEVFGKDPLVV-SSKRSYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKYSSFPDSEPVVVKGDGDGTVNLESLQVCRNWKNTK-----YLVLEKEQHIDILKSSKLIKFLIEILHLRP 1206
            +Q   P+VLVPG+ G        N L  K D   + +Y  L  K+ +  F                     +L+YN  +R+T      ++  PG+G T ++E L         YF ++VE LV   Y  R + VRGAPYD+RRAPNEN  +F  L+++IEE +   G   VVL+ HS+G++Y LYFL++   +WK K++++F+S+  P+ G  + L     G +  +P       RE +R+  S ++LLP    +  + + V +   +Y+  DY   F+D+  E G  M +DT+ L+ A   P G+ E++C+Y  G+ TP    Y +FPD +P +  GDGDGTVNLES+  C+ W++ +        L   +HI++L ++  + +L  +L   P
Sbjct:   34 AQRHPPVVLVPGDLG--------NQLEAKLDKPKVVHY--LCSKRTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRTTQFPDGVDVRVPGFGETFSLEFLDPSKRNVGSYFYTMVESLVGWGY-TRGEDVRGAPYDWRRAPNENGPYFLALQEMIEEMYQMYGG-PVVLVAHSMGNMYMLYFLQRQPQAWKDKYIQAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTANYTLRDYHRFFQDIGFEDGWFMRQDTQGLVEAL-VPPGV-ELHCLYGTGVPTPNSFYYENFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHKVSLQELPGSEHIEMLANATTLAYLKRVLLEEP 413          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. UniProt/SwissProt
Match: sp|Q6XPZ3|PAG15_CANLF (Phospholipase A2 group XV OS=Canis lupus familiaris OX=9615 GN=PLA2G15 PE=1 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 4.885e-48
Identity = 109/319 (34.17%), Postives = 184/319 (57.68%), Query Frame = 1
Query:  259 KLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISYILPK-NAKYFRELERTFPSIAFLLPKPEVFGKDPLVVSSKRS-YSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKYSSFPDSEPVVVKGDGDGTVNLESLQVCRNWKNTK-----YLVLEKEQHIDILKSSKLIKFLIEIL 1194
            +L+YN  +R+T      ++  PG+G T ++E L         YF ++VE LV   Y +R + VRGAPYD+RRAPNEN  +F  L+++IEE +   G   VVL+ HS+G++Y+LYFL++   +WK K++++F+++  P+ G  + L     G +  +P       RE +R+  S ++LLP    +  + + V +  + Y+  DY + F+D+  + G +M +DT+ L+ A   P G+  ++C+Y  G+ TP    Y SFPD +P +  GDGDGTVNL+S   C+ W+  +        L   +HI++L ++  + +L  +L
Sbjct:   91 RLVYNRTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVDWGY-IRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGG-PVVLVAHSMGNMYTLYFLQRQPQAWKNKYIQAFVALGAPWGGVAKTLRVLASGDNNRIPVIRPLKIREQQRSAVSTSWLLPYNYTWSPEKIFVHTPTANYTLRDYHQFFQDIGFKDGWLMRQDTEGLVEAM-VPPGV-PLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLQSALQCQAWRGHQEHQVSLQALPGSEHIEMLANATTLAYLKRVL 405          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. UniProt/SwissProt
Match: sp|Q8WMP9|PAG15_BOVIN (Phospholipase A2 group XV OS=Bos taurus OX=9913 GN=PLA2G15 PE=1 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 3.482e-45
Identity = 124/385 (32.21%), Postives = 197/385 (51.17%), Query Frame = 1
Query:  124 PIVLVPGNGGSRAYNYQKNDLICKEDLIWINYYYLLFPKKLNRIF---------------------KLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISYILPK-NAKYFRELERTFPSIAFLLPKPEVFGKDPLVV-SSKRSYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKYSSFPDSEPVVVKGDGDGTVNLESLQVCRNWKNTK-----YLVLEKEQHIDILKSSKLIKFLIEIL 1194
            P+VLVPG+ G        N L  K D   + +Y  +  K+ +  F                     +LIYN  + +T      ++  PG+G T ++E L         Y  ++VE LV   Y  R K VRGAPYD+RRAPNEN  +F  L+K+IEE +   G   VVL+ HS+G++Y LYFL+     WK K++R+F+++  P+ G  + L     G +  +P   +   R  +R+  S  +LLP    +    + V + K +Y+  DY++ F+D+  + G  M +DT+ L+ A+  P G+  ++C+Y  G+ TP+   Y SFPD +P +  G GDGTVNL+S   C  W+  +        L   +HI +L ++  + +L  +L
Sbjct:   34 PVVLVPGDMG--------NQLEAKLDKPSVVHY--VCSKRTDHYFTLWLNLELLLPVIIDCWIDNVRLIYNQTSHTTQFPEGVDVRVPGFGDTFSMEFLDPSKSSVGSYLHTMVESLVSWGY-ERGKDVRGAPYDWRRAPNENGPYFLALRKMIEEMYQLYGG-PVVLVAHSMGNMYMLYFLQHQPQDWKDKYIRAFVALGPPWGGVPKTLRVLASGDNNRIPVIRSLKIRAQQRSAVSTTWLLPYSYTWSPQKVFVRTPKANYTLQDYRQFFQDIGFKDGWSMRQDTEGLVEAT-VPPGV-RLHCLYGTGVPTPESFDYESFPDRDPKIHYGTGDGTVNLQSALHCHTWRGLQKQEVSLQALPGNEHIAMLANTTTLAYLKRVL 404          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. TrEMBL
Match: A0A074Z6F7 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_09225 PE=4 SV=1)

HSP 1 Score: 301.212 bits (770), Expect = 2.606e-94
Identity = 166/380 (43.68%), Postives = 243/380 (63.95%), Query Frame = 1
Query:  109 SQTFSPIVLVPGNGGSRAYNYQKNDLICKEDLIWINYYYLLFPKKLNRIFKLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISY-ILPKNAKYFRELERTFPSIAFLLPKPEVF-GKDPLVVSSKRSYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKY-------SSFPDSEPVVVKGDGDGTVNLESLQVCRNWKNTKYLVLEKEQHIDILKSSKLIKFLIEILHLRPTNKFR 1221
            ++T SPIVLVPG+GGS+AY      +  +  L+W+N  Y + P  L + F +IY+P T    D    N++FPGWG T +IE L         YFE LV  L + P+YV N+T+RG P+DFRRAPNEN DF   L+ LIEET++ +G+ +VVLLGHSLGSLY L FL      WKRK++++FLSV+GP  G+V+AL  E  G ++ +L ++   FRE++R+ PS AFL+P P ++   +P++++ K +YSA+DY++LF D++   G    ++TK  ++    PTGLDE+YCI+   + T  QL Y         FPD  P ++ GDGDGTV+L SLQ+CR W   KY+VLE  +H+ I+   + +K + EI  ++ ++  R
Sbjct:   62 AETQSPIVLVPGDGGSQAYCSPTGSV--ESFLLWVNLRYFITPGTLAQYFSIIYDPRTGEIHDSDLCNVTFPGWGDTWSIENLDTYKHSGTVYFEHLVTSLRQDPFYVSNRTLRGTPFDFRRAPNENPDFQQRLRLLIEETYIIAGSRRVVLLGHSLGSLYCLAFLHAQSNDWKRKYIKAFLSVSGPLGGSVKALKLEVSGDNFGVLIRSPLSFREVQRSLPSTAFLMPDPRLWPPSEPIIITPKLNYSAHDYQKLFSDINFPQGYAFLQNTKPSVDGFMGPTGLDEVYCIHGSKVSTTYQLVYPEPSFFHKGFPDEYPTLITGDGDGTVHLRSLQLCRLWPGAKYIVLEGAEHLHIVGDERFLKLIHEIAGVQQSHCRR 439          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. TrEMBL
Match: A0A564Y6A1 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS3097 PE=4 SV=1)

HSP 1 Score: 295.434 bits (755), Expect = 2.680e-92
Identity = 159/372 (42.74%), Postives = 240/372 (64.52%), Query Frame = 1
Query:  103 IDSQTFSPIVLVPGNGGSRAYNYQKNDLICKEDL--IWINYYYLLFPKKLNRIFKLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISY-ILPKNAKYFRELERTFPSIAFLLPKPEVFGKDPLVVSS-KRSYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKY-SSFPDSEPVV-VKGDGDGTVNLESLQVCRNWKN---TKYLVLEKEQHIDILKSSKLIKFLIEI 1191
            + S+   P++L+PG+GGS+AY   ++   C+ D   IW++  YL+ P+     FKLIYN  TR+T D     I+FPGWG T +++ L        KYFE +    ++ PYYV+N T+RGAP+DFR+APNEN DF   +K L+EETF N  N KVVLL HS+GSLY L+FL    ++WKRK++++F+  + P  G+++AL  E  G ++ I   +  ++REL+R+ PS+AFLLP P ++    +V+++  ++Y+ YDYKE F D+    G  MYEDTK +++  + P+G+DEIYCIYS  +QTP  + Y S+FPD++P +  + DGDGTVN  SL VC++W +    K  ++    H+ I+   + IK + EI
Sbjct:   39 VKSEMPHPLILIPGDGGSQAYAQFRD---CQSDPFPIWVDLRYLVSPRTFGDYFKLIYNNKTRTTEDNDKAIITFPGWGETWSVDNLDSRPHSVTKYFEDVTAAFIQNPYYVKNFTIRGAPFDFRKAPNENVDFVPKMKALVEETFTNGQNQKVVLLAHSMGSLYGLHFLNNQTVAWKRKYIKAFIVASAPLGGSIKALKIEASGDNFGIYLDSPLWYRELQRSMPSLAFLLPDPRIWSSSEVVIATPTKNYTVYDYKEFFDDIGFPEGYQMYEDTKAIVDPFKPPSGVDEIYCIYSSAVQTPASMLYTSAFPDAQPTINYESDGDGTVNARSLAVCQSWTDVVKVKTQIIPGVNHLSIVLDPRFIKAVKEI 407          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. TrEMBL
Match: A0A0R3W1G2 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS3571 PE=4 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 3.205e-91
Identity = 168/388 (43.30%), Postives = 249/388 (64.18%), Query Frame = 1
Query:  124 PIVLVPGNGGSRAYNYQKNDLICKEDLIWINYYYLLFPKKLNRIFKLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISY-ILPKNAKYFRELERTFPSIAFLLPKPEVFGKDPLVVSSK-RSYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKYSS-FPDSEP-VVVKGDGDGTVNLESLQVCRNWKNT-------KYLVLEKEQHIDILKSSKLIKFLIEIL---HLRPTNKFRYQDLMDNI 1245
            P+++VPG+GGS+AY  Q  D I +   IWI+  YL+ P+     FKL YN  TR T +     I+FPGWG T +++ L        KYF+ L    ++ PYYV N T+RGAP+DFR+APNEN DF   LK+L+EETF N    +VVLLGHS+G+LY+L FLK    +WKR+++++F++V+ P  G+++AL  E  G ++ I   N  ++RE++R+ PS+AFLLP P ++ KD +V+ S  ++Y+ +DYKE F D+    G  MYEDTK  ++    P+G+D++YCIYS  ++TP  L YSS FPD++P VV + DGDGTVN+ SL VC++W N+       + LV+    H+ I+  S+LI  + EI     L P  +  +Q L+ ++
Sbjct:   38 PLIMVPGDGGSQAYA-QFKDHISEPFQIWIDLRYLISPQTFGDYFKLKYNNETRRTEENDKAIITFPGWGETWSVDNLDSRPHSVTKYFQDLTTAFMQNPYYVPNFTIRGAPFDFRKAPNENVDFNPKLKQLVEETFHNGNEQRVVLLGHSMGALYALSFLKNQSDTWKRRYIKAFVAVSAPLGGSIKALKIEASGDNFGIYFGNPLWYREMQRSMPSLAFLLPDPRLWSKDEVVIYSPIKNYTVHDYKEFFSDIGFPEGFQMYEDTKLTVDGLTPPSGVDKVYCIYSSAVRTPGTLIYSSTFPDAQPDVVYEADGDGTVNMRSLSVCQSWVNSSGGVGQVETLVIPGVNHLSIVLDSRLIDRVKEISNAEQLMPPRESLWQSLLHSL 424          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. TrEMBL
Match: A0A504YB47 (Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A OS=Fasciola gigantica OX=46835 GN=FGIG_00722 PE=4 SV=1)

HSP 1 Score: 290.426 bits (742), Expect = 5.834e-91
Identity = 170/385 (44.16%), Postives = 239/385 (62.08%), Query Frame = 1
Query:   64 IECLLLSMMLIGTIDSQTFSPIVLVPGNGGSRAYNYQKNDLICKEDLIWINYYYLLFPKKLNRIFKLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISY-ILPKNAKYFRELERTFPSIAFLLPKPEVF-GKDPLVVSSKRSYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKY-------SSFPDSEPVVVKGDGDGTVNLESLQVCRNWKNTKYLVLEKEQHIDILKSSKLIKFLIEI 1191
            ++ +L  M L+G   S+ + PIVLVPG+GGS+AY   K     +  LIW+N  Y   P  L   F L+Y+P T +  D P   + FPGWG T +IE L         YFE LV  L+  P+Y    T+RGAP+DFRR+PN N  F   +  LIEETF N+G+  VVL+GHSLGSLY L FLKK   +WKRK+++SFLSV+GP  G+V+AL  E  G ++ ++  +A  FR ++R+ PS+AFLLP P ++   + ++++  ++YSA+DYKE F D++ + G  M   TK+ I+    PTG+DE+YCIY  G+ T  Q+ Y       S+FPD  P +V GDGDGTV++ SLQ+CR W   K   L   +H+ I+  S+LI  L +I
Sbjct:    8 LQVILFIMFLLGIKCSEKY-PIVLVPGDGGSQAYCDHKAK--NQSFLIWVNLIYFFRPSWLEGYFNLVYDPATGNFSDTPECEVIFPGWGETWSIENLDTSRHSSTVYFEYLVSSLLLDPFYKSGVTLRGAPFDFRRSPNLNTGFSRKMTTLIEETFHNAGDKPVVLVGHSLGSLYCLAFLKKQSDTWKRKYVKSFLSVSGPLGGSVKALKIEASGDNFGLIVPSALSFRSVQRSMPSLAFLLPDPRLWPPTEKIILTPNKNYSAHDYKEFFDDINYQLGYEMLIKTKSSIDTLLGPTGIDELYCIYGSGLPTTYQMIYLPPTFYRSAFPDQYPTLVTGDGDGTVHMRSLQLCRFWPGVKSYELPGAEHLRIVGDSRLIDLLRQI 389          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. TrEMBL
Match: A0A0R3TLN4 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS8166 PE=4 SV=1)

HSP 1 Score: 291.582 bits (745), Expect = 8.527e-91
Identity = 162/370 (43.78%), Postives = 236/370 (63.78%), Query Frame = 1
Query:  103 IDSQTFSPIVLVPGNGGSRAYNYQKNDLICKEDLIWINYYYLLFPKKLNRIFKLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISY-ILPKNAKYFRELERTFPSIAFLLPKPEVFGKDPLVVSS-KRSYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKY-SSFPDSEPVV-VKGDGDGTVNLESLQVCRNWKN---TKYLVLEKEQHIDILKSSKLIKFLIEI 1191
            + S    PI+L+PG+GGS+AY  Q  D       IW++  YL+ P+  +  FKLIYN  TR T D     I+FPGWG T  ++ L        KYFE +    ++ PYYV+N T+RGAP+DFR+APNEN DF   +K L+EETF+N  N KVVLL HS+GSLY L+FL +   +WKRK++++F+S + P  G+++AL  E  G ++ I   +  ++RE++R+ PS+AFLLP P+++    +V+S+  ++Y+ +DYKE F D+    G  M++DTK  +N    P+GLDEIYCIYS  +QTP  + Y S+FPD++P +  + DGDGTVN  SL VC++W      K LV+    H+ I+   + IK + EI
Sbjct:   39 VKSDMPHPIILIPGDGGSQAYA-QFRDHQSDPFPIWVDLRYLVSPRTFSDYFKLIYNNKTRKTEDNEKAIITFPGWGETWPVDNLDSRPHSVTKYFEDVTADFIQNPYYVKNFTIRGAPFDFRKAPNENVDFVPKMKALVEETFINGQNQKVVLLAHSMGSLYCLHFLNRQTDAWKRKYIKAFISASAPLGGSIKALKIEASGDNFGIYLDSPLWYREVQRSMPSLAFLLPNPQLWSPSEVVISTPTKNYTVHDYKEFFSDIGFPEGYQMFQDTKATVNPFVPPSGLDEIYCIYSSAVQTPGSMVYDSTFPDAQPTINYEPDGDGTVNARSLAVCQSWSGGVKVKTLVIPGVNHLSIVLDPRFIKAVKEI 407          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Cavefish
Match: pla2g15 (phospholipase A2, group XV [Source:ZFIN;Acc:ZDB-GENE-030131-6948])

HSP 1 Score: 177.948 bits (450), Expect = 8.049e-51
Identity = 138/404 (34.16%), Postives = 221/404 (54.70%), Query Frame = 1
Query:   70 CLLL---SMMLIGTIDSQTFS---PIVLVPGNGGSRA------------YNYQKNDLICKEDLIWINYYYLLFPKKLNRI---FKLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISYILPKNAKY-FRELERTFPSIAFLLPKPEVFGKDPLVVSS-KRSYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKYSSFPDSEPV-VVKGDGDGTVNLESLQVCRNWKN-----TKYLVLEKEQHIDILKSSKLIKFLIEIL 1194
            CLLL   S + +   D +  S   P+VL+PG+ G++               Y+K D   +   +W+N   LL P  ++      +LIYN  T  T   P  ++  PG+G T  +E L         YF ++V+ +V   Y  R++ VRGAPYD+R+APNENK +F  L+++IEE     G   VVL+ HS+G++Y+LYFL     +WK K++++F+S+  P+AG  + L     G +  +P  +    R  +RT  S A+L P    +  D ++VS+ K +Y+  DY+  FKD++ + G  M EDT+ L++A E P G+  ++C+Y  GI T +   Y +FPD+EP  VV G+GDGTVN+ S   C+ WK+      + L L   +H+ +L +   + ++  +L
Sbjct:   20 CLLLCFASCVPLKCSDPKRCSGRPPVVLIPGDLGNQLEAKLDKPSVVHYICYKKTD---EYFTLWLNLE-LLVPVAIDCWIDNMRLIYNSTTHLTEAPPGVDVQVPGFGQTFGLEYLDPSKRSVGIYFFTIVQAMVDWGY-TRDEDVRGAPYDWRKAPNENKQYFLKLQQMIEEMAEKYGG-PVVLIAHSMGNMYTLYFLNHQPQAWKDKYIKAFVSLGPPWAGVAKTLRVMASGDNNRIPVISPLKIRTQQRTAVSTAWLFPYAHTWPSDMVLVSTPKANYTVSDYQRFFKDLNYKDGWSMREDTEPLVSALEAP-GV-AVHCLYGTGIPTAQSYIYGTFPDAEPTKVVNGEGDGTVNVLSAVQCKRWKSQQKQPVQLLELPGNEHVAMLLNITTVSYIKSVL 415          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Cavefish
Match: lcat (lecithin-cholesterol acyltransferase [Source:NCBI gene;Acc:103041308])

HSP 1 Score: 165.622 bits (418), Expect = 5.662e-46
Identity = 134/384 (34.90%), Postives = 213/384 (55.47%), Query Frame = 1
Query:  109 SQTFSPIVLVPGNGGSR-AYNYQKNDLI---C---KEDL--IWINYYYLLFPKKLNRI---FKLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISYILP--KNAKYFRELERTFPSIAFLLPKPEVFGKDPLVVSSK-RSYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKYS-SFPDSEPV-VVKGDGDGTVNLESLQVCRNW---KNTKYLVLEKE--QHIDILKSSKLIKFLIEIL 1194
            + T  P+++VPGN G+R      K  L+   C    ED   +WI+   +  P  ++      +++YN  TR T + P   +  PG+G T  +E L    +    YF ++++ LV + Y VRN+TVR APYD+R APNE  ++F+ LK+L+EE   +     V LLGHS+GS Y LYFL +   +WK +F++SF+S+  P+ GAV+ L     G +  +P   N K  RE +R   +  +++P  E + K+ + +S+   +Y+  DY+  F D+  E G  M+EDT+NL     TP G+ E+YC Y  G+ TP    Y   FP+S+P+  V  DGD TV+  S+++C+ W   +     V E +   H+DI+ +  ++  + EIL
Sbjct:   41 NSTLPPLIIVPGNLGNRLEAKIDKPSLVHWLCYKKSEDWFPLWIDLN-MFMPIGVDCWIDNMRIVYNRTTRKTSNAPGVEVRAPGFGQTYTVEFLDNNKLA--GYFHTMLQHLVNMGY-VRNETVRAAPYDWRIAPNEQDEYFSQLKRLVEE-MHDEYKQPVHLLGHSMGSNYILYFLNQQSQAWKDRFIKSFISLGAPWGGAVKPLRVLASGDNDGIPLVSNIK-IREEQRMTTTNPWMIPSEEAWYKEHVFISTPFFNYTNQDYQRFFTDIHFEDGWHMWEDTRNLTAGLPTP-GV-EVYCFYGVGLPTPVTYIYDEEFPNSDPIDFVYDDGDDTVDSRSMRMCQRWIGKQEQPVYVTEFKGLPHLDIVFNHNVLTTIQEIL 416          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Sea Lamprey
Match: pla2g15 (phospholipase A2, group XV [Source:ZFIN;Acc:ZDB-GENE-030131-6948])

HSP 1 Score: 160.999 bits (406), Expect = 4.100e-45
Identity = 115/330 (34.85%), Postives = 183/330 (55.45%), Query Frame = 1
Query:  256 FKLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQAL------YSETHGISYILPKNAKYFRELERTFPSIAFLLPKPEVFGKDPLVVSS-KRSYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKYS-SFPDSEPV-VVKGDGDGTVNLESLQVCRNWKNTK-YLVLEKE----QHIDILKSSKLIKFLIEILHLR 1203
             +L YN  TR+T       +  P +G T  +E L    V    YF +LVE +     Y RN+ +RGAPYD+R+APNEN ++ TNLK +IEE +     + VVL+ HS+G+ Y  YFL +   +WK KF+ SF+++  P+ GA + L        + +GI  I   +    R  +RT  S ++LLP    +  D ++VS+ KR+Y+  DY++ + D+    G +M +DT++ +     P G+  ++C+Y  G+ TP    Y  SFPD +P  V+  DGDGTV+L S  +CR W   +   VL +E    +H+ +L  + LI+++  ++  R
Sbjct:  106 MRLEYNLTTRATSSPNGVQVRVPDFGKTFPVEFLDPSNVSVGSYFHTLVEAMEGW-GYKRNQDIRGAPYDWRKAPNENGEYLTNLKNMIEEMYATYW-SPVVLVAHSMGNPYMRYFLGQQSQAWKDKFIHSFVALGPPWGGAAKTLRVLTSGTGDNNGIPVI---STLKIRAQQRTAVSTSWLLPYNTSWPPDKVLVSTPKRNYTNRDYRDFYNDIGYPEGWLMRQDTESYLYGQPLP-GV-PVHCLYGTGVATPDSFVYDKSFPDHDPTRVITADGDGTVSLASALLCREWAGRQPQPVLLRELPGAEHVSMLSRADLIQYIKGVIFNR 428          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Nematostella
Match: EDO33966 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQQ2])

HSP 1 Score: 161.77 bits (408), Expect = 2.568e-45
Identity = 116/382 (30.37%), Postives = 198/382 (51.83%), Query Frame = 1
Query:  109 SQTFSPIVLVPGNGGSR---------AYNYQKNDLICKEDLIWINYYYLL--FPKKLNRIFKLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISYILP-KNAKYFRELERTFPSIAFLLPKPEVFGKDPLVVSS-KRSYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKY--SSFPDSEPVVVKGDGDGTVNLESLQVCRNWKNTK-YLVLEKE----QHIDILKSSKLIKFLIEIL 1194
            +Q  +P+V+VPG GGS+           ++  ++       +W+   +LL  F        +L+Y+P T++  + P      PG+G T  IE L    +  + YF  LV+ +V   Y  R K +R APYDFR AP+   D++  L++LIE+T+  +G  +V LL HSLG  Y+L FL +   +WK K+++ +++++G + G  Q +     G ++ +P  N    R  +RT  S  F+LP  E++  D ++V++  R Y+  D+++ F+D+    G  +  + +NL            ++C++  G+ T +   Y    FPD +P +  GDGDGTVN  SL+ C  W N + Y V+ K+     H  IL  +K   ++  I+
Sbjct:   30 AQIKNPVVIVPGTGGSQIEAKLNKPTTKHWYCHNTWSDYFTLWLQESFLLPMFIDCWVDNMRLVYDPATKTVHNSPGVETRVPGFGDTNTIEYLDKRNL--IAYFAPLVKAMVSWGYE-RGKNLRAAPYDFRYAPDSQADYYIRLRQLIEDTYTQNGEKQVTLLSHSLGCPYTLVFLNQQSTAWKDKYIKQWVALSGVWGGTTQLVRLFASGDAFGIPLVNPLTVRVEQRTCSSNNFMLPSRELWRSDEVLVTTPDRKYTVRDFEDYFRDVGYPDGIPVRRNLENLTAPLLQHAPNVTLHCLHGSGVDTEESYTYGKGEFPDEQPTIRNGDGDGTVNARSLRACATWVNRQGYDVVVKDYAGVNHNGILSDAKAQAYIKSIV 408          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Nematostella
Match: EDO47377 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMN6])

HSP 1 Score: 155.606 bits (392), Expect = 4.568e-43
Identity = 116/393 (29.52%), Postives = 202/393 (51.40%), Query Frame = 1
Query:   79 LSMMLIGTIDSQTFS--PIVLVPGNGGSRA----YNYQKNDLICKEDLIWINYYYLL---FPKKLNRI---FKLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISYILPK---NAKYFRELERTFPSIAFLLPKPEVFG-KDPLVVSSKRSYSAYDYKELFKDMDMEYGNMMYEDTKNLINA--SETPTGLDEIYCIYSKGIQTPK--QLKYSSFPDSEPVVVKGDGDGTVNLESLQVCRNWKNTKYLVL-----EKEQHIDILKSSKLIKFL 1182
            LS +L+ ++ S+T+   PI+LVPG+GGSR             +CK    W + +  L    P+ ++      +L+Y+   +     P   I  P +G T ++  L        +YF  L++ LV I Y  ++K +R AP+DFR AP+   +F+   + L+E+ FM  G   V+++ HSLG  Y+ YFL ++   WK K+L +++++ G + GA +     + G +   P    N    R   RT+ S  FLLP  + +  K+P++ + K++YS  +++E   D++   G  +    K L+    S+ P  +  +YC+Y  G+ TP+  + K   FPD+ P    GDGDGTVN +SL+ C  ++ T+   +      K +H+ I+   ++  F+
Sbjct:   11 LSYLLLASLVSKTYCKPPILLVPGDGGSRLDAKLNKTTAPHYVCKRINDWFHIWLSLEELLPEVIDCWSDDMRLVYDEKHKRMTSPPGVQIRVPDFGKTSSVAYLDPTIDHPGEYFAPLIDALVSIGY-TKDKNLRAAPFDFRYAPDSAGEFYAYFQALVEQMFMEGGGEPVLVVSHSLGVPYTKYFLDRIHQEWKDKYLHAWVTIGGAWGGAAKLFRIISSGTNLGFPDFILNPLKMRVGLRTYESTTFLLPSEKFWDVKEPVIFTPKKNYSLSNFEEFLDDLNFPLGKTI----KGLVPPVWSDHPPNV-TLYCLYGTGVPTPRTFEFKEGQFPDTYPKTNFGDGDGTVNRKSLEGCFQYEKTQKRPVVTRQFPKAEHMAIIGDKRVTDFI 397          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Medaka
Match: lcat (lecithin-cholesterol acyltransferase [Source:NCBI gene;Acc:101172491])

HSP 1 Score: 184.111 bits (466), Expect = 4.160e-53
Identity = 141/380 (37.11%), Postives = 214/380 (56.32%), Query Frame = 1
Query:  121 SPIVLVPGNGGSR-AYNYQKNDLI---C--KEDL---IWINYYYLLFPKKLNRIF---KLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISYILP--KNAKYFRELERTFPSIAFLLPKPEVFGKDPLVVSSKR-SYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKYS-SFPDSEPV-VVKGDGDGTVNLESLQVCRNWKNTKYLVLEKEQ-----HIDILKSSKLIKFLIEIL 1194
            SP+++VPG+ G+R      K  L+   C  K D    IWI+   +  P  ++      +L+YN  TR + + P   +  PG+G T  IE L Y  +    YF S+VE LV + Y VRN+TVRGAPYD+R APNEN ++F  L++L+EE + N     V LLGHS+G  Y LYFL     +WK  ++R F+S+  P+ GAV+ L   T G +  +P   N K  RE +R   +  ++LP  + + KD + +S+   +Y+  DYK LF D+D E G  M+EDTKNL  A   P G+ E++C+Y  G+ TP    Y   FP+++PV  V  DGD TV+  S+ +C+ W+  +   +   +     H+D++   K++  + +IL
Sbjct:   45 SPLIIVPGSLGNRLEAKIDKPALVHWMCFKKSDHWFPIWIDLN-MFMPIGVDCWIDNIRLVYNKTTRRSSNSPGVQVRVPGFGETYTIEFLDYNNLA--GYFHSMVEHLVNVGY-VRNETVRGAPYDWRLAPNENSEYFIRLQELVEEMY-NQYQKPVYLLGHSMGGHYVLYFLNNQPQAWKDTYIRGFISLGAPWGGAVKVLRVMTSGNNDGIPMLSNIK-LREEQRMMTTNPWMLPSEDAWPKDHVFISTPSVNYTNQDYKRLFTDIDFENGWHMWEDTKNLTGALH-PPGV-EVWCMYGVGLPTPVTHIYDEDFPNADPVDYVYADGDDTVDSFSMSLCKRWEGQQEKPVHVTEYRGLAHLDMVFHEKVLHQIQQIL 416          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Medaka
Match: pla2g15 (phospholipase A2 group XV [Source:NCBI gene;Acc:101172239])

HSP 1 Score: 178.718 bits (452), Expect = 3.332e-51
Identity = 133/377 (35.28%), Postives = 212/377 (56.23%), Query Frame = 1
Query:  124 PIVLVPGNGG----SRAYNYQKNDLIC--KED---LIWINYYYLLFPKKLNRIF---KLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISYILPKNAKY-FRELERTFPSIAFLLPKPEVFGKDPLVVSSKR-SYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKYS-SFPDSEPVVVKGDGDGTVNLESLQVCRNW-KNTKYLVLEKE----QHIDILKSSKLIKFLIEIL 1194
            P+VL+PG+ G    +R         IC  K D    +W+N   LL P  ++      +LIYN  TR++   P   +  PG+G T ++E L         YF S+V+ +V+  Y  R+  VRGAPYD+R+APNENK++F  L+++IEE    +G   VVL+ HS+G++Y+LYFL +   +WK K++++F+ +  P+AG  + L     G +  +P  +    R  +RT  S  +LLP    + KD +++ +   +Y+  DY+ L+KD+  + G +M +DT+ L++    P    E++C+Y  GI T +   YS +FPD EP VV GDGDGTVNL S   C+ W    K  V  KE    +H+D+L +   + ++ ++L
Sbjct:   45 PVVLIPGDLGNQLEARLNKPSVVHYICYKKTDSFFTLWLNLE-LLVPFAIDCWIDNIRLIYNRTTRTSEAPPGVFVRVPGFGKTFSLEYLDPSKQSVGMYFFSIVQSMVEWGY-TRDDDVRGAPYDWRKAPNENKEYFLKLQQMIEEMAEKAGG-PVVLIAHSMGNMYTLYFLNQQPQAWKDKYIKAFICLGPPWAGVAKTLRVIASGDNNRIPVISPLKIRTQQRTAVSTNWLLPYAHSWSKDQVLIRTPSVNYTVQDYRRLYKDIGFDDGWLMRQDTEPLVSDLLPPNV--EVHCLYGSGINTSEAFHYSNNFPDEEPTVVNGDGDGTVNLRSAIQCKRWVGQQKQPVFLKELRGNEHVDMLTNYTTVAYIKKVL 416          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Planmine SMEST
Match: SMESG000037742.1 (SMESG000037742.1)

HSP 1 Score: 540.806 bits (1392), Expect = 0.000e+0
Identity = 280/282 (99.29%), Postives = 282/282 (100.00%), Query Frame = 1
Query:   55 MIFIECLLLSMMLIGTIDSQTFSPIVLVPGNGGSRAYNYQKNDLICKEDLIWINYYYLLFPKKLNRIFKLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISYILPKNAKYFRELERTFPSIAFLLPKPEVFGKDPLVVSSKRSYSAYDYKELFKDMDMEYGN 900
            MIFIECLLLSMMLIGTI+SQTFSPIVLVPGNGGSRAYNYQKNDLICKEDLIWINYYYLLFPKKLNRIFKLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVLLGHSLGSLYSLYFLKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISYILPKNAKYFRELERTFPSIAFLLPKPEVFGKDPLVVSSKRSYSAYDYK+LFKDMDMEYGN
Sbjct:    1 MIFIECLLLSMMLIGTINSQTFSPIVLVPGNGGSRAYNYQKNDLICKEDLIWINYYYLLFPKKLNRIFKLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVLLGHSLGSLYSLYFLKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISYILPKNAKYFRELERTFPSIAFLLPKPEVFGKDPLVVSSKRSYSAYDYKKLFKDMDMEYGN 282          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Planmine SMEST
Match: SMESG000037742.1 (SMESG000037742.1)

HSP 1 Score: 520.005 bits (1338), Expect = 0.000e+0
Identity = 270/274 (98.54%), Postives = 272/274 (99.27%), Query Frame = 1
Query:   85 MMLIGTIDSQTFSPIVLVPGNGGSRAYNYQKNDLICKEDLIWINYYYLLFPKKLNRIFKLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISYILPKNAKYFRELERTFPSIAFLLPKPEVFGKDPLVVSSKRSYSAYDYKELFKDMDMEYGNMM 906
            MMLIGTI+SQTFSPIVLVPGNGGSRAYNYQKNDLICKEDLIWINYYYLLFPKKLNRIFKLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVLLGHSLGSLYSLYFLKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISYILPKNAKYFRELERTFPSIAFLLPKPEVFGKDPLVVSSKRSYSAYDYK+LFKDMDMEYGN  
Sbjct:    1 MMLIGTINSQTFSPIVLVPGNGGSRAYNYQKNDLICKEDLIWINYYYLLFPKKLNRIFKLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVLLGHSLGSLYSLYFLKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISYILPKNAKYFRELERTFPSIAFLLPKPEVFGKDPLVVSSKRSYSAYDYKKLFKDMDMEYGNFF 274          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Planmine SMEST
Match: SMESG000037742.1 (SMESG000037742.1)

HSP 1 Score: 518.079 bits (1333), Expect = 0.000e+0
Identity = 269/273 (98.53%), Postives = 271/273 (99.27%), Query Frame = 1
Query:   88 MLIGTIDSQTFSPIVLVPGNGGSRAYNYQKNDLICKEDLIWINYYYLLFPKKLNRIFKLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISYILPKNAKYFRELERTFPSIAFLLPKPEVFGKDPLVVSSKRSYSAYDYKELFKDMDMEYGNMM 906
            MLIGTI+SQTFSPIVLVPGNGGSRAYNYQKNDLICKEDLIWINYYYLLFPKKLNRIFKLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVLLGHSLGSLYSLYFLKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISYILPKNAKYFRELERTFPSIAFLLPKPEVFGKDPLVVSSKRSYSAYDYK+LFKDMDMEYGN  
Sbjct:    1 MLIGTINSQTFSPIVLVPGNGGSRAYNYQKNDLICKEDLIWINYYYLLFPKKLNRIFKLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVLLGHSLGSLYSLYFLKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISYILPKNAKYFRELERTFPSIAFLLPKPEVFGKDPLVVSSKRSYSAYDYKKLFKDMDMEYGNFF 273          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Planmine SMEST
Match: SMESG000037748.1 (SMESG000037748.1)

HSP 1 Score: 381.719 bits (979), Expect = 6.575e-130
Identity = 190/371 (51.21%), Postives = 268/371 (72.24%), Query Frame = 1
Query:  106 DSQTFSPIVLVPGNGGSRAYNYQKNDLICKEDLIWINYYYLLFPKKLNRIFKLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISYILPKNAKYFRELERTFPSIAFLLPKPEVFGKDPLVVSSKRSYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKYSSFPDSEPVVVKGDGDGTVNLESLQVCRNWKNTKYLVLEKEQHIDILKSSKLIKFLIEILHLRPTNKF 1218
            DS+  SPI+L+PG+GGSRAY+     +   + L+W+N+ Y++FP  L  +FKL YN     T ++  +++ FPGWG TE IE L      +  YF +LV+ LV   YYVRNKTVRGAPYDFR+APNEN+    +LK LIE+T+  SGN +VV+LGHSLGSLYSLYF K+M +SWK++++R+FLSV+GP  GAV+A+  ET G S   P++  YFRE++R+FPS +FLLPKPE+FGK+P +++  R+YS+YDY++LFKDM M YG+ MY DTKNL++ +ETP G+DE+YCI+S G+ T KQL + +FPD +P    GDGD TVN++SL++C  WKN  Y  ++   H+ I+ + + +  L +IL+ +P  KF
Sbjct:   29 DSKIPSPIILIPGDGGSRAYSNVDYRIFTTKVLVWVNFEYMVFPSLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVILGHSLGSLYSLYFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSPRSPIYFREMQRSFPSTSFLLPKPEIFGKEPFIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTFKAFPDGQPQFTTGDGDYTVNIQSLKICEKWKNVNYFTIKGADHMQIVSTPEFMLKLKQILYRQPNGKF 399          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Planmine SMEST
Match: SMESG000037740.1 (SMESG000037740.1)

HSP 1 Score: 365.155 bits (936), Expect = 8.012e-124
Identity = 197/384 (51.30%), Postives = 262/384 (68.23%), Query Frame = 1
Query:   55 MIFIECLLLSMMLIGTIDSQTF---SPIVLVPGNGGSRAYNYQKNDLICKEDLIWINYYYLLFPKKLNRIFKLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVXXXXXXXXXXXXXXXKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISYILPKNAKYFRELERTFPSIAFLLPKPEVFGKDPLVVSSKRSYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTGLDEIYCIYSKGIQTPKQLKYSSFPDSEPVVVKGDGDGTVNLESLQVCRNWKNTKYLVLEKEQHIDILKSSKLIKFLIEILH 1197
            MI +E    +++L+G  D       S IVLVPG+GGSR Y      L    DL+W+NY Y+LFP       KL Y+P T  T +  N  I  PGWGSTE IE L         YF + V  LVK  +YVRNKTVRGAPYDFRRAPNEN +FF NL++LIEET+  SGN +VVLLGHSLGSLYSLYFLK M  SWK+K+LR+F+S + P  G+++A+  +T G S   P+ +  FR+++R+FP+ AFL+ +PE+FG +P+V++ KR+YSA DY+  F DM    G MMYEDTKNL+N  ETP G+DEIYCIYS G+ T +Q+K  SFP+ EP ++ GDGDGTVN++SLQ+C+NWKN  +  +E   H++I+ + + I  +  IL+
Sbjct:    1 MISLEIFTFTLLLVGVPDVTARAAPSSIVLVPGDGGSRIYQEIDCYLFKFNDLVWVNYVYMLFPCLFTSRMKLQYDPKTHKTSNWNNNTILVPGWGSTEMIEELDQWRHPSTTYFYNFVNSLVKDKFYVRNKTVRGAPYDFRRAPNENTEFFVNLEELIEETYKLSGNRRVVLLGHSLGSLYSLYFLKLMTNSWKKKYLRAFISASSPLGGSMKAVKLQTSGTSLGSPRKSIMFRKMQRSFPTSAFLMIRPEIFGNEPIVITPKRNYSASDYEAFFADMSYPDGFMMYEDTKNLVNGFETPEGVDEIYCIYSNGLPTIRQIKLESFPNGEPSLIYGDGDGTVNIKSLQICKNWKNVHHSTIENVAHMEIVGTQEFIDLVKTILY 384          
The following BLAST results are available for this feature:
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLA2G151.886e-5234.91phospholipase A2 group XV [Source:HGNC Symbol;Acc:... [more]
LCAT3.783e-3226.39lecithin-cholesterol acyltransferase [Source:HGNC ... [more]
PLA2G153.654e-2932.69phospholipase A2 group XV [Source:HGNC Symbol;Acc:... [more]
PLA2G151.786e-2335.40phospholipase A2 group XV [Source:HGNC Symbol;Acc:... [more]
LCAT3.526e-1924.67lecithin-cholesterol acyltransferase [Source:HGNC ... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
M05B5.42.163e-5032.84pep chromosome:WBcel235:I:7188465:7190581:1 gene:W... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG188582.100e-5333.51gene:FBgn0042175 transcript:FBtr0332971[more]
CG188582.100e-5333.51gene:FBgn0042175 transcript:FBtr0081364[more]
CG316833.815e-5333.51gene:FBgn0051683 transcript:FBtr0330662[more]
CG316833.815e-5333.51gene:FBgn0051683 transcript:FBtr0081365[more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pla2g155.235e-5435.37phospholipase A2, group XV [Source:ZFIN;Acc:ZDB-GE... [more]
lcat2.385e-4634.29lecithin-cholesterol acyltransferase [Source:ZFIN;... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
PLA2G154.992e-4933.51phospholipase A2 group XV [Source:NCBI gene;Acc:10... [more]
fam53c2.185e-4434.63family with sequence similarity 53 member C [Sourc... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Pla2g154.317e-5231.04phospholipase A2, group XV [Source:MGI Symbol;Acc:... [more]
Lcat6.562e-3828.42lecithin cholesterol acyltransferase [Source:MGI S... [more]
Pla2g154.761e-932.21phospholipase A2, group XV [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8NCC3|PAG15_HUMAN9.056e-5234.91Phospholipase A2 group XV OS=Homo sapiens OX=9606 ... [more]
sp|Q8VEB4|PAG15_MOUSE3.020e-5131.04Phospholipase A2 group XV OS=Mus musculus OX=10090... [more]
sp|Q675A5|PAG15_RAT3.902e-4932.74Phospholipase A2 group XV OS=Rattus norvegicus OX=... [more]
sp|Q6XPZ3|PAG15_CANLF4.885e-4834.17Phospholipase A2 group XV OS=Canis lupus familiari... [more]
sp|Q8WMP9|PAG15_BOVIN3.482e-4532.21Phospholipase A2 group XV OS=Bos taurus OX=9913 GN... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A074Z6F72.606e-9443.68Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A564Y6A12.680e-9242.74Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A0R3W1G23.205e-9143.30Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A504YB475.834e-9144.16Phosphatidylcholine-sterol acyltransferase (Lecith... [more]
A0A0R3TLN48.527e-9143.78Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pla2g158.049e-5134.16phospholipase A2, group XV [Source:ZFIN;Acc:ZDB-GE... [more]
lcat5.662e-4634.90lecithin-cholesterol acyltransferase [Source:NCBI ... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pla2g154.100e-4534.85phospholipase A2, group XV [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO339662.568e-4530.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473774.568e-4329.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lcat4.160e-5337.11lecithin-cholesterol acyltransferase [Source:NCBI ... [more]
pla2g153.332e-5135.28phospholipase A2 group XV [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037742.10.000e+099.29SMESG000037742.1[more]
SMESG000037742.10.000e+098.54SMESG000037742.1[more]
SMESG000037742.10.000e+098.53SMESG000037742.1[more]
SMESG000037748.16.575e-13051.21SMESG000037748.1[more]
SMESG000037740.18.012e-12451.30SMESG000037740.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014043 ID=SMED30014043|Name=Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A|organism=Schmidtea mediterranea sexual|type=transcript|length=1303bp
CTCATTTGTCACTTTTGATAAATTATAAAGCGGACGCAAATTCCAAAAGC
AAAAATGATTTTTATTGAATGCCTGTTGTTATCTATGATGCTGATTGGTA
CCATAGATTCTCAGACTTTTAGTCCGATTGTATTGGTGCCTGGAAACGGG
GGGTCACGAGCTTATAATTATCAAAAAAATGATTTAATTTGCAAAGAAGA
TTTGATTTGGATCAATTACTATTATTTGTTGTTTCCAAAAAAGTTAAATA
GGATTTTCAAACTCATTTATAATCCTATCACTCGTTCTACCGGCGATTTG
CCAAATACAAACATATCATTTCCCGGTTGGGGGTCAACTGAAAACATTGA
AACTCTTGGATATCTAGCAGTTGGTAGAATGAAATATTTTGAATCTTTGG
TAGAGCAATTGGTAAAAATTCCTTATTATGTTAGGAATAAAACCGTTAGA
GGTGCACCTTATGATTTTCGAAGAGCACCAAACGAAAACAAAGATTTTTT
TACAAATTTGAAGAAGTTAATTGAAGAAACATTTATGAATTCTGGTAATA
CAAAAGTGGTTCTTCTGGGTCACAGTTTAGGATCTTTATATTCATTGTAT
TTTTTGAAAAAAATGGATATTTCTTGGAAGCGGAAGTTTTTGAGATCTTT
TCTGTCGGTTAATGGTCCCTTTGCAGGTGCAGTTCAAGCCCTTTATTCTG
AAACACATGGAATTTCATATATTCTACCAAAAAATGCAAAATATTTCAGA
GAGTTGGAAAGAACATTTCCAAGCATAGCATTTTTGCTTCCTAAACCGGA
AGTGTTTGGCAAAGATCCACTTGTAGTTTCATCCAAAAGGTCGTATTCAG
CTTATGATTATAAGGAATTATTTAAAGACATGGATATGGAATATGGTAAT
ATGATGTATGAAGACACGAAAAACCTAATCAACGCGTCTGAAACTCCAAC
AGGACTCGATGAAATTTACTGCATTTATTCCAAAGGAATTCAAACGCCGA
AACAGTTAAAATATTCTTCATTTCCCGACTCAGAACCTGTGGTTGTCAAA
GGGGATGGAGATGGAACCGTCAATCTTGAAAGTCTTCAAGTCTGTAGAAA
TTGGAAGAATACTAAATATTTAGTGTTGGAAAAAGAACAGCATATTGATA
TATTAAAGAGTTCAAAATTAATAAAATTTCTGATAGAAATATTGCACTTA
CGACCGACAAACAAATTTCGGTATCAAGATTTGATGGATAATATTCTATA
AAAAAACATTTAACCTGGAATTTTTAATCGAAATTTTCTAAATTAAGAGT
GTT
back to top

protein sequence of SMED30014043-orf-1

>SMED30014043-orf-1 ID=SMED30014043-orf-1|Name=SMED30014043-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=399bp
MIFIECLLLSMMLIGTIDSQTFSPIVLVPGNGGSRAYNYQKNDLICKEDL
IWINYYYLLFPKKLNRIFKLIYNPITRSTGDLPNTNISFPGWGSTENIET
LGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFT
NLKKLIEETFMNSGNTKVVLLGHSLGSLYSLYFLKKMDISWKRKFLRSFL
SVNGPFAGAVQALYSETHGISYILPKNAKYFRELERTFPSIAFLLPKPEV
FGKDPLVVSSKRSYSAYDYKELFKDMDMEYGNMMYEDTKNLINASETPTG
LDEIYCIYSKGIQTPKQLKYSSFPDSEPVVVKGDGDGTVNLESLQVCRNW
KNTKYLVLEKEQHIDILKSSKLIKFLIEILHLRPTNKFRYQDLMDNIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR029058AB_hydrolase
IPR003386LACT/PDAT_acylTrfase
Vocabulary: molecular function
TermDefinition
GO:0008374O-acyltransferase activity
GO:0016740transferase activity
GO:0016746transferase activity, transferring acyl groups
Vocabulary: biological process
TermDefinition
GO:0006629lipid metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003386Lecithin:cholesterol/phospholipid:diacylglycerol acyltransferasePFAMPF02450LCATcoord: 49..272
e-value: 1.1E-39
score: 136.7
NoneNo IPR availablePANTHERPTHR11440LECITHIN-CHOLESTEROL ACYLTRANSFERASE-RELATEDcoord: 20..384
NoneNo IPR availablePANTHERPTHR11440:SF35BCDNA.GH02384coord: 20..384
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.809
IPR029058Alpha/Beta hydrolase foldSUPERFAMILYSSF53474alpha/beta-Hydrolasescoord: 24..369