Protocadherin-9

Overview
NameProtocadherin-9
Smed IDSMED30014036
Length (bp)3433
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin-9 (SMED30014036) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin-9 (SMED30014036) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin-9 (SMED30014036) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin-9 (SMED30014036) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014036

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30014036SMESG000041975.1 SMESG000041974.1 dd_Smed_v4_7930_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30014036SMESG000041975.1 SMESG000041974.1 dd_Smed_v4_7930_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014036SMESG000041975.1 SMESG000041974.1 dd_Smed_v4_7930_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 179.489 bits (454), Expect = 3.611e-45
Identity = 184/645 (28.53%), Postives = 298/645 (46.20%), Query Frame = 1
Query:  607 LPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTV-ELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVN--PTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLN---NKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPS--SSAKIEIIIKDQNDNAPTLTYFGTP----SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLR----SKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESD--VFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGY 2484
            +P ATD D G N V+ Y++   +     + F L+++ T       +L V + LDRE  + Y   +   DGG T QK+ +  + + + D NDN P F     +  + E       +++L ATD D G N +I Y F  +       L  F++N  +G I +++ LD E+    K  V+A +   TP        + A+V I+V +V D P  I++ Y+    N    + E++  N  +A++TV+ K+ D+   + C +E  +    L +  D  Y      + T+  +D E   + S  I+     DS  PS   +A + + ++D+NDN P    F  P    S+ EN + G  +  I A D+D G+N  + + +     P+  +  +    GV+    + D E            VTA D+G  P  +   + +T+ D NDN PKFT +H  F + EN  K S VG I V D D  ++  + L     + N  + P+  + K+N         S DRE+   + F V ATD  G P  S T  V + V+D NDN P++I P  N +   V     P +     V A D D T     ++Y + S ++  +F ID   G I    + A +D+G H + + + + GY
Sbjct:  163 IPSATDPDTGFNGVQHYELLNGQ-----SVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGG-TPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRL--FALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--------ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIER-EVPFHLKAVYDNQYL-----LETSSLLDYEGTKEFSFKIVAS---DSGKPSLNQTALVRVKLEDENDNPPI---FNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLG----PNASFFDLDRKTGVLTASRVFDREEQ----ERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSN--------VSFDREQQSSYTFDVKATDG-GQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSV-VAEVFAVDVD-TGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGY 760          

HSP 2 Score: 103.99 bits (258), Expect = 1.017e-21
Identity = 106/389 (27.25%), Postives = 175/389 (44.99%), Query Frame = 1
Query: 1438 QEIDREKIPKISTNILCKESVDSHVP--SSSAKIEIIIKDQNDNAPTLTYFGTP-SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYL-SIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTI------MENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFP------SQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPR 2556
            Q +DRE+     T ++  +  D   P  SS+A +++ + D NDN P          I EN   GT V ++ A D D G N  + +       P+ + L ++  T G+I V+  +D E +        + V A+D    P    + I++T  DVNDN P     ++I  I       E +  N+ +  I V DKD   D+N  +       +PF +    +  + L T+  LD E   +F+F+++A+DS G P+ + T  V V++ D+NDN PI   P      S+NN           R     T+SA D+D     + + Y L   +  FD+DR+ G +   R   + +    +  +T  + G   ++S  Q  V++       NSP+
Sbjct:  208 QNLDREQK---DTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIH----KVTVLASDGSSTPARATVTINVT--DVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDT--DVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDS-GKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNR----------RGLYLTTISATDEDSGKNADIV-YQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQS--QAAVIVTVLDENDNSPK 571          

HSP 3 Score: 88.9669 bits (219), Expect = 3.457e-17
Identity = 127/500 (25.40%), Postives = 212/500 (42.40%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFS-----SPIYKEFV---KEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLT-----YFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTS--SHMIFTIME-NNMKNSFVGEIEVEDKD 1989
            P+F E  +E+ I E+  +G ++    ATD D G+N    Y    Q        F LN  NT   +TV+    + LDRE T  +   ++A DG  T  +     + I + D NDN P        SPI        K+ +N+ +I  ++ +D D  +NGK+I      F    +     ++ ++   +     LDYE    F F ++A +   P        TA V + + +  D P   N   +     S+ E N+   ++  ++ T +++     I  +L        L          K+  +  ++  DRE+  +    +  +++    + S +A I + + D+NDN+P  T     +F    + EN    + V  I   D D GEN  VT S+        +   +    GVIK     D E    Q ++ T  V ATD G  P+S+  +++I + DVNDN P   S  S+  F ++  + +  S V E+   D D
Sbjct:  250 PVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALN--NTTGLITVQ----RSLDREETAIHKVTVLASDGSSTPARA---TVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNT-KIALITVSDKDTDVNGKVIC-----FIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPS----LNQTALVRVKLEDENDNPPIFNQPVI---ELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDL--------DRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVI-VTVLDENDNSPKFTHNHFQFF----VSENLPKYSTVGVITVTDADAGENKAVTLSILNDN----DNFVLDPYSGVIKSNVSFDRE----QQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVD 706          

HSP 4 Score: 75.0998 bits (183), Expect = 6.199e-13
Identity = 87/285 (30.53%), Postives = 127/285 (44.56%), Query Frame = 1
Query: 1528 KIEIIIKDQNDNAPTLTYFGTP----SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGET-DGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDV--HDDINLVLRSKNPAMLPFVILKKANRIFHLNTT-------RSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFP-----IIIFPSQNNATVHVISYLEPRNYKFMTVSANDQD 2325
            KI+II+KD NDNAP    F +P    SI ENT   +      A D D G NG   + +      S+  L I ET +G    + I+       Q  T  + +   D G   KS+   + +T+ DVNDN P F    +   I EN    + V ++   D D+  + +I  +  ++        +     R+F LN T       RSLDRE+       V+A+D    P  +   TV + V D NDN P      II P   N TV+ +S  +P N K   ++ +D+D
Sbjct:  127 KIKIIVKDTNDNAP---MFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQ--SVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQ--------VAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARA---TVTINVTDVNDNPPNIDLRYIISPI--NGTVY-LSEKDPVNTKIALITVSDKD 392          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 179.874 bits (455), Expect = 3.766e-45
Identity = 184/645 (28.53%), Postives = 298/645 (46.20%), Query Frame = 1
Query:  607 LPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTV-ELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVN--PTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLN---NKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPS--SSAKIEIIIKDQNDNAPTLTYFGTP----SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLR----SKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESD--VFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGY 2484
            +P ATD D G N V+ Y++   +     + F L+++ T       +L V + LDRE  + Y   +   DGG T QK+ +  + + + D NDN P F     +  + E       +++L ATD D G N +I Y F  +       L  F++N  +G I +++ LD E+    K  V+A +   TP        + A+V I+V +V D P  I++ Y+    N    + E++  N  +A++TV+ K+ D+   + C +E  +    L +  D  Y      + T+  +D E   + S  I+     DS  PS   +A + + ++D+NDN P    F  P    S+ EN + G  +  I A D+D G+N  + + +     P+  +  +    GV+    + D E            VTA D+G  P  +   + +T+ D NDN PKFT +H  F + EN  K S VG I V D D  ++  + L     + N  + P+  + K+N  F        DRE+   + F V ATD  G P  S T  V + V+D NDN P++I P  N +   V     P +     V A D D T     ++Y + S ++  +F ID   G I    + A +D+G H + + + + GY
Sbjct:  163 IPSATDPDTGFNGVQHYELLNGQ-----SVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGG-TPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRL--FALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--------ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIER-EVPFHLKAVYDNQYL-----LETSSLLDYEGTKEFSFKIVAS---DSGKPSLNQTALVRVKLEDENDNPPI---FNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLG----PNASFFDLDRKTGVLTASRVFDREEQ----ERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVSF--------DREQQSSYTFDVKATDG-GQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSV-VAEVFAVDVD-TGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGY 760          

HSP 2 Score: 103.99 bits (258), Expect = 1.005e-21
Identity = 106/389 (27.25%), Postives = 175/389 (44.99%), Query Frame = 1
Query: 1438 QEIDREKIPKISTNILCKESVDSHVP--SSSAKIEIIIKDQNDNAPTLTYFGTP-SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYL-SIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTI------MENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFP------SQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPR 2556
            Q +DRE+     T ++  +  D   P  SS+A +++ + D NDN P          I EN   GT V ++ A D D G N  + +       P+ + L ++  T G+I V+  +D E +        + V A+D    P    + I++T  DVNDN P     ++I  I       E +  N+ +  I V DKD   D+N  +       +PF +    +  + L T+  LD E   +F+F+++A+DS G P+ + T  V V++ D+NDN PI   P      S+NN           R     T+SA D+D     + + Y L   +  FD+DR+ G +   R   + +    +  +T  + G   ++S  Q  V++       NSP+
Sbjct:  208 QNLDREQK---DTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIH----KVTVLASDGSSTPARATVTINVT--DVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDT--DVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDS-GKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNR----------RGLYLTTISATDEDSGKNADIV-YQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQS--QAAVIVTVLDENDNSPK 571          

HSP 3 Score: 89.3521 bits (220), Expect = 2.794e-17
Identity = 127/500 (25.40%), Postives = 212/500 (42.40%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFS-----SPIYKEFV---KEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLT-----YFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTS--SHMIFTIME-NNMKNSFVGEIEVEDKD 1989
            P+F E  +E+ I E+  +G ++    ATD D G+N    Y    Q        F LN  NT   +TV+    + LDRE T  +   ++A DG  T  +     + I + D NDN P        SPI        K+ +N+ +I  ++ +D D  +NGK+I      F    +     ++ ++   +     LDYE    F F ++A +   P        TA V + + +  D P   N   +     S+ E N+   ++  ++ T +++     I  +L        L          K+  +  ++  DRE+  +    +  +++    + S +A I + + D+NDN+P  T     +F    + EN    + V  I   D D GEN  VT S+        +   +    GVIK     D E    Q ++ T  V ATD G  P+S+  +++I + DVNDN P   S  S+  F ++  + +  S V E+   D D
Sbjct:  250 PVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALN--NTTGLITVQ----RSLDREETAIHKVTVLASDGSSTPARA---TVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNT-KIALITVSDKDTDVNGKVIC-----FIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPS----LNQTALVRVKLEDENDNPPIFNQPVI---ELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDL--------DRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVI-VTVLDENDNSPKFTHNHFQFF----VSENLPKYSTVGVITVTDADAGENKAVTLSILNDN----DNFVLDPYSGVIKSNVSFDRE----QQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVD 706          

HSP 4 Score: 75.8702 bits (185), Expect = 4.446e-13
Identity = 87/285 (30.53%), Postives = 127/285 (44.56%), Query Frame = 1
Query: 1528 KIEIIIKDQNDNAPTLTYFGTP----SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGET-DGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDV--HDDINLVLRSKNPAMLPFVILKKANRIFHLNTT-------RSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFP-----IIIFPSQNNATVHVISYLEPRNYKFMTVSANDQD 2325
            KI+II+KD NDNAP    F +P    SI ENT   +      A D D G NG   + +      S+  L I ET +G    + I+       Q  T  + +   D G   KS+   + +T+ DVNDN P F    +   I EN    + V ++   D D+  + +I  +  ++        +     R+F LN T       RSLDRE+       V+A+D    P  +   TV + V D NDN P      II P   N TV+ +S  +P N K   ++ +D+D
Sbjct:  127 KIKIIVKDTNDNAP---MFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQ--SVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQ--------VAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARA---TVTINVTDVNDNPPNIDLRYIISPI--NGTVY-LSEKDPVNTKIALITVSDKD 392          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 179.489 bits (454), Expect = 4.597e-45
Identity = 184/645 (28.53%), Postives = 298/645 (46.20%), Query Frame = 1
Query:  607 LPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTV-ELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVN--PTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLN---NKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPS--SSAKIEIIIKDQNDNAPTLTYFGTP----SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLR----SKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESD--VFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGY 2484
            +P ATD D G N V+ Y++   +     + F L+++ T       +L V + LDRE  + Y   +   DGG T QK+ +  + + + D NDN P F     +  + E       +++L ATD D G N +I Y F  +       L  F++N  +G I +++ LD E+    K  V+A +   TP        + A+V I+V +V D P  I++ Y+    N    + E++  N  +A++TV+ K+ D+   + C +E  +    L +  D  Y      + T+  +D E   + S  I+     DS  PS   +A + + ++D+NDN P    F  P    S+ EN + G  +  I A D+D G+N  + + +     P+  +  +    GV+    + D E            VTA D+G  P  +   + +T+ D NDN PKFT +H  F + EN  K S VG I V D D  ++  + L     + N  + P+  + K+N  F        DRE+   + F V ATD  G P  S T  V + V+D NDN P++I P  N +   V     P +     V A D D T     ++Y + S ++  +F ID   G I    + A +D+G H + + + + GY
Sbjct:  163 IPSATDPDTGFNGVQHYELLNGQ-----SVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGG-TPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRL--FALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--------ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIER-EVPFHLKAVYDNQYL-----LETSSLLDYEGTKEFSFKIVAS---DSGKPSLNQTALVRVKLEDENDNPP---IFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLG----PNASFFDLDRKTGVLTASRVFDREEQ----ERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVSF--------DREQQSSYTFDVKATDG-GQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSV-VAEVFAVDVD-TGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGY 760          

HSP 2 Score: 103.99 bits (258), Expect = 1.098e-21
Identity = 106/389 (27.25%), Postives = 175/389 (44.99%), Query Frame = 1
Query: 1438 QEIDREKIPKISTNILCKESVDSHVP--SSSAKIEIIIKDQNDNAPTLTYFGTP-SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYL-SIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTI------MENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFP------SQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPR 2556
            Q +DRE+     T ++  +  D   P  SS+A +++ + D NDN P          I EN   GT V ++ A D D G N  + +       P+ + L ++  T G+I V+  +D E +        + V A+D    P    + I++T  DVNDN P     ++I  I       E +  N+ +  I V DKD   D+N  +       +PF +    +  + L T+  LD E   +F+F+++A+DS G P+ + T  V V++ D+NDN PI   P      S+NN           R     T+SA D+D     + + Y L   +  FD+DR+ G +   R   + +    +  +T  + G   ++S  Q  V++       NSP+
Sbjct:  208 QNLDREQK---DTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIH----KVTVLASDGSSTPARATVTINVT--DVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDT--DVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDS-GKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNR----------RGLYLTTISATDEDSGKNADIV-YQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQS--QAAVIVTVLDENDNSPK 571          

HSP 3 Score: 89.3521 bits (220), Expect = 3.116e-17
Identity = 127/500 (25.40%), Postives = 212/500 (42.40%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFS-----SPIYKEFV---KEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLT-----YFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTS--SHMIFTIME-NNMKNSFVGEIEVEDKD 1989
            P+F E  +E+ I E+  +G ++    ATD D G+N    Y    Q        F LN  NT   +TV+    + LDRE T  +   ++A DG  T  +     + I + D NDN P        SPI        K+ +N+ +I  ++ +D D  +NGK+I      F    +     ++ ++   +     LDYE    F F ++A +   P        TA V + + +  D P   N   +     S+ E N+   ++  ++ T +++     I  +L        L          K+  +  ++  DRE+  +    +  +++    + S +A I + + D+NDN+P  T     +F    + EN    + V  I   D D GEN  VT S+        +   +    GVIK     D E    Q ++ T  V ATD G  P+S+  +++I + DVNDN P   S  S+  F ++  + +  S V E+   D D
Sbjct:  250 PVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALN--NTTGLITVQ----RSLDREETAIHKVTVLASDGSSTPARA---TVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNT-KIALITVSDKDTDVNGKVIC-----FIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPS----LNQTALVRVKLEDENDNPPIFNQPVI---ELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDL--------DRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVI-VTVLDENDNSPKFTHNHFQFF----VSENLPKYSTVGVITVTDADAGENKAVTLSILNDN----DNFVLDPYSGVIKSNVSFDRE----QQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVD 706          

HSP 4 Score: 75.8702 bits (185), Expect = 4.387e-13
Identity = 87/285 (30.53%), Postives = 127/285 (44.56%), Query Frame = 1
Query: 1528 KIEIIIKDQNDNAPTLTYFGTP----SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGET-DGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDV--HDDINLVLRSKNPAMLPFVILKKANRIFHLNTT-------RSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFP-----IIIFPSQNNATVHVISYLEPRNYKFMTVSANDQD 2325
            KI+II+KD NDNAP    F +P    SI ENT   +      A D D G NG   + +      S+  L I ET +G    + I+       Q  T  + +   D G   KS+   + +T+ DVNDN P F    +   I EN    + V ++   D D+  + +I  +  ++        +     R+F LN T       RSLDRE+       V+A+D    P  +   TV + V D NDN P      II P   N TV+ +S  +P N K   ++ +D+D
Sbjct:  127 KIKIIVKDTNDNAP---MFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQ--SVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQ--------VAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARA---TVTINVTDVNDNPPNIDLRYIISPI--NGTVY-LSEKDPVNTKIALITVSDKD 392          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 179.489 bits (454), Expect = 4.941e-45
Identity = 184/645 (28.53%), Postives = 298/645 (46.20%), Query Frame = 1
Query:  607 LPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTV-ELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVN--PTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLN---NKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPS--SSAKIEIIIKDQNDNAPTLTYFGTP----SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLR----SKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESD--VFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGY 2484
            +P ATD D G N V+ Y++   +     + F L+++ T       +L V + LDRE  + Y   +   DGG T QK+ +  + + + D NDN P F     +  + E       +++L ATD D G N +I Y F  +       L  F++N  +G I +++ LD E+    K  V+A +   TP        + A+V I+V +V D P  I++ Y+    N    + E++  N  +A++TV+ K+ D+   + C +E  +    L +  D  Y      + T+  +D E   + S  I+     DS  PS   +A + + ++D+NDN P    F  P    S+ EN + G  +  I A D+D G+N  + + +     P+  +  +    GV+    + D E            VTA D+G  P  +   + +T+ D NDN PKFT +H  F + EN  K S VG I V D D  ++  + L     + N  + P+  + K+N  F        DRE+   + F V ATD  G P  S T  V + V+D NDN P++I P  N +   V     P +     V A D D T     ++Y + S ++  +F ID   G I    + A +D+G H + + + + GY
Sbjct:  163 IPSATDPDTGFNGVQHYELLNGQ-----SVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGG-TPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRL--FALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--------ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIER-EVPFHLKAVYDNQYL-----LETSSLLDYEGTKEFSFKIVAS---DSGKPSLNQTALVRVKLEDENDNPP---IFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLG----PNASFFDLDRKTGVLTASRVFDREEQ----ERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVSF--------DREQQSSYTFDVKATDG-GQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSV-VAEVFAVDVD-TGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGY 760          

HSP 2 Score: 103.605 bits (257), Expect = 1.227e-21
Identity = 106/389 (27.25%), Postives = 175/389 (44.99%), Query Frame = 1
Query: 1438 QEIDREKIPKISTNILCKESVDSHVP--SSSAKIEIIIKDQNDNAPTLTYFGTP-SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYL-SIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTI------MENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFP------SQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPR 2556
            Q +DRE+     T ++  +  D   P  SS+A +++ + D NDN P          I EN   GT V ++ A D D G N  + +       P+ + L ++  T G+I V+  +D E +        + V A+D    P    + I++T  DVNDN P     ++I  I       E +  N+ +  I V DKD   D+N  +       +PF +    +  + L T+  LD E   +F+F+++A+DS G P+ + T  V V++ D+NDN PI   P      S+NN           R     T+SA D+D     + + Y L   +  FD+DR+ G +   R   + +    +  +T  + G   ++S  Q  V++       NSP+
Sbjct:  208 QNLDREQK---DTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIH----KVTVLASDGSSTPARATVTINVT--DVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDT--DVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDS-GKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNR----------RGLYLTTISATDEDSGKNADIV-YQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQS--QAAVIVTVLDENDNSPK 571          

HSP 3 Score: 89.3521 bits (220), Expect = 3.322e-17
Identity = 127/500 (25.40%), Postives = 212/500 (42.40%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFS-----SPIYKEFV---KEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLT-----YFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTS--SHMIFTIME-NNMKNSFVGEIEVEDKD 1989
            P+F E  +E+ I E+  +G ++    ATD D G+N    Y    Q        F LN  NT   +TV+    + LDRE T  +   ++A DG  T  +     + I + D NDN P        SPI        K+ +N+ +I  ++ +D D  +NGK+I      F    +     ++ ++   +     LDYE    F F ++A +   P        TA V + + +  D P   N   +     S+ E N+   ++  ++ T +++     I  +L        L          K+  +  ++  DRE+  +    +  +++    + S +A I + + D+NDN+P  T     +F    + EN    + V  I   D D GEN  VT S+        +   +    GVIK     D E    Q ++ T  V ATD G  P+S+  +++I + DVNDN P   S  S+  F ++  + +  S V E+   D D
Sbjct:  250 PVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALN--NTTGLITVQ----RSLDREETAIHKVTVLASDGSSTPARA---TVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNT-KIALITVSDKDTDVNGKVIC-----FIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPS----LNQTALVRVKLEDENDNPPIFNQPVI---ELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDL--------DRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVI-VTVLDENDNSPKFTHNHFQFF----VSENLPKYSTVGVITVTDADAGENKAVTLSILNDN----DNFVLDPYSGVIKSNVSFDRE----QQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVD 706          

HSP 4 Score: 75.485 bits (184), Expect = 4.975e-13
Identity = 87/285 (30.53%), Postives = 127/285 (44.56%), Query Frame = 1
Query: 1528 KIEIIIKDQNDNAPTLTYFGTP----SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGET-DGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDV--HDDINLVLRSKNPAMLPFVILKKANRIFHLNTT-------RSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFP-----IIIFPSQNNATVHVISYLEPRNYKFMTVSANDQD 2325
            KI+II+KD NDNAP    F +P    SI ENT   +      A D D G NG   + +      S+  L I ET +G    + I+       Q  T  + +   D G   KS+   + +T+ DVNDN P F    +   I EN    + V ++   D D+  + +I  +  ++        +     R+F LN T       RSLDRE+       V+A+D    P  +   TV + V D NDN P      II P   N TV+ +S  +P N K   ++ +D+D
Sbjct:  127 KIKIIVKDTNDNAP---MFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQ--SVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQ--------VAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARA---TVTINVTDVNDNPPNIDLRYIISPI--NGTVY-LSEKDPVNTKIALITVSDKD 392          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDHA12 (protocadherin alpha 12 [Source:HGNC Symbol;Acc:HGNC:8666])

HSP 1 Score: 177.178 bits (448), Expect = 5.445e-45
Identity = 176/670 (26.27%), Postives = 304/670 (45.37%), Query Frame = 1
Query:  268 DLKKLIPQTKMTYHLLKSSKAHSYFT---IKNDNLFTNTLVDMDSMCQNVGECCNKAKEICDFSIAIACRENQESEVXXXXXXXXXXXXXXXYPIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLN-SVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGL-NSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRL-EHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPS--SSAKIEIIIKDQNDNAPTLTYFGTPS----ILENTKPGTVVFKIIAQDKDEGENGRVTFSM-----EKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKF------TSSHMIFTIMENNM-KNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVID 2205
            +L +L+P+         +SK H       ++N  LF N+ +D + +C    EC    + I D  + +   + +  ++                P+F ER  ++ +SES  +     L  A+D D G N + TY +S  E      +F L +    + S+  EL + K LDRE T K +  LM IDGG+  + TGS+ I I ++D NDN P F  P YK  + E + N  R+++L+A+DPDEG+NG+I Y            +  FSIN D+GEI +   LD+E+   ++  V A++   P         + V + VL+V D   E+ V  L   +  + E+ +    +A+++V+ +++     + C L  H      L+S    +YK   + +  +  +DRE    +S   L   + D   PS  ++A++ + + D NDNAP    F  P     + EN  PG  +F + A D D  +N  V++S+      + A  S  Y+S+    G +     +D E    +   L   V+A D G+ P  +++ + + + D NDN P        ++   +  ++  ++     V ++   D D   +  L    +  A+   +          ++TTR LD    P+    V+  D  G P  + T TV V +++
Sbjct:   55 ELAELVPRL-----FRVASKRHGDLLEVNLQNGILFVNSRIDREKLCGRSAECSIHLEVIVDRPLQVFHVDVEVKDINDNP------------PVFREREQKVPVSESAPLDSHFPLEGASDADIGVNSLLTYALSLNE------NFELKIKTKKDKSILPELVLRKLLDREQTPKLNLLLMVIDGGKP-ELTGSVQIQITVLDVNDNGPAFDKPSYKVVLSENVQNDTRVIQLNASDPDEGLNGEISYGIKMILPVSEKCM--FSINPDTGEIRIYGELDFEENNAYEIQVNAIDKGIPS----MAGHSMVLVEVLDVNDNVPEVMVTSL---SLPVQEDAQVGTVIALISVSDRDSGANGQVICSLTPHVP--FKLVS----TYK-NYYSLVLDSALDRE---SVSAYELVVTARDGGSPSLWATARVSVEVADVNDNAPA---FAQPEYTVFVKENNPPGCHIFTVSAWDADAQKNALVSYSLVERRVGEHALSS--YVSVHAESGKVYALQPLDHE----ELELLQFQVSARDAGVPPLGSNVTLQVFVLDENDNAPALLATPAGSAGGAVSELVPRSVGAGHVVAKVRAVDADSGYNAWLSYELQPAAVGAHIPFHVGLYTGEISTTRILDEADAPRHRLLVLVKDH-GEPALTSTATVLVSLVE 671          

HSP 2 Score: 97.8265 bits (242), Expect = 5.066e-20
Identity = 148/619 (23.91%), Postives = 262/619 (42.33%), Query Frame = 1
Query:  820 TDQKTGSINIAIRIIDENDNMPQF-----------SSPIYKEFVKEGLNSVRILRLSATDPDEGINGKIIYK------FDPRFKTGALILDYFSINEDSG---EIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEH-FQEILSLISKGDESYKVKSFEIRTNQEIDREK--IPKISTNILCKESVDSHVPSSSAKIEIIIK--DQNDNAP--TLTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDI----NLVLRSKNP-AMLPFV-ILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQ--DQTSEFNT-IEYHLESESD----VFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKS--SVQVNVVIDASTAKSNS 2550
             D+     ++ + + D NDN P F           S+P+   F  EG          A+D D G+N  + Y       F+ + KT           +D     E+ L+K LD E+       ++ ++   P      T +  ++I+VL+V D     N    +  +Y +V          ++ + + + D    +   + +  + IL +  K   S    + EIR   E+D E+    +I  N     ++D  +PS +    ++++  D NDN P   +T    P + E+ + GTV+  I   D+D G NG+V  S+        + +S  +    + + S +D ES     +   +VVTA D G        ++S+ + DVNDN P F        + ENN     +  +   D D   +     +LV R     A+  +V +  ++ +++ L   + LD E+     FQV A D+ G P      T+ V V+D+NDN P ++     +A    +S L PR+     V A  +  D  S +N  + Y L+  +      F +    G I T R + ++D   H + + V + G  ++ S  +V V++V +    K++S
Sbjct:  110 VDRPLQVFHVDVEVKDINDNPPVFREREQKVPVSESAPLDSHFPLEG----------ASDADIGVNSLLTYALSLNENFELKIKT----------KKDKSILPELVLRKLLDREQTPKLNLLLMVIDGGKPE----LTGSVQIQITVLDVND-----NGPAFDKPSYKVVLSENVQNDTRVIQLNASDPD--EGLNGEISYGIKMILPVSEKCMFSINPDTGEIRIYGELDFEENNAYEIQVN-----AIDKGIPSMAGHSMVLVEVLDVNDNVPEVMVTSLSLP-VQEDAQVGTVIALISVSDRDSGANGQVICSLTPHV--PFKLVSTYKNYYSLVLDSALDRES----VSAYELVVTARDGGSPSLWATARVSVEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSAWDADAQKNALVSYSLVERRVGEHALSSYVSVHAESGKVYAL---QPLDHEELELLQFQVSARDA-GVPPLGSNVTLQVFVLDENDNAPALLATPAGSAG-GAVSELVPRSVGAGHVVAKVRAVDADSGYNAWLSYELQPAAVGAHIPFHVGLYTGEISTTRILDEADAPRHRLLVLVKDHGEPALTSTATVLVSLVENGQAPKTSS 680          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 126.331 bits (316), Expect = 6.531e-29
Identity = 178/698 (25.50%), Postives = 295/698 (42.26%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQE------ILSLISKGDESYKV--KSFEIRTNQEIDREKIPKISTNILCKESVDSHVPS--SSAKIEIIIKDQNDNAPTL---TYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDH-GIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESD-----VFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRIENFN 2571
            PIF + +   EI E   IG T+    A D D G N    Y +     +          L  +N+ +  ++   PLDRET +    D++A D G T ++  +  + I ++D NDN P F+S  Y   + E +     I  + ATD D G NGK+ Y        G L +DY      +GE+ L++ +D +       P+ AV           +ST             PL INV  +N+   +++   K         +T +EN        R+    E      I+    +G E + +   S  I+T + +DRE   + S  +  +   D   PS  +S  I +++KD NDNAPT     Y  T  I E    G+ +  + A D DE +  ++T+ +E++       L IG+   ++ V   +       Q   + + ++ATD  G++ +     +++ I DVN + P F        I E++     V  ++ ED D  D+  +V    +     F I   +  I   + +  LDRE    F+  V A+D    P N+ T  ++V + D NDN P   F S + A    IS   P    F+ VSA D D       ++Y L   S      +F +DR  GT+    ++ +      V+ I   + G  S+ ++ ++ + +  S    N+P  E  +
Sbjct:  268 PIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKN---------LLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKG-TPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDY-----STGEVTLRERIDAKNS-----PITAVIRAKDGAQPALSSTV------------PLTINVIDINDHAPTLIAAQK--------MITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTAR---DMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVT--ISEEMPRGSQIITLKAVDNDEDQ--KITYRIEEADREVFSILDIGDQGAILSVSGELK-----RQDHKVRVEISATDQGGLQGRCV---VNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQF--FRIDPSSGDI---SVSSDLDREDRATFSVIVTASDHASPPLNTST-QIEVILDDINDNSP--QFTSSSYAA--TISEDIPVGTSFLQVSAIDAD-IGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTL--SDVNDNAPTFEQLS 896          

HSP 2 Score: 119.398 bits (298), Expect = 1.010e-26
Identity = 178/700 (25.43%), Postives = 301/700 (43.00%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAI----DGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHF-QEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFG----TPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHD----DINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESD--VFDID---RQEGT--IFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRIENFNI 2574
            P+F   +  + I E++ I   I    ATD+DFG N     K+          H+ +   + +  +T++    +   RE  +  +  + A+    DG Q    + ++ + I +ID ND+ P   +      ++E +     + R+ A D D G NG I Y  +          + F I+EDSG I   K LD E    +   V A +   P   +L TST ++ + + ++ D     N    + K Y++    +      I+T+ + +ND  + I  R+E   +E+ S++  GD+        +  + E+ R+   K+   I    + D         + + I D N +AP   YF     +  I E++  G  V  + A+D D G+N R+ +S++ S F       I  + G I V S +D E       T +++VTA+DH   P +T  QI + + D+NDN P+FTSS    TI E+    +   ++   D D+      D  L   S +P++  F + + +     L  +  LDRE+       + A D  G P+ S    + + + D NDN P      Q +  ++ I+   P      T+ A D D+    + I + +   +D  +FDI+    Q G   I TR E    D      K   F    +S + S  V V I  S    N P +++F I
Sbjct:  373 PVFASDSYNVTILENITIPAVIATVKATDEDFGTNG----KV----------HYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQP-ALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGS--------EDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTP---SLNTST-TIAVVLKDIND-----NAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAI-----LSVSGELKRQD-HKVRVEI---SATDQGGLQGRCVVNVFIDDVN-SAP---YFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQF-----FRIDPSSGDISVSSDLDREDR----ATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGT---LRVSSKLDREQFAVIVLPIFARDR-GTPSLSAASEITLTLSDVNDNAPTF---EQLSYDLY-IAENSPVGSTVGTIVARDADEGDNAD-ISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEF---DYEAKANKF-FFELQASSGQLSSTVPVRIHVSDVNDNKPALKDFVI 1005          

HSP 3 Score: 102.449 bits (254), Expect = 1.628e-21
Identity = 97/372 (26.08%), Postives = 168/372 (45.16%), Query Frame = 1
Query: 1417 SFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTL---TYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVI 2523
            S EIR  + +DRE + K    +   E VD  + S+S  + + + D  DN+P     +YFG   I E+   GT V  + A+D D GENG + +S+ +    +L  L+I    GVI+  + +D E+     + + + V A+D G   + +   + IT+ DVNDN P F S     TI+EN    + +  ++  D+D   +  +     + + +  + +  +     +     +D +  P     VI       P  S T  + + VID ND+ P +I   +       ++  E    +   V A D+D       I+Y +E   D F ID   G I T + + +     + +K+T  + G  S+ +S  + VV+
Sbjct:  219 SGEIRLAKSMDREVLDKHILKVTAYERVDPTI-SASTTVVVHVLDVQDNSPIFEKDSYFG--EIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNL--LAINAKSGVIQTAAPLDRET----LSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTG--EVTLRERIDAKNSPI--TAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGE----EVGRVYAIDEDSGPN-GIIKYSMEGSED-FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVL 571          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 120.168 bits (300), Expect = 5.927e-27
Identity = 178/700 (25.43%), Postives = 301/700 (43.00%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAI----DGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHF-QEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFG----TPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHD----DINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESD--VFDID---RQEGT--IFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRIENFNI 2574
            P+F   +  + I E++ I   I    ATD+DFG N     K+          H+ +   + +  +T++    +   RE  +  +  + A+    DG Q    + ++ + I +ID ND+ P   +      ++E +     + R+ A D D G NG I Y  +          + F I+EDSG I   K LD E    +   V A +   P   +L TST ++ + + ++ D     N    + K Y++    +      I+T+ + +ND  + I  R+E   +E+ S++  GD+        +  + E+ R+   K+   I    + D         + + I D N +AP   YF     +  I E++  G  V  + A+D D G+N R+ +S++ S F       I  + G I V S +D E       T +++VTA+DH   P +T  QI + + D+NDN P+FTSS    TI E+    +   ++   D D+      D  L   S +P++  F + + +     L  +  LDRE+       + A D  G P+ S    + + + D NDN P      Q +  ++ I+   P      T+ A D D+    + I + +   +D  +FDI+    Q G   I TR E    D      K   F    +S + S  V V I  S    N P +++F I
Sbjct:   14 PVFASDSYNVTILENITIPAVIATVKATDEDFGTNG----KV----------HYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQP-ALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGS--------EDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTP---SLNTST-TIAVVLKDIND-----NAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAI-----LSVSGELKRQD-HKVRVEI---SATDQGGLQGRCVVNVFIDDVN-SAP---YFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQF-----FRIDPSSGDISVSSDLDREDR----ATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGT---LRVSSKLDREQFAVIVLPIFARDR-GTPSLSAASEITLTLSDVNDNAPTF---EQLSYDLY-IAENSPVGSTVGTIVARDADEGDNAD-ISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEF---DYEAKANKF-FFELQASSGQLSSTVPVRIHVSDVNDNKPALKDFVI 646          

HSP 2 Score: 104.76 bits (260), Expect = 2.731e-22
Identity = 149/595 (25.04%), Postives = 251/595 (42.18%), Query Frame = 1
Query:  847 IAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQE------ILSLISKGDESYKV--KSFEIRTNQEIDREKIPKISTNILCKESVDSHVPS--SSAKIEIIIKDQNDNAPTL---TYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDH-GIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESD-----VFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRIENFN 2571
            + I ++D NDN P F+S  Y   + E +     I  + ATD D G NGK+ Y        G L +DY      +GE+ L++ +D +       P+ AV           +ST             PL INV  +N+   +++   K         +T +EN        R+    E      I+    +G E + +   S  I+T + +DRE   + S  +  +   D   PS  +S  I +++KD NDNAPT     Y    +I E    G+ +  + A D DE +  ++T+ +E++       L IG+   ++ V   +       Q   + + ++ATD  G++ +     +++ I DVN + P F        I E++     V  ++ ED D  D+  +V    +     F I   +  I   + +  LDRE    F+  V A+D    P N+ T  ++V + D NDN P   F S + A    IS   P    F+ VSA D D       ++Y L   S      +F +DR  GT+    ++ +      V+ I   + G  S+ ++ ++ + +  S    N+P  E  +
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDY-----STGEVTLRERIDAKNS-----PITAVIRAKDGAQPALSSTV------------PLTINVIDINDHAPTLIAAQK--------MITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTAR---DMGTPSLNTSTTIAVVLKDINDNAPTFDKKEY--NVTISEEMPRGSQIITLKAVDNDEDQ--KITYRIEEADREVFSILDIGDQGAILSVSGELK-----RQDHKVRVEISATDQGGLQGRCV---VNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQF--FRIDPSSGDI---SVSSDLDREDRATFSVIVTASDHASPPLNTST-QIEVILDDINDNSP--QFTSSSYAA--TISEDIPVGTSFLQVSAIDAD-IGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTL--SDVNDNAPTFEQLS 537          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 112.849 bits (281), Expect = 8.879e-25
Identity = 179/686 (26.09%), Postives = 298/686 (43.44%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKS-NFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENN----------MKNSFVG-----EIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGT--VDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNV-VIDAST 2535
            P F ++ +++EISE  ++G +  LP  TD D     V  + I +      +N F+L        +  +L V   LDRE  +KY   + A DGG+   K G +  +I IID NDN P FS   Y   V   ++    ++ + ATD D G N +I Y      KT A     F+I++ SG I     L     T     V + + +P +     +S+A V I+VL        +++ +L   N + + EN +    VA V++  +    +R  + RL     I S      ++ +   + +     +DRE   +     L ++  D  +     ++ + I D NDNAP          L  T+ G+    + A+D D G+NG + +S+  +     E +SI +  G I V + IDC       + +   V A D G    STDLQ+   + D     P+F  +     I E+             NS  G        ++++D H  ++         M   V ++K           + D EK   +   VIAT++     NS T T  + + + D NDN+P I +P++ + TV      E      + VSA+D D +  F  + YH+ SES  F I+   G +F ++ +A+   G   + ++  + G  S ++S  +++ VID  T
Sbjct:  120 PSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQG---NVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKP-AKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIK---KTSAPSNSNFAISQ-SGVITTTASL-LPASTHDVIVVASDHGSPSL-----SSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQ----YRDTKLRL-----IGSSALCPQQTDQAHVYLLLLCGILDRETASEHHLKFLLEK--DGQIIIEHPQL-LTIGDINDNAPQWHSSQIHISLNRTQGGSRT--LTAKDPDLGQNGWIRYSVLDT-----ELVSIDKETGRIFVPNTIDCNIG----SEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVD--------TMSGTVCIQK-----------TFDFEKQKSYQTTVIATNA-----NSETSTSLISIRLKDVNDNWP-IFYPNEYHLTVREGPKPE---EPLLVVSASDMD-SGTFGEVSYHILSESSSFSINPVTGEVFAQKPLAR---GRFHLVVSAKDGGGQSSENSANIHITVIDKDT 736          

HSP 2 Score: 109.383 bits (272), Expect = 1.068e-23
Identity = 96/342 (28.07%), Postives = 165/342 (48.25%), Query Frame = 1
Query: 1516 SSSAKIEIIIKDQNDNAPTLTY-FGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTA 2538
            S+  ++ I I+D NDN P  +      SI E+ K     + + A DKD+ +NG V +S+  S+ P    + I +  G +   S++D E++        + V ATD GI P+S+++ + I + DVNDN P+F  S     ++EN+   + VG++   DKD  ++  +V R  N +   F I +K   ++   T RS+DRE     +  ++A D  G P  S T +  + V+D NDN P  +     + T  V+    P +    T+ A D D+     ++ Y  + +S +F + +  G ++ RR++  SD     + + V + G         V V I   +A
Sbjct:  818 SNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSI-ISSHPG-SSIEIDQFTGQLSTGSLLDYEAT----RNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEY-FGIDEKLGNVY---TKRSIDREVISHVDISIVAEDK-GVPPRSSTASARISVLDVNDNPPSCL-----SITPIVVPAGSPLSTAIGTIVAMDPDKGLN-GSVLYRAQLQSSLF-VVKSNGDVYLRRQLNASDERHQRLSVIVSDQGVPRKSVVCHVPVRISKGSA 1141          

HSP 3 Score: 68.9366 bits (167), Expect = 2.631e-11
Identity = 149/659 (22.61%), Postives = 273/659 (41.43%), Query Frame = 1
Query:  595 HTITLPVATDKDFGNNQVETYKISRQEPRTFDNHF-RLNVLNT-LNSVTVEL-KVFKP--LDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYK-EFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKV----KSFEIR-TNQEIDREKIPKISTNILCKESVDSHVPSS--SAKIEIIIKDQNDNAPTLTYFGTP-SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNS--FVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVI 2523
            H+  + ++ ++  G ++  T K    +P    N + R +VL+T L S+  E  ++F P  +D    ++  F + A DGG     T  + +   ++D     PQF   +++ E  ++      ++++ A +   G + +I Y    +        ++ +++  SG + ++K  D+EKQ  ++  VIA N          TST+ + I + +V D      + Y N  + ++ E  K    + +V+ +  ++  F                   G+ SY +     SF I     E+  +K        L   + D    SS  SA I I + D++   P  +         E+  PG  +  +       G   +V +S+           SI E  G I V   +D +      T L  +      G   +S   Q+ I I+D NDN P+F+SS +  +I E+   +   +V +   +DK  + ++   + S +P       ++       L+T   LD E    +  +V ATD LG P  S   T+ + V+D NDN P      ++  T+ V+    P+      V A D+D + E   I Y + + S+ F ID + G ++T+R + +  I    I I   + G     S+    + +
Sbjct:  442 HSSQIHISLNRTQGGSRTLTAK----DPDLGQNGWIRYSVLDTELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALST-DLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQD-------EHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANS------ETSTSLISIRLKDVND---NWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTF-------------------GEVSYHILSESSSFSINPVTGEVFAQKPLARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSV-------GAMSKVKYSIYSGD--QDHNFSIDEDTGKIYVTRYLDAD---VHDTVLLNIQATLPSG---ESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSS----IEIDQFTGQLSTGSLLDYEATRNYKLRVKATD-LGIPPRSSNMTLFIHVLDVNDNAPEF---EKSWYTMEVLENSPPKTI-VGKVVARDKD-SLENGQIVYRITNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISV 1035          

HSP 4 Score: 65.0846 bits (157), Expect = 3.814e-10
Identity = 99/405 (24.44%), Postives = 174/405 (42.96%), Query Frame = 1
Query:  718 TLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQF--SSPIYKEFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDE---PLEINVDYLNNKNYSIVEEN-KSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKG-DESYKVKSFE-IRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFT 1908
            ++NS T  + V  PLDRE + ++   ++  DGG    +  S  + + + D+NDN PQ   S+P   E  +       + R  A+D D G NGK  ++     +  +  LD      ++G++ L++    +    +K  +  V+   P    LY    ++EIS  N   E   PLE    +L     S ++E      F+A              +Q  L       S++    D ++ V S   IRTN E+DRE + + S  ++   S          ++++ + + NDN P+        + EN + G+ V  + A+D D     R  F +  S+  +  + +I +  G I + + +D E         T+ + ATD       T   ++I + D+NDN P F+
Sbjct: 1674 SINSTTGSISVL-PLDREASQEHLLIIILTDGGS---RNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFEL---LEDSSGSLDLVP---ETGDLVLRRLSSLQS---WKIKLRVVDHGVP---GLYVE-KNLEISNRNPQTEAKAPLE----FLKQTYLSTIDEGLPRGQFIA-------------KLQPELAGL--TYSIVEGNIDSAFSVDSEGVIRTNLELDREILERYSLKVIGTGSGQQ----IGTRVDVRVNNLNDNVPSFPMSKPRRVPENLRVGSYVATVGAKDVDNLAPLRY-FLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEV----LPEHTLTIKATDGSF---DTFTNLTIFVSDINDNAPTFS 2030          

HSP 5 Score: 62.7734 bits (151), Expect = 1.976e-9
Identity = 121/532 (22.74%), Postives = 230/532 (43.23%), Query Frame = 1
Query: 1042 YFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYS--IVEENKSNFF-----VAIVTVTSKEN---DLFRSIQCRLEHFQEILSLIS-KGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIE--IIIKDQNDNAPTLTYFG-TPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFT----IMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVE------VIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHV-IKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRIE 2562
            +  ++E SGEI     LDYEK++  KF ++AV         +  S  +++I V        E++ +  N  +++  +V+   S F       A+ TVT  +    D+ R +  +  +   +  L S K +E  +    ++  N ++DRE   K     L  E+ D   P+   ++   I I D NDNAP  +    T S+  N   G+ +  + A D D GEN R+++ ++K++ PS    +I ++        +I   +SL   +T  ++V A+DHG    S+   ++IT+     + P      ++ +    +MEN+   S V  + +  +     + L+  S   A+ P         ++ L     LDRE   + + + +             G + +E      + D NDN      P  +++ +H+   L        T++A D D   +   I Y +  ++++  ID++ G IF    +   +IG  +  ++   + G  ++ + +Q  VV D    +S  P+ E
Sbjct:   68 FLKVDERSGEISTIAHLDYEKRS--KFDIVAVK--------VEESGETIDILV--------EVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQ-GNVNNVFKLASRKVNEQLQA---DLVVNGQLDREFRDKYE---LLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQS-------GVITTTASLLPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGSS---ALCP--QQTDQAHVYLLLLCGILDRETASEHHLKFLLEKD---------GQIIIEHPQLLTIGDINDN-----APQWHSSQIHI--SLNRTQGGSRTLTAKDPD-LGQNGWIRYSV-LDTELVSIDKETGRIFVPNTI-DCNIGSEIKFRVRAEDGGSPALSTDLQ--VVADLLDTESKPPQFE 541          

HSP 6 Score: 61.6178 bits (148), Expect = 3.687e-9
Identity = 103/434 (23.73%), Postives = 182/434 (41.94%), Query Frame = 1
Query:  661 ISRQEPRTFDNHFRLNVLNTLNSVTVE----LKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGL-NSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTF-------------FKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFG-TPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKF 1905
            +S +E R F  H+R+         +++    L V  P+DRE    + F +   +   T QK       + ++DENDN+P F+S  Y   +K+ + +  +I ++ A+D D G NG++ Y    R  +G   L+  ++N D+G I L +  D +   F                P  A      V++ + + + S    VL VY+      V  L + +   V +       A   +  + + L  S++   EH         +G     VK+ E+     +D E  P IS  +      D +  S+   ++I+++  ++ AP  T    T  I  +T  G  V ++ A D+D G +G V +S+          + I E  G+I+++  +    +L   T   I V A     K   T + + I   DV  ++PK 
Sbjct: 2153 LSGEESREF--HYRIQDPEASKIFSIDKFGRLFVAGPIDREQRATHEFQVEIDNEMMTSQKV-QCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSY----RILSGN-DLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYE------VHVLEDTSVGTVLQK----IRASNRLGMRNDGLLYSLK---EH---------QGKLGIDVKTGELTLKTHLDWESEPIISMYLSVS---DGNGRSAVVPLKIVVEPVDEFAPVFTKSSYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSISDRQ----STVKIEEHTGIIRLQKPLVSRRNL---TIEQITVVAYSSPTKQSKTTVYLEIGPFDVQPSLPKL 2546          

HSP 7 Score: 59.3066 bits (142), Expect = 2.204e-8
Identity = 72/291 (24.74%), Postives = 121/291 (41.58%), Query Frame = 1
Query: 1531 IEIIIKDQNDNAPTLT--YFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVN-DNVPKFTSSHMIFTIMENNMKNSFVGEIEVED-KDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIII----FPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDV 2379
            + I + D NDNAPT +   + T        PG    KI A D D    G +T+S+ +    S     +    G + +K +              + VTATD+G+   ST + +S+ I +    + P F  +   F +MEN+     +G +  E+ ++ H       R ++P       + K  R+F       +DRE+     FQV   D+    +  V     V V+D+NDN P+      + S  ++  H          K   + A+DQD + E   + Y + S +D+
Sbjct: 2015 LTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDA--RGALTYSLGQG---SSSIFRVAPESGALFMKVLPPAGERY------LVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSGEESREFH------YRIQDPEASKIFSIDKFGRLF---VAGPIDREQRATHEFQV-EIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAH--------GQKIGQIMASDQD-SGENGRVSYRILSGNDL 2275          

HSP 8 Score: 56.225 bits (134), Expect = 1.625e-7
Identity = 95/409 (23.23%), Postives = 167/409 (40.83%), Query Frame = 1
Query:  721 LNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVR--ILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLK-KPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFR-SIQ-------CRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFGT-PSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKST--DLQISITIQDVNDNVPKF 1905
            ++  T  + +  PLD E   +++  + A DG   D  T   N+ I + D NDN P FS P+Y+  V     S      ++ A D D    G + Y        G      F +  +SG +++K  P   E+   +   V A +   P      + + SV +SV+    EP +          + ++E +K    + I  ++ +E+  F   IQ         ++ F  +        E      F++    EID E +   S  + CK               +I+ D+NDN P  T      S+ ++   G  + +I+A D+D GENGRV++ +       L  +++    G I++    D +       T  I+V A DHG   ++    +Q+S+ +   + + P F
Sbjct: 1977 IDQFTGTIHLTAPLDFEVLPEHTLTIKATDG-SFDTFT---NLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDA--RGALTYSL------GQGSSSIFRVAPESGALFMKVLPPAGER---YLVTVTATDNGVP------SFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSK--IGLQIGNLSGEESREFHYRIQDPEASKIFSIDKFGRLFVAGPIDREQRATHEFQV----EIDNEMM--TSQKVQCK-------------CHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGN--DLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFF 2341          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: cdh-4 (Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI5])

HSP 1 Score: 108.227 bits (269), Expect = 2.473e-23
Identity = 144/534 (26.97%), Postives = 242/534 (45.32%), Query Frame = 1
Query:  742 LKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEF-VKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKK-PLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVY---------DEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQE-----------ILSLISKGDESYKV--KSFEIRTNQEIDR---EKIPKISTNILCKESVDSHVP--SSSAKIEIIIKDQNDNAPT---LTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSM----EKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIF 2235
            L+V   ++R +   Y+F ++A   G  ++K    +++I I+D ND+ P FS+   ++  +  G     ++++ ATD DEG NGKI+YKF     T  L L+   IN ++GEI L + P   +K   +   V A++   P++           +S LN+           +P  I +    NK+  +        F  IV VT  E+    ++  +L+   E           I  +     E   V  +S EI    ++ +   EK+  +   +    ++D+  P  SS   +++ IKD N+++P    ++Y+    I EN KPG  +FK+ A D D G NG++ FS+    EKS+      +SI    G++K+   +D E         T  + A+D G   + +   ++I+++DVNDN PK    H    I E+    +FV  +   D+D+  +  L     N   +PF I   +  IF       LD  K P FN  +   D  G+P  S +  + VE++D   N   I F
Sbjct:  445 LRVSAKINR-SERVYNFKVIASLHG-INEKLAEKDVSIEILDSNDHAPVFSAKWMRQTPIVIGKPGDVLVKVDATDQDEGENGKIVYKF-----TSELPLE---INANTGEITLVEVP---KKGNSWPATVWAIDLGLPLS----------RMSALNLMFYKNGTKIPAKPKPIIIQESENKHSPVFSS-----FPEIVEVT--EDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVS-AIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYY--LRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSV-----ISIDAKTGIVKLLKSLDREDQDVH----TFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFL-LNSEKVPFRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADH-GDPILSTSCHLHVELVDIAHNHLAIEF 934          

HSP 2 Score: 82.4185 bits (202), Expect = 2.117e-15
Identity = 139/590 (23.56%), Postives = 261/590 (44.24%), Query Frame = 1
Query:  733 TVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQF-SSPIYKEFVKEGLNSVRILRLSATDPD-----EGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFP-VIAVNPTPPVTITLYTSTASVEISVL---NVYDEPLEINVDYLNNK-NYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKV----KSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAP--TLTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVL---RSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDI 2442
            T ++ +   LD E T KY   L+A   G+  Q +      + I D ND MP+F  S +  +     +    I  +SATD D     +  + K++YK     +T       F+I+  +GE+ L +P++ +         V+ V+    VT  ++T+ A + + +L   ++   P      Y+ N    +IV  NKS    A++TV  K       +Q  L       S  SK  E++ V    K+  I  ++ ++  +  +    ++ +++      S+   + + + D ND  P   L ++ T SI E+ K G  V  + A D DE  N  + +S+   +    ++ S+    G I V   ++ ++ +    TL++ + ATD    P      + + I   +  VP+F++SH +F++ME+    + +G ++  + ++ D+I   +     ++ + LPF + +   +I       SLDRE+  ++   + A D+ G   +++T TV V++ D NDN P        +     IS            SA D+D  S    I + L  E+  FD++   G +    ++ +  I
Sbjct: 2235 TGDVTITGQLDYEKTQKYDLKLVATSSGK--QVSSEAEFIVLIEDVNDEMPEFIRSDVSAKISDSAITGQFITIMSATDMDTTNSLDEESQKLLYKIVDGDET------LFNISPATGELSLARPVEQDDLVNEDTKKVLNVS----VTDGMFTAYAKLVVEILRSGSMQPPPRFEQSHYVANALENTIV--NKS----ALLTVAVKGG--VPPLQFSLAPTTSSNSSTSK--EAWPVAIDRKTGRIHVSRVLNYHRDKRYQIPLVVEDATGRRAFST---LTLSVIDINDKPPFFVLPFYST-SISESAKEGDTVMMVSATDDDE--NDTIEYSLLDGS--ESQFFSVHPRQGTITVAKKLEHKAGV----TLSLTIKATDSANPPHHATTTVEVNIASESVKVPRFSNSHYLFSVMEDADVGNVIGRVQQMETEI-DEIRFTIVPGSEESDSFLPFSVERSTGKII---VKSSLDRERKNQWKMTIRA-DAAGG-VHAIT-TVTVDIGDVNDNAPAF----HGDYERFTISEDAAVGTSVTIFSAMDRDD-SPSGRIRFSLVEENPYFDLNENSGWLTVASQLDREKI 2778          

HSP 3 Score: 77.411 bits (189), Expect = 7.066e-14
Identity = 66/243 (27.16%), Postives = 117/243 (48.15%), Query Frame = 1
Query: 1525 AKIEIIIKDQNDNAPTL---TYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKD------VHDDINLVLR-SKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFP 2223
            A I + + DQNDNAPT    TY  +  ++E+   G  +    A   D+ E   + + ++ S   S  ++++    G++ +   +D E+     + L + V A D G+ P  T+ Q+ I++ D NDN PKF     +  + EN+     V  ++  D D      V  ++ +V   + +  +LPF I    + +     ++S+D EK  K+N +VIA D  G P       +++ V D+ND+ P
Sbjct: 3097 ATILVTVIDQNDNAPTFEKSTY--SMKVMESESIGYELAHFRASGGDQNET--IEYYLKPSDVTS--FVNLNAQTGILTLAKPLDFET----LSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLI----SQSIDYEKIKKYNLKVIAKDG-GRPPLRSEALLEIHVEDENDHAP 3324          

HSP 4 Score: 72.4034 bits (176), Expect = 2.458e-12
Identity = 83/307 (27.04%), Postives = 137/307 (44.63%), Query Frame = 1
Query: 1504 SHVPSSSAKIEIIIKDQNDNAPTLTYFGTPSILENTKP---GTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKS-IIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIF 2412
            + +P+    I II + +N ++P  + F  P I+E T+    GTVV K+ A D+D G NG + + +   A  S E L++ E  G I V S +        +   + + V+A D G   KS+   + + I+DVN++ P+F        I EN      + ++   D D  ++  +     N      VI   A +   +   +SLDRE      F +IA+D  G P       + + V D NDN P  +     ++   +   L P       ++A D+D   + + +++ L SE   F ID   G IF
Sbjct:  586 TKIPAKPKPI-IIQESENKHSPVFSSF--PEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISIDA-KTGIVKLLKSLDREDQDVHTFAIIASDE-GFPMRVSVTNLTISVEDVNDNPPKCVV---QHSRARIPEDL-PHGAFVSCMAAFDED-IGQNSKLKFLLNSEKVPFRIDHHSGCIF 882          

HSP 5 Score: 71.2478 bits (173), Expect = 5.160e-12
Identity = 122/528 (23.11%), Postives = 214/528 (40.53%), Query Frame = 1
Query:  652 TYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVR-----ILRLSATDPD-EGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVP--SSSAKIEIIIKDQNDNAPTL---TYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSME-----KSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLN------TTRSLDREKDPKFNFQVIATDSLGNPTN 2169
            T+K+S       DN   + V+N  N + V++K    +D E   +  F  + I   Q + +     I + I + NDN P+    + K  + E L +       I R+ A D D + I  +++  F      G L    F I++ +G + + KPLD E   FF   V+A +         +   A++ ++V++  D     N        YS+      +    +    +   D   +I+  L+   ++ S ++        ++  +   + +D E +  +   ++ K   DS VP   + A++EI + D+NDNAP      Y G   + EN+K G  V  + A D D    G V++ +E      +  P L +     ++G + +   ID E    +     + V A D G  P  ++  + I ++D ND+ P F   +M   + E       + +  V D D           KN A     I     + F +N      T + L+  K  K+   VIA D  G  T+
Sbjct: 2943 TFKLS-------DNDGNVFVVNFRNGI-VKVKESDQIDYEKNQQLEFHRLTI---QDNSEVCKELITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDADFDEIKFRMVDDF------GGL----FQIDDINGVVTVVKPLDSEILGFFNLTVVASDGE-------FEDKATILVTVIDQND-----NAPTFEKSTYSMKVMESESIGYELAHFRASGGDQNETIEYYLKP-SDVTSFVN-----LNAQTGILTLAKPLDFETLSALKLTVVAK---DSGVPPLETEAQVEISVMDENDNAPKFEKEKYVG--KVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAI--NSNGDVLISQSIDYE----KIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQEGEAIGHRLLKFSVSDLD---------GPKNGAPFTVEIQGDGAKSFKVNEKLELLTAKKLEYRKKDKYLLTVIAKDVKGKTTD 3411          

HSP 6 Score: 71.2478 bits (173), Expect = 5.337e-12
Identity = 155/645 (24.03%), Postives = 255/645 (39.53%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPL-DRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVR-ILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTV-------TSKENDLFRS--IQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTY---FGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIG---------ETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTD-LQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDIN---LVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDID 2391
            P+F+     +E++E   IG  +    A D+D G N    Y I         +H  L V      +TV   + K + ++         + AID G T  K+    + +RI D N++ PQF    Y   + E     + I +++A D D G NGKI +      +  ++I    SI+  +G + L K LD E Q    F +IA +   P+ +++   T SVE    +V D P +  V +   +   I E+     FV+ +          SK   L  S  +  R++H    +              F       +D  K P  + +I   +  D  + S+S  + + + D   N   + +       S+ EN++ GT V  I A++         T   +K    +LEY  IG         +  G ++   ++D E+  A + T+    + TD    P+  D L + I I D ND+ P       I ++ EN+  N  + ++E  D D  D+     L+ + +      F  +   +     +  R LDREK  +    V   D  G P       V V V+D+NDN P           +H  S       K   + A D D+  E   + Y++      F ID
Sbjct:  606 PVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVI---HDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAG-TPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVI----SIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVE----DVNDNPPKCVVQHSRAR---IPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLNSEKVPFRIDHHSGCI--------------FIHAPEYPLDYHKTPFFNLSIEVADHGDP-ILSTSCHLHVELVDIAHNHLAIEFDDVAKEASVYENSEIGTEVIMIEAKE---------TGDEQKVKAENLEYRIIGGDGWPHFSIDQKGTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQSFFRIDLTSGYITTSGIRRLDREKQSEHELWVSICDG-GEPQLCSNVIVIVNVLDENDNSPTF------TQAIHHYSVRSKFAGKLCRIFAVDADE-GENARLTYNITEGDARFSID 1203          

HSP 7 Score: 70.0922 bits (170), Expect = 9.791e-12
Identity = 103/400 (25.75%), Postives = 166/400 (41.50%), Query Frame = 1
Query:  733 TVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIY----KEFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIA---VNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFR-SIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTY-FGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKF 1905
            T  + V + L+     +Y   L+  D   T ++  S  + + +ID ND  P F  P Y     E  KEG     ++ +SATD DE  N  I Y      ++      +FS++   G I + K L+++        + A    NP    T T+  + AS  + V      P   N  YL    +S++E+      +  V     E D  R +I    E     L        S +  + +I     +DRE+  +    I    +   H  ++   + + I D NDNAP     +   +I E+   GT V    A D+D+  +GR+ FS+ +       Y  + E  G + V S +D E    +     ++  ATD G    +TDL  +I + DVND+ P+F
Sbjct: 2456 TGRIHVSRVLNYHRDKRYQIPLVVEDA--TGRRAFS-TLTLSVIDINDKPPFFVLPFYSTSISESAKEGDT---VMMVSATDDDE--NDTIEYSLLDGSES-----QFFSVHPRQGTITVAKKLEHKAGVTLSLTIKATDSANPPHHATTTVEVNIASESVKV------PRFSNSHYL----FSVMEDADVGNVIGRVQQMETEIDEIRFTIVPGSEESDSFLPF------SVERSTGKIIVKSSLDRERKNQWKMTIRADAAGGVHAITT---VTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEEN----PYFDLNENSGWLTVASQLDRE----KIDHYKLIARATDEG--GFNTDLPFTIVVSDVNDSPPQF 2813          

HSP 8 Score: 52.7582 bits (125), Expect = 2.115e-6
Identity = 130/587 (22.15%), Postives = 239/587 (40.72%), Query Frame = 1
Query:  781 KYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIY-----KEFVKEGLNSVRIL-RLSATDPDEGING-KIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFGTPS-ILENTKPGTVVFKIIAQDKD-----EGENGRVTFSM---EKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKN-SFVGEIEVEDKDVHDDINLV-----LRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHL--ESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITV 2469
            +++F L+A D G   +    + I  R++D+    P FS  +Y     KE  K+    V+++ + S     +G+ G +I+ K  P           FS++  +GE+ L   L    +T + F V A   T P  I    + A VEI    +    +  +        Y+      ++    ++T+ +  +D   +I+  L   ++I      GD         +    ++D EK  K    ++   S      SS A+  ++I+D ND  P        + I ++   G  +  + A D D     + E+ ++ + +   +++ F      +I    G + +   ++ +  + + T   + V+ TD G+      L + I         P+F  SH +   +EN + N S +  + V+        +L        S +    P  I +K  RI   + +R L+  +D ++   ++  D+ G    S   T+ + VID ND  P  + P  + +    IS         M VSA D D   E +TIEY L   SES  F +  ++GTI   +++      EH   +T+
Sbjct: 2049 EFNFKLIAKDNGSVHRVEEPVKI--RVVDKA--RPVFSQNVYTAVISKESTKKSTVLVKVMAKSSLQSKSKGLIGYRILDKKSP-----------FSVDFLTGEVRLNN-LKMLAETNYTFEVEAREVTRPKMI----AKAQVEI----IVKSGITTHAPVFEKLKYTASTPESTSIGQRLLTIKATTSDENDTIEYSLSGSKDIEIHPETGD---------VTITGQLDYEKTQKYDLKLVATSS--GKQVSSEAEFIVLIEDVNDEMPEFIRSDVSAKISDSAITGQFITIMSATDMDTTNSLDEESQKLLYKIVDGDETLF------NISPATGELSLARPVEQDDLVNEDTKKVLNVSVTD-GMFTAYAKLVVEILRSGSMQPPPRFEQSHYVANALENTIVNKSALLTVAVKGGVPPLQFSLAPTTSSNSSTSKEAWPVAIDRKTGRI---HVSRVLNYHRDKRYQIPLVVEDATGRRAFS---TLTLSVIDINDKPPFFVLPFYSTS----ISESAKEGDTVMMVSATDDD---ENDTIEYSLLDGSESQFFSVHPRQGTITVAKKL------EHKAGVTL 2574          

HSP 9 Score: 51.9878 bits (123), Expect = 3.878e-6
Identity = 87/375 (23.20%), Postives = 155/375 (41.33%), Query Frame = 1
Query: 1531 IEIIIKDQNDNAPTLT---YFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSI-------------IDCESSLAQFTTLTIVV--TATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKD----------VHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQV-IATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHV-ISYLEPRNYKFMTVSANDQDQTSEFNTIEYHL---ESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPR 2556
            + I I D ND+AP  +      TP ++   KPG V+ K+ A D+DEGENG++ +      F S   L I    G I +  +             ID    L++ + L ++     T    KPK   +Q     +  N + P F+S   I  + E+    + V +++  D+D          +HD    +  S +  +    + +++  I   +    L +EK    + Q+ ++    G P  S   T+ + + D N++ P       +  + ++ IS  E        V+AND D  +    I++ L   + +S V  ID + G +   + + + D   H   I   + G+  M+ SV  N+ I       N P+
Sbjct:  478 VSIEILDSNDHAPVFSAKWMRQTPIVI--GKPGDVLVKVDATDQDEGENGKIVYK-----FTSELPLEINANTGEITLVEVPKKGNSWPATVWAIDLGLPLSRMSALNLMFYKNGTKIPAKPKPIIIQ-----ESENKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHD----IAGSSHEVL---TVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQF-----DEVSYYLRISENEKPGKDIFKVTANDFDGGNN-GKIKFSLGNNQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGF-PMRVSV-TNLTISVEDVNDNPPK 825          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 102.834 bits (255), Expect = 1.303e-21
Identity = 181/719 (25.17%), Postives = 297/719 (41.31%), Query Frame = 1
Query:  589 IGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQF-SSPIYKEFVKEG----LNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALI------LDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFV------AIVTVTSKENDLFRSIQCRLE-HFQEILSLISKGDESYKVKSF--EIRTNQEIDREKIPKISTNILCKESVDSHVPSSSA------KIEIIIKDQNDNAPTL---TYFGTPSILENTKPGTVVFKIIAQDKDEGEN----------GRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMK-NSFVGEIEVEDKDVHDDIN-LVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKD---PKFNFQVIATDSLGNPTNSVTGTVDVE--VIDQNDNFPIIIFPSQNNATVHVISYLEPR-------NYKFMTVSAND-QDQTSEFNTIEY-----HLESESDVFDIDRQEGTIFTRREMAK--SDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRIE 2562
            +G ++    A D D  +N   TY +        ++   L+    +N  + E+ + KP+  + T K+ F+++A D G  +    S  + + ++D+    P++ +SP  K  +       LN V ILR  A    +  N  +IYK       G          + F    +  E+ + + LDYE+   +   + A + T  V      ST +  + V +V D   +  VD       +I EE   N  +       IVTV + + D   S   + E H++ +     +  + +++     EI  N++ DREKI      +   +   S +P ++       K++I+I D NDNAP+     Y G   + E+   G  V  I A D D+  N          GR+ F +   +             G I VK  +D E+S        +V+ A+D G    +T+  + I I+DVNDN P+F       T++E ++     +  +   D D  +  + +V R +         + K +    L   ++LDR+     P +NF V A D  G   N + G  DV+  V D NDN P  IFP +      +  Y+E            FM V A D  D T+E   IEY      L +   VF ID+  G IF  R + +  S   E +I++   + G  S +     NV I  +    N+P  E
Sbjct:  994 VGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMK-TQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKV-ILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRV-----ASTKTFVVEVRDVNDVVPQFTVDLFTG---TIDEEMTPNEHLEKTNGKPIVTVKAIDTD---SDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIG--RVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDS-------------GTIFVKEPLDFEAS----DQYHLVLIASD-GRHNATTN--VYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIEL--VKALDRDPPAGVPSWNFVVQAIDDDG---NGLVGYADVQVNVRDINDNSP--IFPER------LFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGF--ANVTIKVTDMNDNAPFFE 1662          

HSP 2 Score: 93.9745 bits (232), Expect = 6.014e-19
Identity = 145/594 (24.41%), Postives = 235/594 (39.56%), Query Frame = 1
Query:  760 LDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVK--EGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALI---LDYFS-INEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLN------------------VYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTY-FGTPSILENTKP--------GTVVFKIIAQDKD-EGENGRVTFSMEKSA-FPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIK-------PKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESES--DVFDIDRQEGTI 2409
             DRET  +    + A D G      G    ++ ++D NDN PQF  P Y+  V   E + +  ++ + A D D   N +I Y  +     G      LD+F  +N  SGEI L KP+  + Q F  F VIA +   P  +    S+A V ++VL+                    DE +E+N   L  +  S  +   S+    +       N      + +   F +       G+E  +V   E    ++++   +   +T++  + +       S+    + ++D ND  P  T    T +I E   P        G  +  + A D D +G    V + +   A     ++  I E  G I      D E    +     + V A+D  +        P   ++++ I I DVNDN P F     I  + E+  +   V  I+  D D H ++   L       +PF +   +  IF       LD E   +++  +IA+D   N T +V     + + D NDN P   F  Q  AT  +   ++     F  V A D DQ  + + I Y LE +   +VF I +  GTI
Sbjct:  937 FDRETRPREDVTVKATDRGDR-PLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGT-SVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFI-FNVIADDNGIPEALQ---SSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGN----KAESKFRQFNKF----ENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVA-------STKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDRE----KIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIF---VKEPLDFEASDQYHLVLIASDGRHNATTNVY----IHIEDVNDNAP--QFEQQKYATTVIEEDVDIPKVLF-NVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTI 1495          

HSP 3 Score: 84.7297 bits (208), Expect = 3.474e-16
Identity = 103/386 (26.68%), Postives = 170/386 (44.04%), Query Frame = 1
Query:  814 GQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEG--LNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDY----EKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKEND---LFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPS----SSAKIEIIIKDQNDNAPTL----TYFGTPSILEN---TKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKS--IIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKF 1905
             + D +   +++ IRI D NDN+P F+ P+Y   V+E   LN   IL+++A D D G N +I Y  D            FSIN + GEI  K  LD     E+   ++F V A +   PV++   +S+A + I   N  DE    +  +L    Y+      +     ++ + +++ D   +  S   +     + ++L S  + +  VK     +  ++   + P   T I+  +      PS    S A + I I+D N+N P       Y     I+E    T P T+V K+ A D D   NG + +S+  +   S +   I    GV+      + D E+   +     + V ATD G +P     Q S+ + D+NDN P+F
Sbjct:  617 AREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQT-ILKVTAVDKDTGDNSRITYSVDNH---------NFSINSN-GEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSL---SSSAMIHIRTENTNDE----SAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIV-KVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPRE----DVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQF 979          

HSP 4 Score: 53.5286 bits (127), Expect = 1.343e-6
Identity = 106/476 (22.27%), Postives = 197/476 (41.39%), Query Frame = 1
Query:  616 ATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRE---TTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPI--YKEFVKEGLNS--VRILRLSATDPDEGI--NGKIIYKF-DPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTS-------KENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSF-VGEIEVEDKD 1989
            ATD D   ++  +  + R E +  D  FR+       S T+EL   K LDR+       ++F + AID    +   G  ++ + + D NDN P F   +  Y E  +E ++S  V  + + A D D+    N  I Y     +   G  +   F I++++G+I+  + LD E  +  +F +I V       +      A+V I V ++ D     N  +     Y    E  +    A+++ ++       K+N     +    ++F      ++   +S +     +R  Q +D E + +     L     D     + A + + + D+ND+AP +       + E+   GT + +  A D+D G+  R  F + + + P  ++    + DG ++V   +D E          +++ A D+          +++ +QDVNDN P+  +        EN   N     EI   D+D
Sbjct: 1461 ATDAD--QDEKSSRIVYRLEGQGADEVFRIGKY----SGTIEL--VKALDRDPPAGVPSWNFVVQAIDD-DGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESV---FRIDQNTGKIFAMRSLDREISSEREF-IIEVRAND-RGVPSREGFANVTIKVTDMND-----NAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYF-----YVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGR-HDAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGRYTATDRDAGDTAR--FRINRQSDPKRQFTI--DQDGTLRVAHTLDRED----IAVYNLIIEAYDNSNNIGRQ--MVAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQLGTCEIRATDRD 1901          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 165.236 bits (417), Expect = 1.384e-40
Identity = 179/675 (26.52%), Postives = 302/675 (44.74%), Query Frame = 1
Query:  604 TLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVT-VELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVN-PTPPVTITLYTSTASVEISVLNVYDEPLEINVDYL-NNKNYSIVEENKSNFFVAIVTVTSKENDL-FRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPS--SSAKIEIIIKDQNDNAPTLTY-FGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESS-LAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKD--VHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVI--SYLEPRNYKFMTVSANDQDQTSEFNTIEYHLES--ESDVFDIDRQEGTIFTRRE--MAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRIENFNIN 2577
            TL  A D D      + Y I        ++ FRL+     + V  ++L++   LDRETT  YS  + A+DGG T    G + + I I D NDN P F+   Y   V E       +L++ A+D D   NG + Y  + R      +   F I+  +G IY+ K LD+E +   +  V+A +    P+      +TA V I V +V D    INV +L ++ +  I E  +   FVA ++V   ++   + ++   L       +L ++ +  Y V       +  +DRE +   + +++   + D   P   +S  I + I D NDN P         +++E   PGT V +++A D+DEG N  +T+S+ ++     ++  I    G+I  +S IDCE+  + Q T     V A D G+ P S+   + +TI DVNDN P F  S    ++ EN      + ++   D D  V+  +N  +      +  F +   +  I        LD E+   + F V+ATD  G    S T  + +++ D NDN P + +P +   ++     +  +  +   + V A D D    F  + Y + +  E+ +F IDR  G IF  R   ++      H++ I+  + G  +++S+    V +    A    P  E    N
Sbjct:  194 TLLPARDLDLEPYNTQRYNIVSG---NVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGG-TPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQM---FRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLE-----TTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVI-----VHLPLDREIVSNYTLSVV---ATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLT-----VVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEIC---IAGELDFERRSSYEFPVLATDRGG---LSTTAMIKMQLTDVNDNRP-VFYPREYKVSLRESPKASSQASSTPIVAVVATDPDY-GNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGG--NLRSNADAVVFLSIIDAMQRPPIFEKARYN 833          

HSP 2 Score: 142.51 bits (358), Expect = 1.172e-33
Identity = 158/565 (27.96%), Postives = 259/565 (45.84%), Query Frame = 1
Query:  616 ATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKF-DPRFK------TGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKI--EIIIKDQNDNAPTLT--YFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYL-SIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEI------------EVED--KDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLG--NPTNSVTGTVDVEVIDQNDNFP 2223
            A DKD G++   TY + ++  +          L  +++ +  L + + LD E++ +++  + A DGG     T ++ I + + D NDN P F    Y   V E  + + +I++++A+D D G N +I Y+  D          + + +  +F I  +SG IYL+ PLD E +  ++  V+A +   P       +   V + VL+  D     +  +  +K    +EEN     V  V VT+ + DL  +   R       L  I+   + + V   EI T + +DRE         L  E+ D   P  SA++   I + D NDNAP +        S+ E   PGT V ++ A D+D G+N  +T+S+ K        L SI  T GVI+ + ++D E      +   + V A+D G  P+ T   + + + D+NDN P FTSS ++F + E+      VG I             VE+  +D+     L   +K+     F I + +    +L   R LDRE   +F  ++ A D+    NP +S   TV +EV D NDN P
Sbjct:  955 AHDKDSGSSGQVTYSLVKESGKG---------LFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLST-NLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAA----HAKTRVIVRVLDANDN----DPKFQKSKYEFRIEENLRRGSVVGV-VTASDLDLGENAAIRYS-----LLPINSSFQVHPVTG-EISTREPLDRELRELYD---LVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEER----SIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSG---NLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAI-TVKIEVADVNDNAP 1483          

HSP 3 Score: 130.183 bits (326), Expect = 6.280e-30
Identity = 178/709 (25.11%), Postives = 294/709 (41.47%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEG------LNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKP--LDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFV--------AIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNI---LCKESVDSHVPSSSAKIEIIIKDQNDNAPTL-TYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLR-------------SKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRIEN 2565
            PIF++    + ++E+  +G  I    A+D D G N +  Y I           F+      + S + E+ +   LD E  + Y F ++A D G     + +  I +++ D NDN P F    YK  ++E        +S  I+ + ATDPD G  G++ Y+     + G      F I+  +GEI++ +P  L    Q      + A +     +     + A V +S+++    P              I E+ + N++V         + +V +   D+      R      I S    G  S +  S  IR  + +D E   ++  NI   L +  V  H      ++ I ++D NDNAP         S+ E+ + G  ++   A DKD G +G+VT+S+ K +   L   +I    G + +   +D ESS       T++VTATD G+   ST+L I + +QDVNDN P F        + E+   N+ + ++   D D  ++  +  R             S +     F I   +  I+       LDRE   ++   V+ATD+ G P       V V V+D NDN P      Q +     I     R      V+A+D D   E   I Y L   +  F +    G I TR  + +     + + +   + G T ++S+ +V V I  S    N+P I +
Sbjct:  609 PIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEG--------FKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGL---STTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGI-----FRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRS----NADAVVFLSIIDAMQRP-------------PIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYS----IYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHT-----QVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGL--FAIDARSGHLILSQHLDYESSQRH----TLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIY---LRAPLDRETRDRYQLTVLATDN-GTPAAHAKTRVIVRVLDANDNDPKF----QKSKYEFRIEENLRRGSVVGVVTASDLD-LGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQG-TPVRSA-RVPVRIHVSDVNDNAPEIAD 1258          

HSP 4 Score: 124.405 bits (311), Expect = 3.656e-28
Identity = 156/582 (26.80%), Postives = 254/582 (43.64%), Query Frame = 1
Query:  589 IGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQ--TDQKTGSINIAIRIIDENDNMPQFSSP------IYKEFVKEGLNSVRIL-RLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPL-----DYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLE-INVDYLNNKNYSIVEENKSNFFVAIVTVTS---KEN-----DLFRSIQCRLEHFQEILSLIS-KGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSS-------AKIEIIIKDQNDNAPTL---TYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITI--QDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPI 2226
            +G  I    ATD D G N    Y++ R  P+  ++  +   L  ++S+T  L +  PLD E   +Y   + A+D     T++   S+ + +RI+D ND+ P F SP          F+ +      ++  + A D D G NG++ Y+      TG      F IN  +G I L K L     D EK   F   + A +   P       S+ ++ + V   ++ P   +   Y      +I+E   S  FV  VT  S    EN     ++   +   L H      +I+ +G    + ++  +      D  +   +S++ + K+     +  +S       A I I + D NDN+P     + +G  S+ EN++PG V+  ++A D DEG N  + +S+      +    SI  + G +  + + D E    Q +  T+ + A+D G +PKS     +ITI  +D NDN P+F  S    ++ E+    + V +I   D D+  +  LV    N     F I  ++  I    T   LDRE    +NF V+ATD       S T  V + V+D NDN PI
Sbjct: 1500 VGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEI-----TGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEP---KKSSLNLHLIVQGSHNNPPRFLQAVY----RATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGL-SVPENSEPG-VIHTVVASDLDEGPNADLIYSITGGNLGN--KFSIDSSSGELSARPL-DRE----QHSRYTLQIQASDRG-QPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLI---TTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPI 2056          

HSP 5 Score: 121.709 bits (304), Expect = 2.476e-27
Identity = 158/713 (22.16%), Postives = 289/713 (40.53%), Query Frame = 1
Query:  589 IGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVR-ILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDE----SYKVKSFEIRTNQ----EIDREKIPKIS---------------------------------------TN--------ILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFG-TPSILENTKPGTVVFKIIAQDKDEGENGRVTFSM----EKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIF-HLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIF--PSQNNATVHVISYLEPR---NYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTI---FTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNV 2517
            +G ++    A D D G N    Y ++ +    F    +  ++ T+            LDRE    Y+F ++A DGG+ + ++ ++ + I ++D NDN P F    Y   V   +   + +L++ A D D G N +I+Y  +      + +   F IN  +G +   + L  E        V+A +   P         +S+ +  L + + P    V    N+ Y ++ +  S     ++ V +  +D  R         Q++      G+E    S    S EIR N+    + DR   P +S                                       TN        +L   + D+   +S A++ I ++D+NDN+P  +      ++ E    GT V ++ A D D G N R+ + +      +AF      S     G+++   ++D E  +     L I+  ATD G+   +    I + I DVNDN P F  ++++ T+ E     + +  I   D D +  +   L +++   +  + +   +R    L   R LD E   ++   VIA+D+       +T    V V D+NDN P+ +   P    A +  IS +      ++  +TV+A D D     + + Y +E   + F +    G +    +R + A S  G++ ++I   + G  ++KSS  + V
Sbjct: 1967 LGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGK----------LDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAE---NSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNP-------PQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRR---------QKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFS-----GIVRTNIVLDRE--IRDIYKLKII--ATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLV-TVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLT----VRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRV 2636          

HSP 6 Score: 114.005 bits (284), Expect = 5.372e-25
Identity = 158/629 (25.12%), Postives = 257/629 (40.86%), Query Frame = 1
Query:  601 ITLPVATDKDFGN-NQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKP--LDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILD-YFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIII--KDQNDNAPTLTYFG-TPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSL----------EYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIF-HLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESD-----VFDIDRQEGTIFTR 2418
            I   VATD D+GN  QV    ++  E   F           ++  T E+ V +P  L   T   +  ++ A DGG       ++ + + IID     P F    Y  +VKE      I R +        +G + ++   R+   +   D YFSI  +SG I + KPLD+E ++     + A    PPV    Y  T  V I V +V D   E     +      I     +     +    + + D   S Q      +E      KG  +   +S  +  +Q +D E   +   + L   + D  VPS S  + I++  +D NDN P       + ++ E+      + ++ A D D G N R+T+ +  +   ++          ++  I    G I +++ +D E+         + V ATD+G        ++ + + D NDN PKF  S   F I EN  + S VG +   D D+ +  N  +R    ++LP     + + +   ++T   LDRE    ++  V A D  G P  S    V + V D NDN P I  P ++  +V      +P   + + V A D+D   +  +I Y +    D     +F ID   G I TR
Sbjct:  739 IVAVVATDPDYGNFGQVSYRIVAGNEAGIF----------RIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAV-VFLSIIDAMQRPPIFEKARYNYYVKED-----IPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPV----YGHT-QVNIEVEDVNDNAPEFEASMVR-----ISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKES----GKGLFAIDARSGHLILSQHLDYESSQR---HTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETR----DRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGE--NAAIRY---SLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQ-GTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVR---EEQPPGTEVVRVRAVDRDH-GQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTR 1320          

HSP 7 Score: 107.457 bits (267), Expect = 6.650e-23
Identity = 172/710 (24.23%), Postives = 300/710 (42.25%), Query Frame = 1
Query:  616 ATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKE--GLNSV-----------RILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRL-EHFQEILSLISKGDESYKVKSFE--IRTNQEIDREKIPK--ISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFGTPS----------ILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIK-VKSIIDCESSLAQFTTLTIVVTATDHG-IKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLN------TTR-SLDREKDPKFNFQVI-------------------ATDSLGNPTNSV---TGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESES--DVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRIE 2562
            A D+D G N   TY I +   R  D H   ++  T  S  +  +V   LD E  + Y   + A DGG   ++T  + + + ++D NDN P F+S      V+E   L  V            ++R S  +  E +  ++ Y  +P  K   LI   F I+  SG + + + LD E Q+ F+  + A++ T   +    +S  +V+I V +V D   E   D ++     + E       +   T T  +      +Q RL  +F ++     +    +++ S    +     +D E + +  +    L + S  +    +S  + + I D ND+AP   +F +P+          I + T+ G VV  I+A D+D G+NG++T+  E +         I    G+I+ VKS+      + +     +++ A DHG  +PK + L + + +Q  ++N P+F  +    TI+EN    SFV  ++V  K +H   N  L  + PA +       AN +FH++      TTR   DRE    +   V                    ++DS+G+ +N       T+ + V D NDN P   F   +   + V    EP      TV A+D D+    + I Y +   +  + F ID   G + + R + +     + ++I   + G    +     N+ I       N+PR +
Sbjct: 1281 AVDRDHGQNASITYSIVKG--RDSDGHGLFSIDPT--SGVIRTRVV--LDHEERSIYRLGVAASDGGNPPRETVRM-LRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDL--RVTYTLNPLTKD--LIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTT--ASNNPQSSAITVKIEVADVNDNAPEWPQDPID---LQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAP---HFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTY--EITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFV--LQVTAKSLHGAENANLSYEIPAGV-------ANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSP--EFRPGSCYGLSVPENSEPG--VIHTVVASDLDEGPNADLI-YSITGGNLGNKFSIDSSSGEL-SARPLDREQHSRYTLQIQASDRGQPKSRQG-HCNITIFVEDQNDNAPRFK 1953          

HSP 8 Score: 90.5077 bits (223), Expect = 8.486e-18
Identity = 139/637 (21.82%), Postives = 254/637 (39.87%), Query Frame = 1
Query:  586 KIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPL--DRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVR-ILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTIT-------------------LYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKEN---DLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFG-TPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHG-IKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLV--LRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTI 2409
            +IG  +   VA D+D G+N   TY+I+       +  FR   +N+   +   +K   P   D E   +++  + A D GQ + K  S+N+ + +   ++N P+F   +Y+  + E + S   +L+++A       N  + Y+         +  D F ++   G I  +   D E Q  +  PV   +     T++                    +   A++ I+V +V D   E      +    S+ E ++      +V     E    DL  SI     +     S+ S   E          + + +DRE+  + +  I   +            I I ++DQNDNAP       T S+ E+   GT V +I A D D G N R+ +S+   A  +    +I    G+I     +D E       +   +V ATD G  + +S  + + I + D+NDN P F     I  +         + +++  D D+  +  +V  L ++N A+     +  +     L+ ++SL  E     + +V+A D  GNP  S  G +++ + +     P++ F  QN     ++    P   + + V A   D   +     +   +E  +  +D   G I
Sbjct: 1622 RIGEVVAHIVAVDEDSGDNGQLTYEITGGNG---EGRFR---INSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEI-----PAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPG--SCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITG--GNLGNKFSIDSSSGE---------LSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSL---ANETQWQFAIDGQSGLITTVGKLDRELQ----ASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGA--LSASQSLASESGKLLHLEVVARDK-GNPPQSSLGLIELLIGEAPQGTPVLRF--QNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEI 2222          

HSP 9 Score: 83.1889 bits (204), Expect = 1.589e-15
Identity = 121/549 (22.04%), Postives = 234/549 (42.62%), Query Frame = 1
Query:  847 IAIRIIDENDNMPQFSSPIYKEFVKEGLNS-VRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRL--EHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTL------TYFGT-PSILENTKPGTVVFKII---AQDKD-EGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGT-----VDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNT-IEYHLESESD--VFDIDRQEGTIFTRREM 2427
            + I + DENDN P+FS   +   V EG N    + ++ A D D G N ++ Y         A +++       SG +     LD E +  +K  +IA +   P      T TA++ + +++V D     N       N   V E  +     I ++++ + D + ++  RL  E   +I ++     + Y   S ++   + +D E   +   +++  ++       +   + + + D+NDNAP         YF   P+I E ++  +V F ++   A D D EG N +V + +E    P+ E  S+  ++GV+ V ++   + +++      + + A D G     +   + +   D      +F  +     I E     S V  +++    +   + ++  ++  A   F +L+    +      + LDRE++  +  +++ +   G P  S   +     V + ++D NDNFPI    ++  A    IS L P  Y    + A D DQ +  N+ + Y + S +D  +F ID   G +F    +
Sbjct: 2308 LVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIE----PAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQM----TGTATIRVQIVDVND-----NQPTFPPNNLVTVSE-ATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRY---SGKLVLKRRLDYELQQEYELDVIASDAAHE----ARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIE----PAQEGFSVHPSNGVVSV-NMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVV--LQLGQDALDQSLAIIAGNEESA---FELLQSKAIVL----VKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAE---ISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRL 2818          

HSP 10 Score: 78.9518 bits (193), Expect = 2.993e-14
Identity = 147/560 (26.25%), Postives = 224/560 (40.00%), Query Frame = 1
Query:  721 LNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQF-SSPIYKEFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKP----LDYEKQTFFKFPVIAVN-PTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEEN----KSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYF-----GTPSILENTKPGTVVFKIIAQDKD---EGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLP------FVILKKANRIFHLNTTRS-LDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQD 2325
            ++  T E++    LDRET   YS   + + G        +I + + + DENDN P F  + ++ EF +     V+   L A D D        Y         A  L   S  E  G +YL       LD E    +   + A++  TPP+         +V I++ +V D     N     ++ ++ V EN     S   V      + EN L      R +  +E +  I         ++  I  N+ +D E        ++ K+  +  +  ++A + I + D NDN PT+         +P I E+ +PG  V +I   D D   E  N  VT +     F      ++   D  I +  I+         +  T+ V ATD G  P      I + I DVNDN P+F        +ME     + V ++   D+D  + +N  L + + A  P      F I  +   I    TTRS +D E +P     V+A D  G P  S T TV V + D NDN PI     Q+   V V    EP     + VSA+D D
Sbjct:  125 IDRATGEIRTKVKLDRETRASYSLVAIPLSGR-------NIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLS--SHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPL-----RGFMTVNITIQDVNDNQPIFN----QSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDP-------RTGAIYINKALDFETKELHELVVVAKDHGEQPL-ETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHF------ALTTRDNSIYL-VIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRD--EGLNSAL-TYSLAETPETHAQWFQIDPQTGLI----TTRSHIDCETEPVPQLTVVARDG-GVPPLSSTATVLVTIHDVNDNEPIF---DQSFYNVSVAEN-EPVGRCILKVSASDPD 639          

HSP 11 Score: 74.3294 bits (181), Expect = 7.828e-13
Identity = 90/344 (26.16%), Postives = 151/344 (43.90%), Query Frame = 1
Query: 1423 EIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIII--KDQNDNAPTLTYFGTPSILENTKPGTVVFKII-AQDKD-EGENGRVTFSMEKSAFPSLEYLSIGETDGV----IKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVL----RSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPII--IFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIF 2412
            EIRT  ++DRE   + S +++        +P S   I +++  KD+NDNAPT              P  V   ++ A+D D E  N +    +  +   +    S  E DGV    +++   +D E++       ++++ A D G  P    + ++ITIQDVNDN P F  S    T+ EN    + V ++   D D  D+  LV     R ++     F I  +   I+     ++LD E        V+A D    P  + T  V + V D NDN P I  IF S ++A+  +    +P  +    +S +D D  +E+  +   L      F +  ++ +I+
Sbjct:  131 EIRTKVKLDRET--RASYSLVA-------IPLSGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETT----PGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDA-DENGLVEYAINRRQSDKEQMFRIDPRTGAIY---INKALDFETKELHELVVVAKDHGEQPLET-TAFVSIRVTDVNDNQPTINVIFLS-DDASPKISESAQPGEF-VARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIY 454          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 165.236 bits (417), Expect = 1.384e-40
Identity = 179/675 (26.52%), Postives = 302/675 (44.74%), Query Frame = 1
Query:  604 TLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVT-VELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVN-PTPPVTITLYTSTASVEISVLNVYDEPLEINVDYL-NNKNYSIVEENKSNFFVAIVTVTSKENDL-FRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPS--SSAKIEIIIKDQNDNAPTLTY-FGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESS-LAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKD--VHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVI--SYLEPRNYKFMTVSANDQDQTSEFNTIEYHLES--ESDVFDIDRQEGTIFTRRE--MAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRIENFNIN 2577
            TL  A D D      + Y I        ++ FRL+     + V  ++L++   LDRETT  YS  + A+DGG T    G + + I I D NDN P F+   Y   V E       +L++ A+D D   NG + Y  + R      +   F I+  +G IY+ K LD+E +   +  V+A +    P+      +TA V I V +V D    INV +L ++ +  I E  +   FVA ++V   ++   + ++   L       +L ++ +  Y V       +  +DRE +   + +++   + D   P   +S  I + I D NDN P         +++E   PGT V +++A D+DEG N  +T+S+ ++     ++  I    G+I  +S IDCE+  + Q T     V A D G+ P S+   + +TI DVNDN P F  S    ++ EN      + ++   D D  V+  +N  +      +  F +   +  I        LD E+   + F V+ATD  G    S T  + +++ D NDN P + +P +   ++     +  +  +   + V A D D    F  + Y + +  E+ +F IDR  G IF  R   ++      H++ I+  + G  +++S+    V +    A    P  E    N
Sbjct:  194 TLLPARDLDLEPYNTQRYNIVSG---NVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGG-TPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQM---FRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLE-----TTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVI-----VHLPLDREIVSNYTLSVV---ATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLT-----VVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEIC---IAGELDFERRSSYEFPVLATDRGG---LSTTAMIKMQLTDVNDNRP-VFYPREYKVSLRESPKASSQASSTPIVAVVATDPDY-GNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGG--NLRSNADAVVFLSIIDAMQRPPIFEKARYN 833          

HSP 2 Score: 142.51 bits (358), Expect = 1.172e-33
Identity = 158/565 (27.96%), Postives = 259/565 (45.84%), Query Frame = 1
Query:  616 ATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKF-DPRFK------TGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKI--EIIIKDQNDNAPTLT--YFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYL-SIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEI------------EVED--KDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLG--NPTNSVTGTVDVEVIDQNDNFP 2223
            A DKD G++   TY + ++  +          L  +++ +  L + + LD E++ +++  + A DGG     T ++ I + + D NDN P F    Y   V E  + + +I++++A+D D G N +I Y+  D          + + +  +F I  +SG IYL+ PLD E +  ++  V+A +   P       +   V + VL+  D     +  +  +K    +EEN     V  V VT+ + DL  +   R       L  I+   + + V   EI T + +DRE         L  E+ D   P  SA++   I + D NDNAP +        S+ E   PGT V ++ A D+D G+N  +T+S+ K        L SI  T GVI+ + ++D E      +   + V A+D G  P+ T   + + + D+NDN P FTSS ++F + E+      VG I             VE+  +D+     L   +K+     F I + +    +L   R LDRE   +F  ++ A D+    NP +S   TV +EV D NDN P
Sbjct:  955 AHDKDSGSSGQVTYSLVKESGKG---------LFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLST-NLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAA----HAKTRVIVRVLDANDN----DPKFQKSKYEFRIEENLRRGSVVGV-VTASDLDLGENAAIRYS-----LLPINSSFQVHPVTG-EISTREPLDRELRELYD---LVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEER----SIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSG---NLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAI-TVKIEVADVNDNAP 1483          

HSP 3 Score: 130.183 bits (326), Expect = 6.280e-30
Identity = 178/709 (25.11%), Postives = 294/709 (41.47%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEG------LNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKP--LDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFV--------AIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNI---LCKESVDSHVPSSSAKIEIIIKDQNDNAPTL-TYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLR-------------SKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRIEN 2565
            PIF++    + ++E+  +G  I    A+D D G N +  Y I           F+      + S + E+ +   LD E  + Y F ++A D G     + +  I +++ D NDN P F    YK  ++E        +S  I+ + ATDPD G  G++ Y+     + G      F I+  +GEI++ +P  L    Q      + A +     +     + A V +S+++    P              I E+ + N++V         + +V +   D+      R      I S    G  S +  S  IR  + +D E   ++  NI   L +  V  H      ++ I ++D NDNAP         S+ E+ + G  ++   A DKD G +G+VT+S+ K +   L   +I    G + +   +D ESS       T++VTATD G+   ST+L I + +QDVNDN P F        + E+   N+ + ++   D D  ++  +  R             S +     F I   +  I+       LDRE   ++   V+ATD+ G P       V V V+D NDN P      Q +     I     R      V+A+D D   E   I Y L   +  F +    G I TR  + +     + + +   + G T ++S+ +V V I  S    N+P I +
Sbjct:  609 PIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEG--------FKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGL---STTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGI-----FRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRS----NADAVVFLSIIDAMQRP-------------PIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYS----IYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHT-----QVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGL--FAIDARSGHLILSQHLDYESSQRH----TLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIY---LRAPLDRETRDRYQLTVLATDN-GTPAAHAKTRVIVRVLDANDNDPKF----QKSKYEFRIEENLRRGSVVGVVTASDLD-LGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQG-TPVRSA-RVPVRIHVSDVNDNAPEIAD 1258          

HSP 4 Score: 124.405 bits (311), Expect = 3.656e-28
Identity = 156/582 (26.80%), Postives = 254/582 (43.64%), Query Frame = 1
Query:  589 IGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQ--TDQKTGSINIAIRIIDENDNMPQFSSP------IYKEFVKEGLNSVRIL-RLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPL-----DYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLE-INVDYLNNKNYSIVEENKSNFFVAIVTVTS---KEN-----DLFRSIQCRLEHFQEILSLIS-KGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSS-------AKIEIIIKDQNDNAPTL---TYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITI--QDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPI 2226
            +G  I    ATD D G N    Y++ R  P+  ++  +   L  ++S+T  L +  PLD E   +Y   + A+D     T++   S+ + +RI+D ND+ P F SP          F+ +      ++  + A D D G NG++ Y+      TG      F IN  +G I L K L     D EK   F   + A +   P       S+ ++ + V   ++ P   +   Y      +I+E   S  FV  VT  S    EN     ++   +   L H      +I+ +G    + ++  +      D  +   +S++ + K+     +  +S       A I I + D NDN+P     + +G  S+ EN++PG V+  ++A D DEG N  + +S+      +    SI  + G +  + + D E    Q +  T+ + A+D G +PKS     +ITI  +D NDN P+F  S    ++ E+    + V +I   D D+  +  LV    N     F I  ++  I    T   LDRE    +NF V+ATD       S T  V + V+D NDN PI
Sbjct: 1500 VGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEI-----TGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEP---KKSSLNLHLIVQGSHNNPPRFLQAVY----RATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGL-SVPENSEPG-VIHTVVASDLDEGPNADLIYSITGGNLGN--KFSIDSSSGELSARPL-DRE----QHSRYTLQIQASDRG-QPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLI---TTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPI 2056          

HSP 5 Score: 121.709 bits (304), Expect = 2.476e-27
Identity = 158/713 (22.16%), Postives = 289/713 (40.53%), Query Frame = 1
Query:  589 IGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVR-ILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDE----SYKVKSFEIRTNQ----EIDREKIPKIS---------------------------------------TN--------ILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFG-TPSILENTKPGTVVFKIIAQDKDEGENGRVTFSM----EKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIF-HLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIF--PSQNNATVHVISYLEPR---NYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTI---FTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNV 2517
            +G ++    A D D G N    Y ++ +    F    +  ++ T+            LDRE    Y+F ++A DGG+ + ++ ++ + I ++D NDN P F    Y   V   +   + +L++ A D D G N +I+Y  +      + +   F IN  +G +   + L  E        V+A +   P         +S+ +  L + + P    V    N+ Y ++ +  S     ++ V +  +D  R         Q++      G+E    S    S EIR N+    + DR   P +S                                       TN        +L   + D+   +S A++ I ++D+NDN+P  +      ++ E    GT V ++ A D D G N R+ + +      +AF      S     G+++   ++D E  +     L I+  ATD G+   +    I + I DVNDN P F  ++++ T+ E     + +  I   D D +  +   L +++   +  + +   +R    L   R LD E   ++   VIA+D+       +T    V V D+NDN P+ +   P    A +  IS +      ++  +TV+A D D     + + Y +E   + F +    G +    +R + A S  G++ ++I   + G  ++KSS  + V
Sbjct: 1967 LGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGK----------LDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAE---NSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNP-------PQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRR---------QKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFS-----GIVRTNIVLDRE--IRDIYKLKII--ATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLV-TVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLT----VRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRV 2636          

HSP 6 Score: 114.005 bits (284), Expect = 5.372e-25
Identity = 158/629 (25.12%), Postives = 257/629 (40.86%), Query Frame = 1
Query:  601 ITLPVATDKDFGN-NQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKP--LDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILD-YFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIII--KDQNDNAPTLTYFG-TPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSL----------EYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIF-HLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESD-----VFDIDRQEGTIFTR 2418
            I   VATD D+GN  QV    ++  E   F           ++  T E+ V +P  L   T   +  ++ A DGG       ++ + + IID     P F    Y  +VKE      I R +        +G + ++   R+   +   D YFSI  +SG I + KPLD+E ++     + A    PPV    Y  T  V I V +V D   E     +      I     +     +    + + D   S Q      +E      KG  +   +S  +  +Q +D E   +   + L   + D  VPS S  + I++  +D NDN P       + ++ E+      + ++ A D D G N R+T+ +  +   ++          ++  I    G I +++ +D E+         + V ATD+G        ++ + + D NDN PKF  S   F I EN  + S VG +   D D+ +  N  +R    ++LP     + + +   ++T   LDRE    ++  V A D  G P  S    V + V D NDN P I  P ++  +V      +P   + + V A D+D   +  +I Y +    D     +F ID   G I TR
Sbjct:  739 IVAVVATDPDYGNFGQVSYRIVAGNEAGIF----------RIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAV-VFLSIIDAMQRPPIFEKARYNYYVKED-----IPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPV----YGHT-QVNIEVEDVNDNAPEFEASMVR-----ISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKES----GKGLFAIDARSGHLILSQHLDYESSQR---HTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETR----DRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGE--NAAIRY---SLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQ-GTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVR---EEQPPGTEVVRVRAVDRDH-GQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTR 1320          

HSP 7 Score: 107.457 bits (267), Expect = 6.650e-23
Identity = 172/710 (24.23%), Postives = 300/710 (42.25%), Query Frame = 1
Query:  616 ATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKE--GLNSV-----------RILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRL-EHFQEILSLISKGDESYKVKSFE--IRTNQEIDREKIPK--ISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFGTPS----------ILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIK-VKSIIDCESSLAQFTTLTIVVTATDHG-IKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLN------TTR-SLDREKDPKFNFQVI-------------------ATDSLGNPTNSV---TGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESES--DVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRIE 2562
            A D+D G N   TY I +   R  D H   ++  T  S  +  +V   LD E  + Y   + A DGG   ++T  + + + ++D NDN P F+S      V+E   L  V            ++R S  +  E +  ++ Y  +P  K   LI   F I+  SG + + + LD E Q+ F+  + A++ T   +    +S  +V+I V +V D   E   D ++     + E       +   T T  +      +Q RL  +F ++     +    +++ S    +     +D E + +  +    L + S  +    +S  + + I D ND+AP   +F +P+          I + T+ G VV  I+A D+D G+NG++T+  E +         I    G+I+ VKS+      + +     +++ A DHG  +PK + L + + +Q  ++N P+F  +    TI+EN    SFV  ++V  K +H   N  L  + PA +       AN +FH++      TTR   DRE    +   V                    ++DS+G+ +N       T+ + V D NDN P   F   +   + V    EP      TV A+D D+    + I Y +   +  + F ID   G + + R + +     + ++I   + G    +     N+ I       N+PR +
Sbjct: 1281 AVDRDHGQNASITYSIVKG--RDSDGHGLFSIDPT--SGVIRTRVV--LDHEERSIYRLGVAASDGGNPPRETVRM-LRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDL--RVTYTLNPLTKD--LIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTT--ASNNPQSSAITVKIEVADVNDNAPEWPQDPID---LQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAP---HFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTY--EITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFV--LQVTAKSLHGAENANLSYEIPAGV-------ANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSP--EFRPGSCYGLSVPENSEPG--VIHTVVASDLDEGPNADLI-YSITGGNLGNKFSIDSSSGEL-SARPLDREQHSRYTLQIQASDRGQPKSRQG-HCNITIFVEDQNDNAPRFK 1953          

HSP 8 Score: 90.5077 bits (223), Expect = 8.486e-18
Identity = 139/637 (21.82%), Postives = 254/637 (39.87%), Query Frame = 1
Query:  586 KIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPL--DRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVR-ILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTIT-------------------LYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKEN---DLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFG-TPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHG-IKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLV--LRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTI 2409
            +IG  +   VA D+D G+N   TY+I+       +  FR   +N+   +   +K   P   D E   +++  + A D GQ + K  S+N+ + +   ++N P+F   +Y+  + E + S   +L+++A       N  + Y+         +  D F ++   G I  +   D E Q  +  PV   +     T++                    +   A++ I+V +V D   E      +    S+ E ++      +V     E    DL  SI     +     S+ S   E          + + +DRE+  + +  I   +            I I ++DQNDNAP       T S+ E+   GT V +I A D D G N R+ +S+   A  +    +I    G+I     +D E       +   +V ATD G  + +S  + + I + D+NDN P F     I  +         + +++  D D+  +  +V  L ++N A+     +  +     L+ ++SL  E     + +V+A D  GNP  S  G +++ + +     P++ F  QN     ++    P   + + V A   D   +     +   +E  +  +D   G I
Sbjct: 1622 RIGEVVAHIVAVDEDSGDNGQLTYEITGGNG---EGRFR---INSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEI-----PAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPG--SCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITG--GNLGNKFSIDSSSGE---------LSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSL---ANETQWQFAIDGQSGLITTVGKLDRELQ----ASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGA--LSASQSLASESGKLLHLEVVARDK-GNPPQSSLGLIELLIGEAPQGTPVLRF--QNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEI 2222          

HSP 9 Score: 83.1889 bits (204), Expect = 1.589e-15
Identity = 121/549 (22.04%), Postives = 234/549 (42.62%), Query Frame = 1
Query:  847 IAIRIIDENDNMPQFSSPIYKEFVKEGLNS-VRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRL--EHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTL------TYFGT-PSILENTKPGTVVFKII---AQDKD-EGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGT-----VDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNT-IEYHLESESD--VFDIDRQEGTIFTRREM 2427
            + I + DENDN P+FS   +   V EG N    + ++ A D D G N ++ Y         A +++       SG +     LD E +  +K  +IA +   P      T TA++ + +++V D     N       N   V E  +     I ++++ + D + ++  RL  E   +I ++     + Y   S ++   + +D E   +   +++  ++       +   + + + D+NDNAP         YF   P+I E ++  +V F ++   A D D EG N +V + +E    P+ E  S+  ++GV+ V ++   + +++      + + A D G     +   + +   D      +F  +     I E     S V  +++    +   + ++  ++  A   F +L+    +      + LDRE++  +  +++ +   G P  S   +     V + ++D NDNFPI    ++  A    IS L P  Y    + A D DQ +  N+ + Y + S +D  +F ID   G +F    +
Sbjct: 2308 LVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIE----PAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQM----TGTATIRVQIVDVND-----NQPTFPPNNLVTVSE-ATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRY---SGKLVLKRRLDYELQQEYELDVIASDAAHE----ARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIE----PAQEGFSVHPSNGVVSV-NMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVV--LQLGQDALDQSLAIIAGNEESA---FELLQSKAIVL----VKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAE---ISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRL 2818          

HSP 10 Score: 78.9518 bits (193), Expect = 2.993e-14
Identity = 147/560 (26.25%), Postives = 224/560 (40.00%), Query Frame = 1
Query:  721 LNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQF-SSPIYKEFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKP----LDYEKQTFFKFPVIAVN-PTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEEN----KSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYF-----GTPSILENTKPGTVVFKIIAQDKD---EGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLP------FVILKKANRIFHLNTTRS-LDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQD 2325
            ++  T E++    LDRET   YS   + + G        +I + + + DENDN P F  + ++ EF +     V+   L A D D        Y         A  L   S  E  G +YL       LD E    +   + A++  TPP+         +V I++ +V D     N     ++ ++ V EN     S   V      + EN L      R +  +E +  I         ++  I  N+ +D E        ++ K+  +  +  ++A + I + D NDN PT+         +P I E+ +PG  V +I   D D   E  N  VT +     F      ++   D  I +  I+         +  T+ V ATD G  P      I + I DVNDN P+F        +ME     + V ++   D+D  + +N  L + + A  P      F I  +   I    TTRS +D E +P     V+A D  G P  S T TV V + D NDN PI     Q+   V V    EP     + VSA+D D
Sbjct:  125 IDRATGEIRTKVKLDRETRASYSLVAIPLSGR-------NIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLS--SHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPL-----RGFMTVNITIQDVNDNQPIFN----QSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDP-------RTGAIYINKALDFETKELHELVVVAKDHGEQPL-ETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHF------ALTTRDNSIYL-VIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRD--EGLNSAL-TYSLAETPETHAQWFQIDPQTGLI----TTRSHIDCETEPVPQLTVVARDG-GVPPLSSTATVLVTIHDVNDNEPIF---DQSFYNVSVAEN-EPVGRCILKVSASDPD 639          

HSP 11 Score: 74.3294 bits (181), Expect = 7.828e-13
Identity = 90/344 (26.16%), Postives = 151/344 (43.90%), Query Frame = 1
Query: 1423 EIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIII--KDQNDNAPTLTYFGTPSILENTKPGTVVFKII-AQDKD-EGENGRVTFSMEKSAFPSLEYLSIGETDGV----IKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVL----RSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPII--IFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIF 2412
            EIRT  ++DRE   + S +++        +P S   I +++  KD+NDNAPT              P  V   ++ A+D D E  N +    +  +   +    S  E DGV    +++   +D E++       ++++ A D G  P    + ++ITIQDVNDN P F  S    T+ EN    + V ++   D D  D+  LV     R ++     F I  +   I+     ++LD E        V+A D    P  + T  V + V D NDN P I  IF S ++A+  +    +P  +    +S +D D  +E+  +   L      F +  ++ +I+
Sbjct:  131 EIRTKVKLDRET--RASYSLVA-------IPLSGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETT----PGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDA-DENGLVEYAINRRQSDKEQMFRIDPRTGAIY---INKALDFETKELHELVVVAKDHGEQPLET-TAFVSIRVTDVNDNQPTINVIFLS-DDASPKISESAQPGEF-VARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIY 454          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304900)

HSP 1 Score: 145.206 bits (365), Expect = 1.785e-34
Identity = 153/561 (27.27%), Postives = 253/561 (45.10%), Query Frame = 1
Query:  583 VKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGE--IYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYD-EPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFGTP----SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLR----SKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPII 2229
            V +G+ I    A D D G N   TY IS +     D++F L V    +  T  ++  KPLDRE   +++F ++A DGG    K+ S ++ I + D NDN P F+   Y+  V E       +  ++ATDPDE  + ++ Y+      T       F+I   +G   I + + LDY+++  F   V A +          + TA+V I++ +  +  P+  N  Y    + S+ E+      V +V+ T  +  +   I   L   + I  L S    S   ++  I TN  +DRE        +  K+  +  + S +  +EI + D NDNAP    F +P    SILE+   GT V ++ A D D G NGR+ + +         ++ I  T G I+    +D ES         +   A D G  P S+ +++ I ++DVND+ P F S  +   + EN+   S VGEI   D D  + +N V+       + +    ++ +  +    L T   LD E   K  F+++   +  +P       +++ V D NDN P++
Sbjct:  702 VPVGYNIIRVQAYDSDEGANAEITYSISER-----DDNFPLAV----DPRTGWVQTIKPLDREEQGRFAFQVVAKDGG-VPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEI-----TTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGG------RSDTATVHINITDANNFAPIFENAPY----SASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNE-ESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSL-SDTTDVEIGVTDVNDNAPA---FKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFV-IDPTSGTIRTNKGLDRES----VAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPD--EGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRK-RFELVVRAA--SPPLRNDAHIEILVTDVNDNAPVL 1220          

HSP 2 Score: 140.198 bits (352), Expect = 5.134e-33
Identity = 179/699 (25.61%), Postives = 302/699 (43.20%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISR----------QEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAID--GGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKE----GLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKV----KSFEIRTNQEIDREKIPKISTNILCKESVDSHVP--SSSAKIEIIIKDQNDNAPTL--TYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKD--VHDDINLVLRSKNPAML----PFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPR--NYKFMTVSANDQDQTSEFNTIEYHLESESDV----FDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVID 2526
            P F     E  I E   +G T+    ATD+D G N    Y I            QE   F    R  V++T +S          LDRET++ Y   + A D    Q++++T + ++ ++++D+NDN PQFS   Y   V E    G     +  + ATD D+G N  I Y        G      FSI+  SG++ L KPLDYE    ++  + A +   P      ++T  + ++V++  D        Y +    S++E     +   I+ V + ++D   +         EI   IS+ D+++ +    ++  ++T + +DRE+  + +  ++ K   D  VP  S+S+ + I ++D NDN P     Y+   ++ E+  PGT V  + A D D  E+ R+ + +          ++     G+I +   +D      Q     + V ATD G +  +  + I+IT  D N+  P F ++    ++ E+    + V  +   D D  V+  I   L  ++   L    PF I  +   I    T   LDRE    +   V A D  GNP+ S T  V++ V D NDN P    P      ++  S LE        + V+A+D D     N    +L S+ D+    F ID   GTI T + + +  +    +     + G   + S+V+V + ++
Sbjct:  462 PTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSS----------LDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI-----IGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSR----SNTTQLLVNVIDANDNAPRF---YTSQFQESVLENVPVGY--NIIRVQAYDSDEGANA--------EITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAK---DGGVPPKSASSSVVITVQDVNDNDPAFNPKYY-EANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLD----YKQEKRFLLTVAATDSGGRSDTATVHINIT--DANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIV---TNAPLDRETTSGYLLTVTAKDG-GNPSLSDTTDVEIGVTDVNDNAPAFKSP------LYQASILEDALVGTSVIQVAASDPDVG--LNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLE 1104          

HSP 3 Score: 114.775 bits (286), Expect = 3.676e-25
Identity = 145/514 (28.21%), Postives = 227/514 (44.16%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAID-GGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNY--SIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKV--KSFEIRTNQEIDREKIPKISTNILCKESVDSHVP--SSSAKIEIIIKDQNDNAPTLTYFG-TPSILENTKPGTVVFKIIAQDKDEGENGRVTFSM----EKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAML 2040
            P FN +  E  + E    G  +T   ATD D   +    Y+I+    R     F +   N    +T+     + LD +   ++   + A D GG++D  T  INI     D N+  P F +  Y   V E       +L +SATD D G+N +I Y  +     G    D FSIN  +G I    PLD E  + +   V A +   P      + T  VEI V +V D     N     +  Y  SI+E+  +    +++ V + + D+   +  R+++   +LS     D S+ +   S  IRTN+ +DRE +       +   +VD   P  SS+ +++I ++D ND+ PT      T  + EN+  G+VV +I A D DEG N  V +S+    + +AF  +     G     +   + +D ES+  +F    +VV A      P   D  I I + DVNDN P      +IF    ++  +  +G I   D DV D ++  + S N A L
Sbjct:  792 PAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTR---GRFAITSQNGRGLITIA----QSLDYKQEKRFLLTVAATDSGGRSDTATVHINIT----DANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPS----LSDTTDVEIGVTDVND-----NAPAFKSPLYQASILED--ALVGTSVIQVAASDPDV--GLNGRIKY---LLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAI---AVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLV--TRPGSERAQLLTMTELDYESTRKRFE---LVVRAAS---PPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHYRILSGNNANL 1265          

HSP 4 Score: 85.8853 bits (211), Expect = 1.995e-16
Identity = 123/526 (23.38%), Postives = 218/526 (41.44%), Query Frame = 1
Query:  826 QKTGSINIAIRIIDENDNM-PQFSSPIY-KEFVKEGLNSVRILRLSATDP-DEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPT-PPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRS--IQCRLEHFQEILSLISKGDESYKV-----KSFEIRTNQEIDREKIPKISTNILCKE--SVDSHVPSSSAKIEIIIKDQNDNAPTL---TYFGTPSILENTKPGT---VVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLR-SKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFN 2343
            Q+    +IA R+  E  N  P F   +Y    ++E      +  + A DP D  +   ++   D R ++       F ++  +G +     LD E      F V+A + + PP      + T +++++VL+  D       +       SI E   +     ++T+ + + D+ ++  I+  +E   +   L    D+   +     +S  I T   +DRE        +   +  S  S   +++A +++ + D NDN P     TY  T  + E+   GT    V  I A D D+G N  + +++      S    SI    G + +   +D ES      +  +V+ A D G   +S   Q+ + + D NDN P+F +S    +++EN      +  ++  D D   +  +    S+     P  +  +   +    T + LDRE+  +F FQV+A D  G P  S + +V + V D NDN P    P    A V      +P      TV+A D D+ S  +
Sbjct:  337 QEFNDTDIARRVRRELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQS------LFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPP-----RSGTTTLQVNVLDCNDHSPTFEAEQFEA---SIRE--GATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQ--DQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTY--TVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQS--QFSIDSMSGDVSLVKPLDYES----VRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWV---QTIKPLDREEQGRFAFQVVAKDG-GVPPKSASSSVVITVQDVNDNDP-AFNPKYYEANV---GEDQPPGTPVTTVTATDPDEDSRLH 828          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0303223)

HSP 1 Score: 145.206 bits (365), Expect = 1.926e-34
Identity = 156/561 (27.81%), Postives = 256/561 (45.63%), Query Frame = 1
Query:  583 VKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGE--IYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYD-EPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFGTP----SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLR----SKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPII 2229
            V +G+ I    A D D G N   TY IS +     D++F L V    +  T  ++  KPLDRE   +++F ++A DGG    K+ S ++ I + D NDN P F+   Y+  V E       +  ++ATDPDE  + ++ Y+      T       F+I   +G   I + + LDY+++  F   V A +          + TA+V I++ +  +  P+  N  Y    + S+ E+      V +V+ T  +  +   I   L   + I  L S    S   ++  I TN  +DRE        +  K+  +  + S +  +EI + D NDNAP    F +P    SILE+   GT V ++ A D D G NGR+ + +         ++ I  T G I+    +D ES +A F    I V   D G  P S+ +++ I ++DVND+ P F S  +   + EN+   S VGEI   D D  + +N V+       + +    ++ +  +    L T   LD E   K  F+++   +  +P       +++ V D NDN P++
Sbjct:  702 VPVGYNIIRVQAYDSDEGANAEITYSISER-----DDNFPLAV----DPRTGWVQTIKPLDREEQGRFAFQVVAKDGG-VPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEI-----TTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGG------RSDTATVHINITDANNFAPIFENAPY----SASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNE-ESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSL-SDTTDVEIGVTDVNDNAPA---FKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFV-IDPTSGTIRTNKGLDRES-VAVFHLTAIAV---DKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPD--EGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRK-RFELVVRAA--SPPLRNDAHIEILVTDVNDNAPVL 1220          

HSP 2 Score: 140.198 bits (352), Expect = 6.401e-33
Identity = 179/699 (25.61%), Postives = 302/699 (43.20%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISR----------QEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAID--GGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKE----GLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKV----KSFEIRTNQEIDREKIPKISTNILCKESVDSHVP--SSSAKIEIIIKDQNDNAPTL--TYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKD--VHDDINLVLRSKNPAML----PFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPR--NYKFMTVSANDQDQTSEFNTIEYHLESESDV----FDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVID 2526
            P F     E  I E   +G T+    ATD+D G N    Y I            QE   F    R  V++T +S          LDRET++ Y   + A D    Q++++T + ++ ++++D+NDN PQFS   Y   V E    G     +  + ATD D+G N  I Y        G      FSI+  SG++ L KPLDYE    ++  + A +   P      ++T  + ++V++  D        Y +    S++E     +   I+ V + ++D   +         EI   IS+ D+++ +    ++  ++T + +DRE+  + +  ++ K   D  VP  S+S+ + I ++D NDN P     Y+   ++ E+  PGT V  + A D D  E+ R+ + +          ++     G+I +   +D      Q     + V ATD G +  +  + I+IT  D N+  P F ++    ++ E+    + V  +   D D  V+  I   L  ++   L    PF I  +   I    T   LDRE    +   V A D  GNP+ S T  V++ V D NDN P    P      ++  S LE        + V+A+D D     N    +L S+ D+    F ID   GTI T + + +  +    +     + G   + S+V+V + ++
Sbjct:  462 PTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSS----------LDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI-----IGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSR----SNTTQLLVNVIDANDNAPRF---YTSQFQESVLENVPVGY--NIIRVQAYDSDEGANA--------EITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAK---DGGVPPKSASSSVVITVQDVNDNDPAFNPKYY-EANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLD----YKQEKRFLLTVAATDSGGRSDTATVHINIT--DANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIV---TNAPLDRETTSGYLLTVTAKDG-GNPSLSDTTDVEIGVTDVNDNAPAFKSP------LYQASILEDALVGTSVIQVAASDPDVG--LNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLE 1104          

HSP 3 Score: 114.39 bits (285), Expect = 4.280e-25
Identity = 145/514 (28.21%), Postives = 227/514 (44.16%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAID-GGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNY--SIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKV--KSFEIRTNQEIDREKIPKISTNILCKESVDSHVP--SSSAKIEIIIKDQNDNAPTLTYFG-TPSILENTKPGTVVFKIIAQDKDEGENGRVTFSM----EKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAML 2040
            P FN +  E  + E    G  +T   ATD D   +    Y+I+    R     F +   N    +T+     + LD +   ++   + A D GG++D  T  INI     D N+  P F +  Y   V E       +L +SATD D G+N +I Y  +     G    D FSIN  +G I    PLD E  + +   V A +   P      + T  VEI V +V D     N     +  Y  SI+E+  +    +++ V + + D+   +  R+++   +LS     D S+ +   S  IRTN+ +DRE +       +   +VD   P  SS+ +++I ++D ND+ PT      T  + EN+  G+VV +I A D DEG N  V +S+    + +AF  +     G     +   + +D ES+  +F    +VV A      P   D  I I + DVNDN P      +IF    ++  +  +G I   D DV D ++  + S N A L
Sbjct:  792 PAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTR---GRFAITSQNGRGLITIA----QSLDYKQEKRFLLTVAATDSGGRSDTATVHINIT----DANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPS----LSDTTDVEIGVTDVND-----NAPAFKSPLYQASILED--ALVGTSVIQVAASDPDV--GLNGRIKY---LLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAI---AVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLV--TRPGSERAQLLTMTELDYESTRKRFE---LVVRAAS---PPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHYRILSGNNANL 1265          

HSP 4 Score: 85.8853 bits (211), Expect = 2.207e-16
Identity = 123/526 (23.38%), Postives = 218/526 (41.44%), Query Frame = 1
Query:  826 QKTGSINIAIRIIDENDNM-PQFSSPIY-KEFVKEGLNSVRILRLSATDP-DEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPT-PPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRS--IQCRLEHFQEILSLISKGDESYKV-----KSFEIRTNQEIDREKIPKISTNILCKE--SVDSHVPSSSAKIEIIIKDQNDNAPTL---TYFGTPSILENTKPGT---VVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLR-SKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFN 2343
            Q+    +IA R+  E  N  P F   +Y    ++E      +  + A DP D  +   ++   D R ++       F ++  +G +     LD E      F V+A + + PP      + T +++++VL+  D       +       SI E   +     ++T+ + + D+ ++  I+  +E   +   L    D+   +     +S  I T   +DRE        +   +  S  S   +++A +++ + D NDN P     TY  T  + E+   GT    V  I A D D+G N  + +++      S    SI    G + +   +D ES      +  +V+ A D G   +S   Q+ + + D NDN P+F +S    +++EN      +  ++  D D   +  +    S+     P  +  +   +    T + LDRE+  +F FQV+A D  G P  S + +V + V D NDN P    P    A V      +P      TV+A D D+ S  +
Sbjct:  337 QEFNDTDIARRVRRELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQS------LFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPP-----RSGTTTLQVNVLDCNDHSPTFEAEQFEA---SIRE--GATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQ--DQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTY--TVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQS--QFSIDSMSGDVSLVKPLDYES----VRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWV---QTIKPLDREEQGRFAFQVVAKDG-GVPPKSASSSVVITVQDVNDNDP-AFNPKYYEANV---GEDQPPGTPVTTVTATDPDEDSRLH 828          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0088214)

HSP 1 Score: 145.206 bits (365), Expect = 1.926e-34
Identity = 156/561 (27.81%), Postives = 256/561 (45.63%), Query Frame = 1
Query:  583 VKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGE--IYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYD-EPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFGTP----SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLR----SKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPII 2229
            V +G+ I    A D D G N   TY IS +     D++F L V    +  T  ++  KPLDRE   +++F ++A DGG    K+ S ++ I + D NDN P F+   Y+  V E       +  ++ATDPDE  + ++ Y+      T       F+I   +G   I + + LDY+++  F   V A +          + TA+V I++ +  +  P+  N  Y    + S+ E+      V +V+ T  +  +   I   L   + I  L S    S   ++  I TN  +DRE        +  K+  +  + S +  +EI + D NDNAP    F +P    SILE+   GT V ++ A D D G NGR+ + +         ++ I  T G I+    +D ES +A F    I V   D G  P S+ +++ I ++DVND+ P F S  +   + EN+   S VGEI   D D  + +N V+       + +    ++ +  +    L T   LD E   K  F+++   +  +P       +++ V D NDN P++
Sbjct:  702 VPVGYNIIRVQAYDSDEGANAEITYSISER-----DDNFPLAV----DPRTGWVQTIKPLDREEQGRFAFQVVAKDGG-VPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEI-----TTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGG------RSDTATVHINITDANNFAPIFENAPY----SASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNE-ESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSL-SDTTDVEIGVTDVNDNAPA---FKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFV-IDPTSGTIRTNKGLDRES-VAVFHLTAIAV---DKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPD--EGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRK-RFELVVRAA--SPPLRNDAHIEILVTDVNDNAPVL 1220          

HSP 2 Score: 140.198 bits (352), Expect = 6.401e-33
Identity = 179/699 (25.61%), Postives = 302/699 (43.20%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISR----------QEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAID--GGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKE----GLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKV----KSFEIRTNQEIDREKIPKISTNILCKESVDSHVP--SSSAKIEIIIKDQNDNAPTL--TYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKD--VHDDINLVLRSKNPAML----PFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPR--NYKFMTVSANDQDQTSEFNTIEYHLESESDV----FDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVID 2526
            P F     E  I E   +G T+    ATD+D G N    Y I            QE   F    R  V++T +S          LDRET++ Y   + A D    Q++++T + ++ ++++D+NDN PQFS   Y   V E    G     +  + ATD D+G N  I Y        G      FSI+  SG++ L KPLDYE    ++  + A +   P      ++T  + ++V++  D        Y +    S++E     +   I+ V + ++D   +         EI   IS+ D+++ +    ++  ++T + +DRE+  + +  ++ K   D  VP  S+S+ + I ++D NDN P     Y+   ++ E+  PGT V  + A D D  E+ R+ + +          ++     G+I +   +D      Q     + V ATD G +  +  + I+IT  D N+  P F ++    ++ E+    + V  +   D D  V+  I   L  ++   L    PF I  +   I    T   LDRE    +   V A D  GNP+ S T  V++ V D NDN P    P      ++  S LE        + V+A+D D     N    +L S+ D+    F ID   GTI T + + +  +    +     + G   + S+V+V + ++
Sbjct:  462 PTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSS----------LDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI-----IGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSR----SNTTQLLVNVIDANDNAPRF---YTSQFQESVLENVPVGY--NIIRVQAYDSDEGANA--------EITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAK---DGGVPPKSASSSVVITVQDVNDNDPAFNPKYY-EANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLD----YKQEKRFLLTVAATDSGGRSDTATVHINIT--DANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIV---TNAPLDRETTSGYLLTVTAKDG-GNPSLSDTTDVEIGVTDVNDNAPAFKSP------LYQASILEDALVGTSVIQVAASDPDVG--LNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLE 1104          

HSP 3 Score: 114.39 bits (285), Expect = 4.280e-25
Identity = 145/514 (28.21%), Postives = 227/514 (44.16%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAID-GGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNY--SIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKV--KSFEIRTNQEIDREKIPKISTNILCKESVDSHVP--SSSAKIEIIIKDQNDNAPTLTYFG-TPSILENTKPGTVVFKIIAQDKDEGENGRVTFSM----EKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAML 2040
            P FN +  E  + E    G  +T   ATD D   +    Y+I+    R     F +   N    +T+     + LD +   ++   + A D GG++D  T  INI     D N+  P F +  Y   V E       +L +SATD D G+N +I Y  +     G    D FSIN  +G I    PLD E  + +   V A +   P      + T  VEI V +V D     N     +  Y  SI+E+  +    +++ V + + D+   +  R+++   +LS     D S+ +   S  IRTN+ +DRE +       +   +VD   P  SS+ +++I ++D ND+ PT      T  + EN+  G+VV +I A D DEG N  V +S+    + +AF  +     G     +   + +D ES+  +F    +VV A      P   D  I I + DVNDN P      +IF    ++  +  +G I   D DV D ++  + S N A L
Sbjct:  792 PAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTR---GRFAITSQNGRGLITIA----QSLDYKQEKRFLLTVAATDSGGRSDTATVHINIT----DANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPS----LSDTTDVEIGVTDVND-----NAPAFKSPLYQASILED--ALVGTSVIQVAASDPDV--GLNGRIKY---LLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAI---AVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLV--TRPGSERAQLLTMTELDYESTRKRFE---LVVRAAS---PPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHYRILSGNNANL 1265          

HSP 4 Score: 85.8853 bits (211), Expect = 2.207e-16
Identity = 123/526 (23.38%), Postives = 218/526 (41.44%), Query Frame = 1
Query:  826 QKTGSINIAIRIIDENDNM-PQFSSPIY-KEFVKEGLNSVRILRLSATDP-DEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPT-PPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRS--IQCRLEHFQEILSLISKGDESYKV-----KSFEIRTNQEIDREKIPKISTNILCKE--SVDSHVPSSSAKIEIIIKDQNDNAPTL---TYFGTPSILENTKPGT---VVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLR-SKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFN 2343
            Q+    +IA R+  E  N  P F   +Y    ++E      +  + A DP D  +   ++   D R ++       F ++  +G +     LD E      F V+A + + PP      + T +++++VL+  D       +       SI E   +     ++T+ + + D+ ++  I+  +E   +   L    D+   +     +S  I T   +DRE        +   +  S  S   +++A +++ + D NDN P     TY  T  + E+   GT    V  I A D D+G N  + +++      S    SI    G + +   +D ES      +  +V+ A D G   +S   Q+ + + D NDN P+F +S    +++EN      +  ++  D D   +  +    S+     P  +  +   +    T + LDRE+  +F FQV+A D  G P  S + +V + V D NDN P    P    A V      +P      TV+A D D+ S  +
Sbjct:  337 QEFNDTDIARRVRRELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQS------LFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPP-----RSGTTTLQVNVLDCNDHSPTFEAEQFEA---SIRE--GATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQ--DQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTY--TVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQS--QFSIDSMSGDVSLVKPLDYES----VRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWV---QTIKPLDREEQGRFAFQVVAKDG-GVPPKSASSSVVITVQDVNDNDP-AFNPKYYEANV---GEDQPPGTPVTTVTATDPDEDSRLH 828          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh2g28 (protocadherin 2 gamma 28 [Source:ZFIN;Acc:ZDB-GENE-050610-19])

HSP 1 Score: 188.734 bits (478), Expect = 1.842e-48
Identity = 196/695 (28.20%), Postives = 317/695 (45.61%), Query Frame = 1
Query:  223 VINISDDTALNIKLYDLKKLIPQTKMTYHLLKSSKAHSYFTIKNDNLFTNTLVDMDSMCQNVGECCNKAKEICDFSIAIACRENQESEVXXXXXXXXXXXXXXXYPIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLN-SVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYK-EFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKS-----FEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSA--KIEIIIKDQNDNAPTLTYFG-TPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEK---SAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLR----SKNPAMLPFVILKKANRIF--------HLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIII 2232
            V NI  D  L     D+K+L  ++       + S+ +    +    L     +D + +C  V  C         F I +      ES +    I + I D ND+ P+F+ + I+ +ISES   G   +L  A D D G N +++Y ++ ++      HF L V++  + S  VE+ +  PLDRET +++   L A DGG   Q+TG++ I + +ID NDN P FS P+Y+    +   N   ++R+SATD D+G NG+I Y F    ++    LD F I  D+GEI +K  LDYE+   F+  + A +          T ++ V I + +V D P  I++   +N    I E+      +A++ V   ++     ++C +             D  +KVKS     + + T+Q +DREKI + +  +    + D   PS S    + + I D NDNAP       T  I+EN  PG  V  + A D+D G N R+++ +E    +   +  ++S+    G I      D E    Q    +I V A D G  P S+++ + I IQD NDN P+     +++ +       S V EI     DV   +  V+     S   A L + + K  +R           + T R +  +   K    V+  D+ G P+ S T  V+V V    D+FP ++
Sbjct:   54 VGNIVQDLGL-----DVKRL--KSGRARIFTEDSREYIALNVDKGTLVVKERIDREELCAQVSPCS------LHFQIIL------ESPMELHRIDVEILDINDHAPVFDRKEIDFQISESALPGARFSLDSAHDPDTGTNALKSYTLNPKD------HFDLKVMSRNDGSKYVEMVLQAPLDRETQHEHKLTLTAFDGGNP-QRTGTVRICVTVIDANDNAPVFSLPVYRVSLFENAPNGAVVVRVSATDNDQGANGEITYSFS---RSSGKNLDLFHIGADTGEITVKGHLDYERAKQFELNIDATDKGG------LTDSSKVIIDITDVNDNPPVISLISFSNP---IPEDAAPETVIAMLNVKDLDSGKNGQVKCYI-----------SADMPFKVKSSAQNFYSLITDQLLDREKISEYNITV---TATDEGSPSFSTNKTLTLKISDVNDNAPVFERQSYTAFIMENNSPGVSVLSVKAHDRDSGNNARISYFLEDVVVNGVSASTFISVNAESGEILAARSFDYE----QTKDFSIRVKAQDGGSPPLSSNVSVKILIQDQNDNAPQ-----VLYPVQSG---ASVVAEIVPRSADVGYLVTKVVAVDVDSGQNAWLSYKLHKATDRALFEVGAQNGEIRTVRQVTDKDAVKQRLTVVVEDN-GQPSRSATVNVNVAVA---DSFPEVL 680          

HSP 2 Score: 127.872 bits (320), Expect = 2.017e-29
Identity = 163/588 (27.72%), Postives = 257/588 (43.71%), Query Frame = 1
Query:  847 IAIRIIDENDNMPQF-SSPIYKEFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSG--EIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSI-VEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEI---LSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAP--TLTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKS--------IIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINL------VLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRN----YKFMTVSANDQDQTSEFNTIEYHLESESD--VFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVI 2523
            I + I+D ND+ P F    I  +  +  L   R    SA DPD G N    Y  +P+       L   S N+ S   E+ L+ PLD E Q   K  + A +   P      T T  + ++V++  D     N    +   Y + + EN  N  V +V V++ +ND   + +      +     L L   G ++      EI     +D E+  +   NI   ++ D    + S+K+ I I D NDN P  +L  F  P I E+  P TV+  +  +D D G+NG+V             Y+S    D   KVKS        I D      + +   I VTATD G    ST+  +++ I DVNDN P F        IMENN     V  ++  D+D  ++  +      V+ +   A     +  ++  I      RS D E+   F+ +V A D  G+P  S   +V + + DQNDN P +++P Q+ A+  V++ + PR+    Y    V A D D + +   + Y L   +D  +F++  Q G I T R++   D  +  + + V + G  S  ++V VNV +
Sbjct:  128 IDVEILDINDHAPVFDRKEIDFQISESALPGARFSLDSAHDPDTGTNALKSYTLNPK---DHFDLKVMSRNDGSKYVEMVLQAPLDRETQHEHKLTLTAFDGGNP----QRTGTVRICVTVIDAND-----NAPVFSLPVYRVSLFENAPNGAV-VVRVSATDNDQGANGEITYSFSRSSGKNLDLFHIGADT-----GEITVKGHLDYERAKQFELNI---DATDKGGLTDSSKVIIDITDVNDNPPVISLISFSNP-IPEDAAPETVIAMLNVKDLDSGKNGQVKC-----------YIS---ADMPFKVKSSAQNFYSLITDQLLDREKISEYNITVTATDEGSPSFSTNKTLTLKISDVNDNAPVFERQSYTAFIMENNSPGVSVLSVKAHDRDSGNNARISYFLEDVVVNGVSASTFISVNAESGEIL---AARSFDYEQTKDFSIRVKAQDG-GSPPLSSNVSVKILIQDQNDNAPQVLYPVQSGAS--VVAEIVPRSADVGYLVTKVVAVDVD-SGQNAWLSYKLHKATDRALFEVGAQNGEIRTVRQVTDKDAVKQRLTVVVEDNGQPSRSATVNVNVAV 672          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh2g28 (protocadherin 2 gamma 28 [Source:ZFIN;Acc:ZDB-GENE-050610-19])

HSP 1 Score: 186.808 bits (473), Expect = 8.997e-48
Identity = 173/592 (29.22%), Postives = 280/592 (47.30%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLN-SVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYK-EFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKS-----FEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSA--KIEIIIKDQNDNAPTL---TYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEK---SAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLR----SKNPAMLPFVILKKANRIF--------HLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIII 2232
            P+F+ + I+ +ISE    G   +L  A D D G N +++Y ++ ++      HF L V++  + S  VE+ +  PLDRET +++   L A DGG   Q+TG++ I + +ID NDN P FS P+Y+    +   N   ++R+SATD D+G NG+I Y F    ++    LD F I  D+GEI +K  LDYE+   F+  + A +          T ++ V I + +V D P  I++   +N    I E+      +A++ V   ++     ++C +             D  +KVKS     + + T+Q +DREKI + +  +    + D   PS S    + + I D NDNAP     +Y  T  I+EN  PG  V  + A D+D G N R+++ +E    +   +  ++S+    G I      D E    Q    +I V A D G  P S+++ + I IQD NDN P+     +++ +       S V EI     DV   +  V+     S   A L + + K  +R           + T R +  +   K    V+  D+ G P+ S T  V+V V    D+FP ++
Sbjct:  140 PVFDRKEIDFQISELALPGARFSLDSAQDLDTGTNALKSYTLNPKD------HFDLKVMSRNDGSKYVEMVLQAPLDRETQHEHKLTLTAFDGGNP-QRTGTVRICVTVIDANDNAPVFSLPVYRVSLFENAPNGAVVVRVSATDNDQGANGEITYSFS---RSSGKNLDLFHIGPDTGEITVKGHLDYERAKQFELNIDATDKGG------LTDSSKVIIDITDVNDNPPVISLISFSNP---IPEDAAPETVIAMLNVKDLDSGKNGQVKCYI-----------SADMPFKVKSSAQNFYSLITDQLLDREKISEYNITV---TATDEGSPSFSTNKTLTLKISDVNDNAPVFERQSY--TAFIIENNSPGVSVLSVKAHDRDSGNNARISYFLEDVVVNGVSASTFISVNAESGEILAARSFDYE----QTKDFSIRVKAQDGGSPPLSSNVSVKILIQDQNDNAPQ-----VLYPVQSG---ASVVAEIVPRSADVGYLVTKVVAVDVDSGQNAWLSYKLHKATDRALFEVGAQNGEIRTVRQVTDKDAVKQRLTVVVEDN-GQPSRSATVNVNVAVA---DSFPEVL 680          

HSP 2 Score: 120.939 bits (302), Expect = 3.275e-27
Identity = 161/588 (27.38%), Postives = 256/588 (43.54%), Query Frame = 1
Query:  847 IAIRIIDENDNMPQF-SSPIYKEFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSG--EIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSI-VEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEI---LSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAP--TLTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKS--------IIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINL------VLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRN----YKFMTVSANDQDQTSEFNTIEYHLESESD--VFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVI 2523
            I + I+D ND+ P F    I  +  +  L   R    SA D D G N    Y  +P+       L   S N+ S   E+ L+ PLD E Q   K  + A +   P      T T  + ++V++  D     N    +   Y + + EN  N  V +V V++ +ND   + +      +     L L   G ++      EI     +D E+  +   NI   ++ D    + S+K+ I I D NDN P  +L  F  P I E+  P TV+  +  +D D G+NG+V             Y+S    D   KVKS        I D      + +   I VTATD G    ST+  +++ I DVNDN P F        I+ENN     V  ++  D+D  ++  +      V+ +   A     +  ++  I      RS D E+   F+ +V A D  G+P  S   +V + + DQNDN P +++P Q+ A+  V++ + PR+    Y    V A D D + +   + Y L   +D  +F++  Q G I T R++   D  +  + + V + G  S  ++V VNV +
Sbjct:  128 IDVEILDINDHAPVFDRKEIDFQISELALPGARFSLDSAQDLDTGTNALKSYTLNPK---DHFDLKVMSRNDGSKYVEMVLQAPLDRETQHEHKLTLTAFDGGNP----QRTGTVRICVTVIDAND-----NAPVFSLPVYRVSLFENAPNGAV-VVRVSATDNDQGANGEITYSFSRSSGKNLDLFHIGPDT-----GEITVKGHLDYERAKQFELNI---DATDKGGLTDSSKVIIDITDVNDNPPVISLISFSNP-IPEDAAPETVIAMLNVKDLDSGKNGQVKC-----------YIS---ADMPFKVKSSAQNFYSLITDQLLDREKISEYNITVTATDEGSPSFSTNKTLTLKISDVNDNAPVFERQSYTAFIIENNSPGVSVLSVKAHDRDSGNNARISYFLEDVVVNGVSASTFISVNAESGEIL---AARSFDYEQTKDFSIRVKAQDG-GSPPLSSNVSVKILIQDQNDNAPQVLYPVQSGAS--VVAEIVPRSADVGYLVTKVVAVDVD-SGQNAWLSYKLHKATDRALFEVGAQNGEIRTVRQVTDKDAVKQRLTVVVEDNGQPSRSATVNVNVAV 672          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 182.956 bits (463), Expect = 2.162e-46
Identity = 186/703 (26.46%), Postives = 319/703 (45.38%), Query Frame = 1
Query:  589 IGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYK-EFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLN-----NKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEH---FQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVP--SSSAKIEIIIKDQNDNAPTLTYFGTPSI-----LENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESD----------VFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRIENFNINNGGLMAHNSFSTSE 2619
            +G    +PVATD+D G+N +  Y ++     T  N F L V    +    +L V   LDRE  + Y  ++  +DGG   +++ ++ + I I D NDN+P+F    Y+ E  +       +L++ A D D G NG++ Y      +  + ++   SI+ ++G I++K  +D E+ +  KF V A +  P       +S A V I+V +  D    I +  +      +   +I E+      VA+V V+ ++      + C +     FQ  L   S+     K K F ++T   +D E+I +    I+    VDS  P  SS+  +++ + D NDNAP  +    P++      E  +PG  V  ++A D D G N  +T+S+   + P      I    G ++V S +D E    Q      +V A D G+        + + + D NDN PKF  +   F++ EN    S VG + V D D  ++  + L S  P    F+I    N  + + +T S DREK+  ++F++ A D  G+P  S    + + V+D+NDN P +  P+ ++       +L+PR       S     ++ E   I+  L SE D          +F I   EG I   +E     IG H + + V + G    +++  V++ ++ +    N   +E       GL+ H+ ++  E
Sbjct:  174 VGALFAIPVATDRDSGSNGIADYALTTGPEAT--NLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSAL-LRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSL---HQPSSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSK----SSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQ--LRSASETGNDRKRKYF-LQTTTLLDYERIKEYRIEIVA---VDSGNPALSSTNSLKVQVTDMNDNAPVFS----PTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPE-GLFEINPNTGEVRVMSQLDRE----QLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQL-SVEPDNGKFMI---QNGTYTILSTISFDREKESTYSFRLKAVDG-GDPPRSSYVGITINVLDENDNAPYVTKPANSS-----YKFLDPR------TSPETHVESVEAEDIDIGLNSELDFNIVGGNPHGLFRI-SSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNETIG--NVSHVE-------GLVGHSLYTPLE 825          

HSP 2 Score: 100.523 bits (249), Expect = 6.907e-21
Identity = 140/543 (25.78%), Postives = 228/543 (41.99%), Query Frame = 1
Query:  853 IRIIDENDNMPQFSSPIYKEFVKEGLNSVRILRLS-ATDPDEGINGKIIYKFDPRFKTGALILDYFSIN--EDSGE----IYLKKPLDYEKQTFFKFPVIAVN-PTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQ---EILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYF---------GTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSL--AQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFT 2415
            I I+DENDN PQFSSP+    + E  +   +  +  ATD D G NG   Y       TG    + FS+   +DS E    + +   LD E +  +   +  V+  +PP       S+A + I++ +  D     NV      +Y       S    +++ V + ++D+  + +      Q    ++ L+S  D +  +    I     +DRE+I  +   +  K++      SS A + I +KDQNDNAP++            G  +I E+   GT V  +   D+DEGEN  VT  +        +  S  ET    K K  +   + L   +     I + A D G    S+   + + + D+NDN P F+ +       E N     V ++   D D   +  L   S     +P  + +       +     LDRE+   + F V A D  G P+   T TV V+V+D+NDN P  +    N  +  V   + P +   M V+ ND D+  E   ++  +E ++  F I     TI +
Sbjct:  147 IEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYA----LTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPP-----RQSSALLRITITDAND-----NVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSI-DRNTGI----IFVKGSVDREEISILKFYVQAKDN-GPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDV--PFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTY-SITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADK-GVPSLRGTATVVVKVLDRNDNDPKFML---NGYSFSVQENMPPLSPVGM-VTVNDHDE-GENARVQLSVEPDNGKFMIQNGTYTILS 660          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 182.57 bits (462), Expect = 2.794e-46
Identity = 186/703 (26.46%), Postives = 320/703 (45.52%), Query Frame = 1
Query:  589 IGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYK-EFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLN-----NKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEH---FQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVP--SSSAKIEIIIKDQNDNAPTLTYFGTPSI-----LENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESD----------VFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRIENFNINNGGLMAHNSFSTSE 2619
            +G    +PVATD+D G+N +  Y ++     T  N F L V    +    +L V   LDRE  + Y  ++  +DGG   +++ ++ + I I D NDN+P+F    Y+ E  +       +L++ A D D G NG++ Y      +  + ++   SI+ ++G I++K  +D E+ +  KF V A +  P       +S A V I+V +  D    I +  +      +   +I E+      VA+V V+ ++      + C +     FQ  L   S+     K K F ++T   +D E+I +    I+   +VDS  P  SS+  +++ + D NDNAP  +    P++      E  +PG  V  ++A D D G N  +T+S+   + P      I    G ++V S +D E    Q      +V A D G+        + + + D NDN PKF  +   F++ EN    S VG + V D D  ++  + L S  P    F+I    N  + + +T S DREK+  ++F++ A D  G+P  S    + + V+D+NDN P +  P+ ++       +L+PR       S     ++ E   I+  L SE D          +F I   EG I   +E     IG H + + V + G    +++  V++ ++ +    N   +E       GL+ H+ ++  E
Sbjct:  169 VGALFAIPVATDRDSGSNGIADYALTTGPEAT--NLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSAL-LRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSL---HQPSSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSK----SSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQ--LRSASETGNDRKRKYF-LQTTTLLDYERIKEYRIEIV---AVDSGNPALSSTNSLKVQVTDMNDNAPVFS----PTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPE-GLFEINPNTGEVRVMSQLDRE----QLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQL-SVEPDNGKFMI---QNGTYTILSTISFDREKESTYSFRLKAVDG-GDPPRSSYVGITINVLDENDNAPYVTKPANSS-----YKFLDPR------TSPETHVESVEAEDIDIGLNSELDFNIVGGNPHGLFRI-SSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNETIG--NVSHVE-------GLVGHSLYTPLE 820          

HSP 2 Score: 100.138 bits (248), Expect = 9.100e-21
Identity = 140/543 (25.78%), Postives = 228/543 (41.99%), Query Frame = 1
Query:  853 IRIIDENDNMPQFSSPIYKEFVKEGLNSVRILRLS-ATDPDEGINGKIIYKFDPRFKTGALILDYFSIN--EDSGE----IYLKKPLDYEKQTFFKFPVIAVN-PTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQ---EILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYF---------GTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSL--AQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFT 2415
            I I+DENDN PQFSSP+    + E  +   +  +  ATD D G NG   Y       TG    + FS+   +DS E    + +   LD E +  +   +  V+  +PP       S+A + I++ +  D     NV      +Y       S    +++ V + ++D+  + +      Q    ++ L+S  D +  +    I     +DRE+I  +   +  K++      SS A + I +KDQNDNAP++            G  +I E+   GT V  +   D+DEGEN  VT  +        +  S  ET    K K  +   + L   +     I + A D G    S+   + + + D+NDN P F+ +       E N     V ++   D D   +  L   S     +P  + +       +     LDRE+   + F V A D  G P+   T TV V+V+D+NDN P  +    N  +  V   + P +   M V+ ND D+  E   ++  +E ++  F I     TI +
Sbjct:  142 IEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYA----LTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPP-----RQSSALLRITITDAND-----NVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSI-DRNTGI----IFVKGSVDREEISILKFYVQAKDN-GPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDV--PFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTY-SITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADK-GVPSLRGTATVVVKVLDRNDNDPKFML---NGYSFSVQENMPPLSPVGM-VTVNDHDE-GENARVQLSVEPDNGKFMIQNGTYTILS 655          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 182.57 bits (462), Expect = 3.045e-46
Identity = 186/703 (26.46%), Postives = 319/703 (45.38%), Query Frame = 1
Query:  589 IGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYK-EFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLN-----NKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEH---FQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVP--SSSAKIEIIIKDQNDNAPTLTYFGTPSI-----LENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESD----------VFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRIENFNINNGGLMAHNSFSTSE 2619
            +G    +PVATD+D G+N +  Y ++     T  N F L V    +    +L V   LDRE  + Y  ++  +DGG   +++ ++ + I I D NDN+P+F    Y+ E  +       +L++ A D D G NG++ Y      +  + ++   SI+ ++G I++K  +D E+ +  KF V A +  P       +S A V I+V +  D    I +  +      +   +I E+      VA+V V+ ++      + C +     FQ  L   S+     K K F ++T   +D E+I +    I+    VDS  P  SS+  +++ + D NDNAP  +    P++      E  +PG  V  ++A D D G N  +T+S+   + P      I    G ++V S +D E    Q      +V A D G+        + + + D NDN PKF  +   F++ EN    S VG + V D D  ++  + L S  P    F+I    N  + + +T S DREK+  ++F++ A D  G+P  S    + + V+D+NDN P +  P+ ++       +L+PR       S     ++ E   I+  L SE D          +F I   EG I   +E     IG H + + V + G    +++  V++ ++ +    N   +E       GL+ H+ ++  E
Sbjct:  179 VGALFAIPVATDRDSGSNGIADYALTTGPEAT--NLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSAL-LRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSL---HQPSSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSK----SSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQ--LRSASETGNDRKRKYF-LQTTTLLDYERIKEYRIEIVA---VDSGNPALSSTNSLKVQVTDMNDNAPVFS----PTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPE-GLFEINPNTGEVRVMSQLDRE----QLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQL-SVEPDNGKFMI---QNGTYTILSTISFDREKESTYSFRLKAVDG-GDPPRSSYVGITINVLDENDNAPYVTKPANSS-----YKFLDPR------TSPETHVESVEAEDIDIGLNSELDFNIVGGNPHGLFRI-SSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNETIG--NVSHVE-------GLVGHSLYTPLE 830          

HSP 2 Score: 100.138 bits (248), Expect = 8.945e-21
Identity = 140/543 (25.78%), Postives = 228/543 (41.99%), Query Frame = 1
Query:  853 IRIIDENDNMPQFSSPIYKEFVKEGLNSVRILRLS-ATDPDEGINGKIIYKFDPRFKTGALILDYFSIN--EDSGE----IYLKKPLDYEKQTFFKFPVIAVN-PTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQ---EILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYF---------GTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSL--AQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFT 2415
            I I+DENDN PQFSSP+    + E  +   +  +  ATD D G NG   Y       TG    + FS+   +DS E    + +   LD E +  +   +  V+  +PP       S+A + I++ +  D     NV      +Y       S    +++ V + ++D+  + +      Q    ++ L+S  D +  +    I     +DRE+I  +   +  K++      SS A + I +KDQNDNAP++            G  +I E+   GT V  +   D+DEGEN  VT  +        +  S  ET    K K  +   + L   +     I + A D G    S+   + + + D+NDN P F+ +       E N     V ++   D D   +  L   S     +P  + +       +     LDRE+   + F V A D  G P+   T TV V+V+D+NDN P  +    N  +  V   + P +   M V+ ND D+  E   ++  +E ++  F I     TI +
Sbjct:  152 IEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYA----LTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPP-----RQSSALLRITITDAND-----NVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSI-DRNTGI----IFVKGSVDREEISILKFYVQAKDN-GPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDV--PFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTY-SITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADK-GVPSLRGTATVVVKVLDRNDNDPKFML---NGYSFSVQENMPPLSPVGM-VTVNDHDE-GENARVQLSVEPDNGKFMIQNGTYTILS 665          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: ENSXETT00000027070.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:19099783:19110965:-1 gene:ENSXETG00000013163.1 transcript:ENSXETT00000027070.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 185.267 bits (469), Expect = 2.819e-47
Identity = 192/682 (28.15%), Postives = 309/682 (45.31%), Query Frame = 1
Query:  589 IGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTV----TSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFG-TPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAF---PSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDD---INLVLRS--KNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHV---ISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESD--VFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRIENFNIN 2577
            +G    L  A D D GNN +++YK+S       D    L  +NT      EL + K LDRE  N     L A DGG T  KTG+  I I + D NDN P F+   Y+  V E +     ++ L ATD DEG N +I Y F+   +      + F+IN ++G + +   LDYE  T ++  V A +    V      S   + I V +V D   +I +   ++    I E+++    +A+V +    + +  ++   I   L        LIS     YK     + T+ ++DREK  + +  I  ++     + ++S  I +I+ D NDNAP          I EN   G   +++ A D D  ENG+V + +        P   Y+SI    GV+  +   D E  L +F      + A D G    + +  I + + DVNDN P F     +  I ENN   S    +   D D++++   + ++L    ++  +  ++ +   + + +    RS D E   +F  QV+A DS G+P+ S   TV + + DQNDN P I++PSQ++    V   I +   + Y    V A D D +     + YHL    D     I +  G I   R++ ++D     I + V + GY  + S+V +N+V+ A   +   P I N +I+
Sbjct:  151 VGTHFALGSAKDPDLGNNSIQSYKLSAN-----DYFGMLEKVNTDGRKYPELVLEKTLDREKKNSSVLILSAFDGG-TPSKTGTSLIRIVVTDINDNYPLFNKDTYRVTVSENVPIGFLVIDLHATDADEGSNAEITYLFNDIPENAQ---EVFAINPENGSVQITGKLDYEVATNYEMTVEAKDGGGLV------SYCKLLIQVSDVNDNAPDILITSFSDI---IPEDSRVGTVIALVNLDDLDSGENGEVVGQISESLP-----FHLISSSGNYYK-----LVTSMDLDREKTSEYNITIKAEDKGSPQL-TNSKTIRLILTDVNDNAPVFDKMDYVAYIQENNPSGNSFYRVHATDPDINENGKVVYMILTDIIEDIPISSYVSINTVSGVLYAQRSFDYEK-LREF-----YIQAEDKGSPQLTNNKTIRLILTDVNDNAPVFEKMDYVAYIQENNPSGSSFFRVHATDSDINENGKVVYMILTDIIEDMPLSSYISINTVSGVLY--AQRSFDYESLREFYIQVMAKDS-GSPSRSANATVKICITDQNDNAPKILYPSQDSEAASVFEFIPHFSTKGYLVTKVVAVDAD-SGHNAWLSYHLLQVPDPSFLIIGQNTGEIRITRDLQETDALRQRIVVMVKDNGYPMLSSTVTLNLVV-AENFQQVLPEITNQHID 792          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: vapa (VAMP associated protein A [Source:Xenbase;Acc:XB-GENE-990155])

HSP 1 Score: 181.8 bits (460), Expect = 5.732e-46
Identity = 180/645 (27.91%), Postives = 300/645 (46.51%), Query Frame = 1
Query:  607 LPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTV-ELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVN--PTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLN---NKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPS--SSAKIEIIIKDQNDNAPTLTYFGTP----SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLR----SKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESD--VFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGY 2484
            +P A D D G N V+ Y++   +     + F L+++ T       +L V + LDRE  + Y   +   DGG T QK+ +  + + + D NDN P F     +  + E       +++L ATD D G N +I Y F  +  +    L  F++N  +G I +++PLD E+    K  V+A +   TP        + A+V I+V +V D P  I++ Y+    N    + E++  N  +A++TV+ K+ D+   + C +E  +    L +  D  Y      + T+  +D E I + S  I+   + D+  PS   +A + + ++D+NDN P    F  P    S+ EN + G  +  + A D+D G+N  + + +     P+  +  +    GV+    + D E            VTA D+G  P  +   + +T+ D NDN PKFT +H  F + EN  K S VG I   D D  ++  + L     ++N  + P+  L K+N         S DRE+   + F V A D  G P  S T  V + ++D NDN P++I P  N +   V     P +     V A D D T     ++Y + S ++  +F ID   G I    + + +D+G H + + + + GY
Sbjct:  163 IPSAVDPDTGFNGVQHYELLNGQ-----SVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGG-TPQKSSTAILQVTVSDVNDNKPVFKESQVEVHIPENAPIGTSVVQLHATDADIGSNAEIKYIFGAQVTSATKRL--FALNNTTGLITVQRPLDREETAVHKLTVLATDGSSTP--------ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPINTKIALITVSDKDTDVNSKVICFIER-EVPFHLKAVYDNQYL-----LETSSLLDYEGIKEFSFKIV---AADTGKPSLNQTALVRVELEDENDNPP---IFSQPVIELSVSENNRRGLYLTTVSASDEDSGKNSDIVYQLG----PNASFFDLDRKTGVLTASRVFDREEQ----ERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITATDSDAGENKAVTLSILNDNENFVLDPYSGLIKSN--------VSFDREQQSSYTFDVKAVDG-GQPPRSSTAKVTINIMDANDNSPVVISPPSNTSFKLVPLSAIPGSV-VAEVFAVDTD-TGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPSAADVGLHRLVVNISDLGY 760          

HSP 2 Score: 102.449 bits (254), Expect = 2.652e-21
Identity = 108/389 (27.76%), Postives = 176/389 (45.24%), Query Frame = 1
Query: 1438 QEIDREKIPKISTNILCKESVDSHVP--SSSAKIEIIIKDQNDNAPTLTYFGTP-SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYL-SIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTI------MENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFP------SQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPR 2556
            Q +DRE+     T ++  +  D   P  SS+A +++ + D NDN P          I EN   GT V ++ A D D G N  + +        + + L ++  T G+I V+  +D E +        + V ATD    P    + I++T  DVNDN P     ++I  I       E +  N+ +  I V DKD   D+N  +       +PF +    +  + L T+  LD E   +F+F+++A D+ G P+ + T  V VE+ D+NDN PI   P      S+NN           R     TVSA+D+D + + + I Y L   +  FD+DR+ G +   R   + +    +  +T  + G   ++S  Q  V++       NSP+
Sbjct:  208 QNLDREQK---DTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNKPVFKESQVEVHIPENAPIGTSVVQLHATDADIGSNAEIKYIFGAQVTSATKRLFALNNTTGLITVQRPLDREETAVH----KLTVLATDGSSTPARATVTINVT--DVNDNPPNIDLRYIISPINGTVYLSEKDPINTKIALITVSDKDT--DVNSKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGIKEFSFKIVAADT-GKPSLNQTALVRVELEDENDNPPIFSQPVIELSVSENNR----------RGLYLTTVSASDED-SGKNSDIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQS--QAAVIVTVLDENDNSPK 571          

HSP 3 Score: 90.1225 bits (222), Expect = 1.613e-17
Identity = 127/500 (25.40%), Postives = 211/500 (42.20%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFS-----SPIYKEFV---KEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLT-----YFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTS--SHMIFTIME-NNMKNSFVGEIEVEDKD 1989
            P+F E  +E+ I E+  IG ++    ATD D G+N    Y    Q        F LN  NT   +TV+    +PLDRE T  +   ++A DG  T  +     + I + D NDN P        SPI        K+ +N+ +I  ++ +D D  +N K+I      F    +     ++ ++   +     LDYE    F F ++A +   P        TA V + + +  D P   +   +     S+ E N+   ++  V+ + +++     I  +L        L          K+  +  ++  DRE+  +    +  +++    + S +A I + + D+NDN+P  T     +F    + EN    + V  I A D D GEN  VT S+        E   +    G+IK     D E    Q ++ T  V A D G  P+S+  +++I I D NDN P   S  S+  F ++  + +  S V E+   D D
Sbjct:  250 PVFKESQVEVHIPENAPIGTSVVQLHATDADIGSNAEIKYIFGAQVTSATKRLFALN--NTTGLITVQ----RPLDREETAVHKLTVLATDGSSTPARA---TVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPINT-KIALITVSDKDTDVNSKVIC-----FIEREVPFHLKAVYDNQYLLETSSLLDYEGIKEFSFKIVAADTGKPS----LNQTALVRVELEDENDNPPIFSQPVI---ELSVSENNRRGLYLTTVSASDEDSGKNSDIVYQLGPNASFFDL--------DRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVI-VTVLDENDNSPKFTHNHFQFF----VSENLPKYSTVGVITATDSDAGENKAVTLSILNDN----ENFVLDPYSGLIKSNVSFDRE----QQSSYTFDVKAVDGGQPPRSSTAKVTINIMDANDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDTD 706          

HSP 4 Score: 73.9442 bits (180), Expect = 1.336e-12
Identity = 105/354 (29.66%), Postives = 152/354 (42.94%), Query Frame = 1
Query: 1372 ILSLISKGDESYKVK----SFEI-RTNQEIDREKIPKISTNILCKESVDSH------------VPS---SSAKIEIIIKDQNDNAPTL-TYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGET-DGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDV--HDDINLVLRSKNPAMLPFVILKKANRIFHLNTT-------RSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFP-----IIIFPSQNNATVHVISYLEPRNYKFMTVSANDQD 2325
            +  L+SK  +S  VK    + EI  T+  IDREK        LC  S +S             +P+      KI+II+KD NDNAP   +     SI ENT   +      A D D G NG   + +      S+  L I ET +G    + I+       Q  T  + +   D G   KS+   + +T+ DVNDN P F  S +   I EN    + V ++   D D+  + +I  +  ++        +     R+F LN T       R LDRE+       V+ATD    P  +   TV + V D NDN P      II P   N TV+ +S  +P N K   ++ +D+D
Sbjct:   63 VYRLVSKAGDSPLVKVSSSTGEIFTTSTRIDREK--------LCAGSSNSDENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSTVINISIPENTLINSRFPIPSAVDPDTGFNGVQHYELLNGQ--SVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNKPVFKESQVEVHIPENAPIGTSVVQLHATDADIGSNAEIKYIFGAQ--------VTSATKRLFALNNTTGLITVQRPLDREETAVHKLTVLATDGSSTPARA---TVTINVTDVNDNPPNIDLRYIISPI--NGTVY-LSEKDPINTKIALITVSDKD 392          

HSP 5 Score: 73.559 bits (179), Expect = 1.571e-12
Identity = 127/582 (21.82%), Postives = 240/582 (41.24%), Query Frame = 1
Query:  841 INIAIRIIDENDNMPQFSSPIYKEFVKEG-LNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPT--LTYF-----GTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNV-VIDASTAKSNSPRI 2559
            I I I + D NDN P F S +    + E  L + R    SA DPD G NG   Y+         L +      E   ++ +++ LD E++  +   +   +   P      +STA ++++V +V D     N          +     +    ++V + + + D+  + + +     ++ S  +K   +    +  I   + +DRE+       +L   + D     + A + I + D NDN P   L Y      GT  + E     T +  I   DKD   N +V   +E+         ++ +   +++  S++D E  + +F   +  + A D G    +    + + ++D NDN P F+   +  ++ ENN +  ++  +   D+D   + ++V +    A   F  L +   +  L  +R  DRE+  +F F V A D+ G P       V V V+D+NDN P     + N+    V   L P+      ++A D D   E   +   + ++++ F +D   G I +     +     +   +   + G     S+ +V + ++DA+    NSP +
Sbjct:  126 IKIKIIVKDTNDNAPMFPSTVINISIPENTLINSRFPIPSAVDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQK----SSTAILQVTVSDVND-----NKPVFKESQVEVHIPENAPIGTSVVQLHATDADIGSNAEIKYIFGAQVTS-ATKRLFALNNTTGLITVQRPLDREETAVHKLTVL---ATDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPINTKIALITVSDKDTDVNSKVICFIEREV--PFHLKAVYDNQYLLETSSLLDYE-GIKEF---SFKIVAADTGKPSLNQTALVRVELEDENDNPPIFSQPVIELSVSENNRRGLYLTTVSASDEDSGKNSDIVYQLGPNAS--FFDLDRKTGV--LTASRVFDREEQERFIFTVTARDN-GTPPLQSQAAVIVTVLDENDNSPKF---THNHFQFFVSENL-PKYSTVGVITATDSD-AGENKAVTLSILNDNENFVLDPYSGLIKSNVSFDREQQSSYTFDVKAVDGGQPPRSSTAKVTINIMDAN---DNSPVV 675          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: ENSXETT00000039600.1 (protocadherin alpha 5 [Source:NCBI gene;Acc:100125046])

HSP 1 Score: 173.326 bits (438), Expect = 8.468e-44
Identity = 180/658 (27.36%), Postives = 303/658 (46.05%), Query Frame = 1
Query:  313 LKSSKAHSYFTI--KNDNLFTNTLVDMDSMCQNVGECCNKAKEICDFSIAIACRENQESEVXXXXXXXXXXXXXXXYPIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLN-TLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYK-EFVKEGLNSVRILRLSATDPDEGINGKIIYKFD----PRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSA--KIEIIIKDQNDNAPTLTYFG-TPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKS---AFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPK----FTSSHMIFTIM--ENNMKNSFVGEIEVEDKDVHDDINLVLRSKN-PAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFP 2223
            + S     YF +  KN  LF N ++D +++C  +  C  + + I D  + I   + +  ++            NDNYPIF  +  ++ I+ES   G    L  A D D G N V  Y++S       +++F L+V + T  S +V+L + K LDRE    ++  L+A DGG+  +  GS  + I + D NDN P F   IY+   ++  L    +++++ATD DEG NGK+ Y F+    P+ ++       F+I E +G I     +DYEK++ ++  V A++  P            V +++++V D P E+ V  L   N  + E++ +   VA+++V  +++D    + C +   + I   IS     Y    + +  +  +DRE+  +   +I    + D   P+ S    I++ I D NDN P+        S+ EN  PG+ V+ + A D D G+N  +T+S+  S     P   Y+S+   +G I      D E    Q       + ATD G+ P S++L + I I+D+NDN P     F+SS    T M   +  K   V +I+  D D   +  +    KN P   PF I      I  + +    D ++   F    +     G+P  S   T+ + ++D     P
Sbjct:   67 ISSKDGSDYFQVNLKNGILFVNRMIDREALCPEISVCIVQLEVIVDKPVQIHHVDVEIEDI------------NDNYPIFPAKEYKLLIAESRLPGSNFPLEGAVDSDVGTNSVTVYELSS------NDNFALDVQSYTHESKSVQLVLKKSLDREQIPFHNITLIAFDGGKP-KLNGSAQLLITVQDVNDNAPVFEQSIYRASLLENALVGTFVIKVNATDLDEGENGKLKYSFNKLVPPQTRS------VFNIEEHTGIIRSFGEVDYEKKSLYEIEVDAIDKGP----YAIAGHCKVIVNIVDVNDNPPEMTVTSL---NVPVPEDSPTGTVVAVISVHDRDSDQNGKVTCHIS--KNIPFKISPTLREY----YSLTVDGPLDRERTSEYELDI---TATDGGAPALSVTKSIKVQISDVNDNPPSFQKSSEIISVKENNPPGSHVYTVSASDSDTGQNSFITYSLSASFLDGIPISSYISVNPENGKIFALLSFDHE----QVCYFQCQIIATDAGLPPMSSNLTLHIFIEDINDNAPSALAPFSSSESAVTEMVPRSFKKGQVVTKIKAIDPDSGYNAWISYEVKNLPRNSPFSIGHHTGEITIMRSFIDSDSDQHKLF----VELKDHGDPQMSAMVTLIILLVDPEHELP 675          

HSP 2 Score: 104.375 bits (259), Expect = 4.445e-22
Identity = 157/586 (26.79%), Postives = 254/586 (43.34%), Query Frame = 1
Query:  844 NIAIRIIDENDNMPQFSSPIYKEFVKEG-LNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNY--SIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEH-FQEILSLISKGDESYKVKSFEIRTNQEIDREK--IPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAP--TLTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSA----FPSL-EYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDD--INLVLRSKNPAMLPFVILKKAN----RIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYK----FMTVSANDQDQTSEFNT-IEYHLES--ESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVI 2523
            ++ + I D NDN P F +  YK  + E  L         A D D G N   +Y+        AL +  ++    S ++ LKK LD E+  F    +IA +   P        +A + I+V +V D     N        Y  S++E      FV  V  T    DL      +L++ F +++   ++   + +  +  IR+  E+D EK  + +I  + + K     +  +   K+ + I D NDN P  T+T    P + E++  GTVV  I   D+D  +NG+VT  + K+      P+L EY S+   DG +  +   + E          + +TATD G    S    I + I DVNDN P F  S  I ++ ENN   S V  +   D D   +  I   L +     +P       N    +IF L    S D E+   F  Q+IATD+ G P  S   T+ + + D NDN P  + P  ++ +   ++ + PR++K       + A D D  S +N  I Y +++   +  F I    G I   R    SD  +H + + + + G   M + V + +++
Sbjct:  119 HVDVEIEDINDNYPIFPAKEYKLLIAESRLPGSNFPLEGAVDSDVGTNSVTVYELSSN-DNFALDVQSYTHESKSVQLVLKKSLDREQIPFHNITLIAFDGGKP----KLNGSAQLLITVQDVND-----NAPVFEQSIYRASLLENALVGTFVIKVNAT----DLDEGENGKLKYSFNKLVPPQTRSVFNIEEHTGIIRSFGEVDYEKKSLYEIEVDAIDK---GPYAIAGHCKVIVNIVDVNDNPPEMTVTSLNVP-VPEDSPTGTVVAVISVHDRDSDQNGKVTCHISKNIPFKISPTLREYYSL-TVDGPLDRERTSEYE----------LDITATDGGAPALSVTKSIKVQISDVNDNPPSFQKSSEIISVKENNPPGSHVYTVSASDSDTGQNSFITYSLSASFLDGIPISSYISVNPENGKIFAL---LSFDHEQVCYFQCQIIATDA-GLPPMSSNLTLHIFIEDINDNAPSALAPFSSSES--AVTEMVPRSFKKGQVVTKIKAIDPD--SGYNAWISYEVKNLPRNSPFSIGHHTGEITIMRSFIDSDSDQHKLFVELKDHGDPQMSAMVTLIILL 667          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: atp5pd (ATP synthase peripheral stalk subunit d [Source:Xenbase;Acc:XB-GENE-993879])

HSP 1 Score: 172.94 bits (437), Expect = 1.658e-43
Identity = 177/660 (26.82%), Postives = 310/660 (46.97%), Query Frame = 1
Query:  319 SSKAHSYFTI--KNDNLFTNTLVDMDSMCQNVGECCNKAKEICDFSIAIACRENQESEVXXXXXXXXXXXXXXXYPIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLN-TLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYK-EFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKS-----FEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSA--KIEIIIKDQNDNAPTLTYFGTPSIL--ENTKPGTVVFKIIAQDKDEGENGRVTFSMEKS---AFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPK----FTSSHMIFTIM--ENNMKNSFVGEIEVEDKDVHDDINLVLRSKN-PAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPII 2229
            S     YF +  +N  +F N ++D + +C  +  C  + + I D  + I   + +  ++               +PIF+    +++ISE  + G  + L  A D D G N V  Y++S       +++F L+V + T  S +V+L + KPLDRE    ++  L+A DGG+  + +G+  + I + D NDN P F+  IY+   ++  L    +++++ATD DEG N K+ Y F+         +  FSI E++G I +   +D+EK+  ++  V A++      +        V ++VL+V D P E+++  L   N  + E++K    VAI+ V  K++     ++C++             +  +K+ S     + +  +  +D E I + + +I+   ++D   PS S    I+I I D NDN P+  + G  +I   EN  PG+ V+ + A D D G+N  +T+S+  S     P   Y+SI   +G I      D E    Q       + ATD G+   S++L + I I+D+NDN P     F S+    T M   ++     V +I+  D D   +  +  + K+ P   PF I ++   I     TRSL  + D +F   V+A D  G P  +    + +   D  ++  I+
Sbjct:   67 SKDGSEYFQVNLQNGIIFVNRVIDREMLCPEISICIVQLEVILDKPVQIHHVDVEIEDINDN------------FPIFSSTEFKLQISEMRQSGSRLPLEGAVDADIGTNSVTGYELS------LNDYFSLDVQSYTHESKSVQLVLRKPLDREQIPLHNITLIAFDGGKP-KLSGTTQLLITVQDINDNAPVFNEEIYRASLLENALKGTIVIKVNATDLDEGENSKLTYAFNRLVPQHVRTI--FSIEENTGIIRVVGEVDFEKKNLYEIEVNAIDRGHRAMV----GHCKVLVNVLDVNDNPPEMSITSL---NLPVSEDSKVGTVVAIINVHDKDSGQNGKVKCQI-----------STNVPFKIASTLREYYSLIVDGPLDHESISEYNFDII---AIDEGFPSLSVTKSIKIQISDVNDNRPSF-HQGAETIFIKENNPPGSHVYTVTASDADTGQNSFITYSLSDSSIDGIPMSSYISINPENGKIYALMSFDHE----QIIYFQCQIIATDAGLPHLSSNLTLHIFIEDINDNAPSALAPFYSTEPAVTEMVPRSSKVGQLVTKIKAVDPDSGYNAWISYKLKDLPRNSPFSIGRQNGEII---ITRSL-MDSDDEFRLFVVAEDH-GEPAMTALTQIIISFKDSGEDTQIV 674          

HSP 2 Score: 97.0561 bits (240), Expect = 9.627e-20
Identity = 157/567 (27.69%), Postives = 232/567 (40.92%), Query Frame = 1
Query:  844 NIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVRILRL-SATDPDEGINGKIIYKFDPRFKTGALILDYFSIN-------EDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNY--SIVEENKSNFFVAIVTVT---SKENDLFRSIQCRL--EHFQEILSLISKGDESYKVKSFEIRTNQEIDREK--IPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAP--TLTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSME-----KSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDD--INLVLRSKNPAMLP---FVILKKAN-RIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKF--MTVSANDQDQTSEFNT-IEYHLES--ESDVFDIDRQEGTIFTRREMAKSD 2439
            ++ + I D NDN P FSS  +K  + E   S   L L  A D D G N    Y+          + DYFS++         S ++ L+KPLD E+       +IA +   P      + T  + I+V ++ D     N    N + Y  S++E       V  V  T     EN        RL  +H + I S+    +E+  +    IR   E+D EK  + +I  N + +            K+ + + D NDN P  ++T    P + E++K GTVV  I   DKD G+NG+V   +      K A    EY S+           I+D        +     + A D G    S    I I I DVNDN P F        I ENN   S V  +   D D   +  I   L   +   +P   ++ +   N +I+ L    S D E+   F  Q+IATD+ G P  S   T+ + + D NDN P  + P    +T   ++ + PR+ K   +       D  S +N  I Y L+    +  F I RQ G I   R +  SD
Sbjct:  117 HVDVEIEDINDNFPIFSSTEFKLQISEMRQSGSRLPLEGAVDADIGTNSVTGYELS--------LNDYFSLDVQSYTHESKSVQLVLRKPLDREQIPLHNITLIAFDGGKPK----LSGTTQLLITVQDIND-----NAPVFNEEIYRASLLENALKGTIVIKVNATDLDEGENSKLTYAFNRLVPQHVRTIFSI----EENTGI----IRVVGEVDFEKKNLYEIEVNAIDR---GHRAMVGHCKVLVNVLDVNDNPPEMSITSLNLP-VSEDSKVGTVVAIINVHDKDSGQNGKVKCQISTNVPFKIASTLREYYSL-----------IVDGPLDHESISEYNFDIIAIDEGFPSLSVTKSIKIQISDVNDNRPSFHQGAETIFIKENNPPGSHVYTVTASDADTGQNSFITYSLSDSSIDGIPMSSYISINPENGKIYAL---MSFDHEQIIYFQCQIIATDA-GLPHLSSNLTLHIFIEDINDNAPSALAPFY--STEPAVTEMVPRSSKVGQLVTKIKAVDPDSGYNAWISYKLKDLPRNSPFSIGRQNGEIIITRSLMDSD 637          

HSP 3 Score: 53.9138 bits (128), Expect = 1.542e-6
Identity = 102/369 (27.64%), Postives = 160/369 (43.36%), Query Frame = 1
Query: 1165 LYTSTASVEISVLNVYDEPLEINVDY-LNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKV--KSFEIRTNQEIDREKI-PKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTL--TYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKV--KSIIDCESSLAQFTTLTIVVTATDHGIKPK-STDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFH-------LNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFP 2223
            LY S   V+ ++L V+   L++  D  L   +Y + EE+K   FV  +       DL   I         I+S    G E ++V  ++  I  N+ IDRE + P+IS  I+  E +    P     +++ I+D NDN P    T F    I E  + G+ +    A D D G N    + +  + + SL+  S       +++  +  +D E    Q     I + A D G KPK S   Q+ IT+QD+NDN P F       +++EN +K + V  I+V   D+ +  N  L      ++P    +    IF        +     +D EK   +  +V A D  G+        V V V+D NDN P
Sbjct:    1 LYLSWDQVQGTILMVFFM-LQMAADLVLCQLHYMVPEESKHGTFVGRLA-----QDLGLQINDMNARRPRIIS--KDGSEYFQVNLQNGIIFVNRVIDREMLCPEISICIVQLEVILDK-PVQIHHVDVEIEDINDNFPIFSSTEFKL-QISEMRQSGSRLPLEGAVDADIGTNSVTGYELSLNDYFSLDVQSYTHESKSVQLVLRKPLDRE----QIPLHNITLIAFDGG-KPKLSGTTQLLITVQDINDNAPVFNEEIYRASLLENALKGTIV--IKVNATDLDEGENSKLTYAFNRLVP----QHVRTIFSIEENTGIIRVVGEVDFEKKNLYEIEVNAIDR-GHRAMVGHCKVLVNVLDVNDNPP 347          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: ENSXETT00000029153.1 (protocadherin 8 [Source:NCBI gene;Acc:100485587])

HSP 1 Score: 172.555 bits (436), Expect = 4.797e-43
Identity = 132/454 (29.07%), Postives = 228/454 (50.22%), Query Frame = 1
Query:  589 IGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVT-VELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFS-SPIYKEFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIA--VNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYS---IVEENKSNFFVAIVTVTSKENDLFRSIQCRL---EHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFGTP----SILENTKPGTVVFKIIAQDKDEGENGRVTFSM---EKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVP 1899
            +G  I L +ATD+D G N +++++IS       ++HF ++V    + V   +L + K LDRE+ + Y+ +L+A+DGG +  ++G+  + +R++D NDN P F  S +  E +++      +L L+A DPDEG+NG+IIY F P+      +   F I+  SG + L+  +D+E +  ++F V A  + P P        +T  V + V++V D    I++  L + +     I E      FVA+++ T +++     + C L   EHF        +  ++Y+  S+ I T   +DREKI + +  ++  E + S    +  +  I + D+NDNAP    F  P    S+LEN  PG  +  ++A+D D G NG+V + +   E    P   Y+S+    G +      + E        L + + A+D G    ++   I + I D NDN P
Sbjct:  143 VGTRIPLDIATDEDVGVNSIQSFQIS------VNSHFSIDVQTRADGVKYADLVLMKELDRESQSAYTLELLAMDGG-SPSRSGTAMVNVRVLDFNDNSPVFERSAVTVELMEDAPVGYLLLDLNAVDPDEGVNGEIIYGFSPQVPQE--VRQLFKIDPKSGRLTLEGQVDFESKQTYEFDVQAQDMGPNP------LAATCKVIVHVIDVNDNAPVISITPLTSISAGVAYITEAAARESFVALISTTDRDSGQNGQVHCTLYGHEHF--------RLQQAYE-DSYMIVTTSALDREKISEYNLTVVA-EDLGSPPFKTVKQYTIRVSDENDNAPV---FAKPVYEVSVLENNAPGAYITTVVARDPDFGHNGKVIYRLVETEVMGAPISTYVSLDPATGAVYALRTFNHEI----LKQLDLRIQASDGGSPQLTSSAIIKVKIVDQNDNAP 564          

HSP 2 Score: 97.0561 bits (240), Expect = 1.152e-19
Identity = 140/642 (21.81%), Postives = 279/642 (43.46%), Query Frame = 1
Query:  739 ELKVFKPLDRETTNKYS------FDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQF-SSPIYKEFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDS-------GEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYD-----EPLEINVDYLNNK--NYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKV--KSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTY-------FGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLP-----FVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVH-VISYLEPRNYKFMTVSANDQDQTSEFNTIEYHL-ESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKIT--VFNPGYTSMKSSVQVNVVIDASTAKSN 2547
            +L + + +DRE   K S       D++++      ++   I++ + + D NDN P+F S+ I  E  +      RI    ATD D G+N    ++          +  +FSI+  +        ++ L K LD E Q+ +   ++A++   P      + TA V + VL+  D     E   + V+ + +    Y +++ N      A+        ++      ++   QE+  L       +K+  KS  +    ++D E       ++  ++ +  +  +++ K+ + + D NDNAP ++         G   I E     + V  I   D+D G+NG+V  ++       L+     E   +I   S +D E    + +   + V A D G  P  T  Q +I + D NDN P F       +++ENN   +++  +   D D   +  ++ R     ++      +V L  A    +    R+ + E   + + ++ A+D  G+P  + +  + V+++DQNDN P+II P+ +N +   V+    P  +    + A D D+      + Y L E   ++F I++  G +F   +++++ +G HV ++T  V + G   + S+  +  ++ ++T   N
Sbjct:   76 QLSIGERIDRERICKQSPHCTLALDVVSL----AKEQFKLIHVEVEVRDINDNSPRFPSAEIPVEVSESATVGTRIPLDIATDEDVGVNSIQSFQIS--------VNSHFSIDVQTRADGVKYADLVLMKELDRESQSAYTLELLAMDGGSPS----RSGTAMVNVRVLDFNDNSPVFERSAVTVELMEDAPVGYLLLDLN------AVDPDEGVNGEIIYGFSPQVP--QEVRQL-------FKIDPKSGRLTLEGQVDFESKQTYEFDVQAQD-MGPNPLAATCKVIVHVIDVNDNAPVISITPLTSISAGVAYITEAAARESFVALISTTDRDSGQNGQVHCTLYGHEHFRLQQAY--EDSYMIVTTSALDRE----KISEYNLTVVAEDLGSPPFKTVKQYTIRVSDENDNAPVFAKPVYEVSVLENNAPGAYITTVVARDPDFGHNGKVIYRLVETEVMGAPISTYVSLDPATGAVY--ALRTFNHEILKQLDLRIQASDG-GSPQLTSSAIIKVKIVDQNDNAPVIIQPALSNGSAEVVVPSRAPHGFLVTQIKAKDADEGVNAE-LSYSLTEDGRNLFTINKVTGEVFLVADVSEA-VG-HVFRVTVSVSDSGRPPLSSTATITFLVTSATPPIN 673          

HSP 3 Score: 62.3882 bits (150), Expect = 4.988e-9
Identity = 63/256 (24.61%), Postives = 112/256 (43.75%), Query Frame = 1
Query: 1603 ENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDV--------------HDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQ 2328
            E  +PGTV+  +      EGE    TF + K    SL  + + E+DG + +   ID E    Q    T+ +       K +   + + + ++D+NDN P+F S+ +   + E+    + +      D+DV              H  I++  R+        V++K+            LDRE    +  +++A D  G+P+ S T  V+V V+D NDN P+     ++  TV ++    P  Y  + ++A D D+
Sbjct:   34 EEDEPGTVIGTLAEDLHLEGEG---TFRLMKQFNNSL--IHVRESDGQLSIGERIDRERICKQSPHCTLALDVVSLA-KEQFKLIHVEVEVRDINDNSPRFPSAEIPVEVSESATVGTRIPLDIATDEDVGVNSIQSFQISVNSHFSIDVQTRADGVKYADLVLMKE------------LDRESQSAYTLELLAMDG-GSPSRSGTAMVNVRVLDFNDNSPVF---ERSAVTVELMED-APVGYLLLDLNAVDPDE 266          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 182.57 bits (462), Expect = 2.401e-46
Identity = 188/675 (27.85%), Postives = 309/675 (45.78%), Query Frame = 1
Query:  589 IGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSV---RILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINV---------DYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEH---FQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVP--SSSAKIEIIIKDQNDNAPTLTYFGTP-SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYL-SIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDD--INLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVS-ANDQDQTSEFNT-IEYHLESES--DVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTA 2538
            IG    +P+ATD+D G N V +Y++  Q        F L V         +L V   LDRE  + Y   +   DGG   + + ++ + + ++D NDN P+F  P Y+  + E  NS     ++++ A D D+G N +I Y F    +   ++     ++ ++G I ++ P+D E  +  +F V+A +       T  ++ A V ++V ++ D    I +         D + N +  + EE      VA+V V+ ++     ++ C +     FQ  L   S+     K K F ++T   +D EK+   +  I+    VDS  P  SS+  +++ + D NDNAP  T   T  +  EN KPG VV ++ A D D G N  + +S+E    P+ + L +I   +G I+VK+ +D E    Q  +  + V A D G         + + + D NDN PKF  S   F++MEN    S VG + V D D  ++  + L +   N     FVI      I    ++ S DRE+   + FQ+ A D  G P  S    V + V+D+NDN P I  PS    T H +  L P+     TVS    +D  S  N  + Y +   +   +F I    G I   +E+ +   G H + + V + G      +  V++ ++ + A
Sbjct:  161 IGSLFPIPLATDRDAGPNGVASYEL--QAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSAL-LRVTVLDTNDNAPKFERPTYEAELSE--NSPIGHSVIQVKANDSDQGANAEIDYTF---HQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKD----RGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETA----VALVQVSDRDEGENAAVTCVVAGDVPFQ--LRQASETGSDSKKKYF-LQTTTPLDYEKVKDYTIEIVA---VDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPE--PAAQGLFTISPENGEIRVKTSLDRE----QRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGD---FVIQNGTGTIL---SSLSFDREQQSTYTFQLKAVDG-GVPPRSAYVGVTINVLDENDNAPFITAPSN---TSHRL--LTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNETLA 795          

HSP 2 Score: 117.472 bits (293), Expect = 4.028e-26
Identity = 145/591 (24.53%), Postives = 239/591 (40.44%), Query Frame = 1
Query:  853 IRIIDENDNMPQFSSPIYKEFVKEGLNSVRILRLS-ATDPDEGINGKIIYKFDPRFKTGALILDYFSIN------EDSGEIYLKKPLDYEKQTFFKFPV-IAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQ--EILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFG---------TPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSL--AQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLR-SKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRI 2559
            I + D NDN P F+SP+    + E  N   +  +  ATD D G NG   Y+     + G    + F +       E   ++ +   LD E+   +   + +     PP       S+A + ++VL+  D     N        Y       S    +++ V + ++D   + +      Q  E++  + + D +  +    I     +DRE +  +  ++L K+   +   S+ A++ + +KD NDNAPT+   G           +I E+    T V  +   D+DEGEN  VT  +       L   S  ET    K K  +   + L   +    TI + A D G  P S+   + + + DVNDN P FT S       ENN     V E+   D D   +  LV      PA      +   N    + T  SLDRE+   +  +V+A D  G+P+   T TV V V+D NDN P  +    N + +  +  L P     +TV   D+ + +    ++  +E ++  F I    GTI +     +     +  ++   + G      S  V V I+      N+P I
Sbjct:  134 IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYEL----QAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPP-----RASSALLRVTVLDTND-----NAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGL----ITVQGPVDREDLSTLRFSVLAKDR-GATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQAS--ETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKT--SLDREQRDSYELKVVAADR-GSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSP--VGMVTVIDGDKGENAR---VQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVP--PRSAYVGVTINVLDENDNAPFI 693          

HSP 3 Score: 61.2326 bits (147), Expect = 7.160e-9
Identity = 65/257 (25.29%), Postives = 105/257 (40.86%), Query Frame = 1
Query: 1855 LQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDD--INLVLRSKNPAMLPF---VILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDV----FDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRIENFNINNGGLMAH 2598
            L+  I +QD+NDN P F S  +   I EN    S        D+D   +   +  L++   A   F   V   +  +   L    +LDRE+   ++  +   D  GNP  + +  + V V+D NDN P    P+        +S   P  +  + V AND DQ +    I+Y      +V      +DR  G I  +  + + D+    ++ +V      +   S +  VV+       N+P IE   I   GL+ H
Sbjct:  130 LEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDG-GNPPRASSALLRVTVLDTNDNAPKFERPTYEAE----LSENSPIGHSVIQVKANDSDQGANAE-IDYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDL--STLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIE---IRGIGLVTH 375          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 182.57 bits (462), Expect = 2.401e-46
Identity = 188/675 (27.85%), Postives = 309/675 (45.78%), Query Frame = 1
Query:  589 IGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSV---RILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINV---------DYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEH---FQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVP--SSSAKIEIIIKDQNDNAPTLTYFGTP-SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYL-SIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDD--INLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVS-ANDQDQTSEFNT-IEYHLESES--DVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTA 2538
            IG    +P+ATD+D G N V +Y++  Q        F L V         +L V   LDRE  + Y   +   DGG   + + ++ + + ++D NDN P+F  P Y+  + E  NS     ++++ A D D+G N +I Y F    +   ++     ++ ++G I ++ P+D E  +  +F V+A +       T  ++ A V ++V ++ D    I +         D + N +  + EE      VA+V V+ ++     ++ C +     FQ  L   S+     K K F ++T   +D EK+   +  I+    VDS  P  SS+  +++ + D NDNAP  T   T  +  EN KPG VV ++ A D D G N  + +S+E    P+ + L +I   +G I+VK+ +D E    Q  +  + V A D G         + + + D NDN PKF  S   F++MEN    S VG + V D D  ++  + L +   N     FVI      I    ++ S DRE+   + FQ+ A D  G P  S    V + V+D+NDN P I  PS    T H +  L P+     TVS    +D  S  N  + Y +   +   +F I    G I   +E+ +   G H + + V + G      +  V++ ++ + A
Sbjct:  161 IGSLFPIPLATDRDAGPNGVASYEL--QAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSAL-LRVTVLDTNDNAPKFERPTYEAELSE--NSPIGHSVIQVKANDSDQGANAEIDYTF---HQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKD----RGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETA----VALVQVSDRDEGENAAVTCVVAGDVPFQ--LRQASETGSDSKKKYF-LQTTTPLDYEKVKDYTIEIVA---VDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPE--PAAQGLFTISPENGEIRVKTSLDRE----QRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGD---FVIQNGTGTIL---SSLSFDREQQSTYTFQLKAVDG-GVPPRSAYVGVTINVLDENDNAPFITAPSN---TSHRL--LTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNETLA 795          

HSP 2 Score: 117.472 bits (293), Expect = 4.028e-26
Identity = 145/591 (24.53%), Postives = 239/591 (40.44%), Query Frame = 1
Query:  853 IRIIDENDNMPQFSSPIYKEFVKEGLNSVRILRLS-ATDPDEGINGKIIYKFDPRFKTGALILDYFSIN------EDSGEIYLKKPLDYEKQTFFKFPV-IAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQ--EILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFG---------TPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSL--AQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLR-SKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRI 2559
            I + D NDN P F+SP+    + E  N   +  +  ATD D G NG   Y+     + G    + F +       E   ++ +   LD E+   +   + +     PP       S+A + ++VL+  D     N        Y       S    +++ V + ++D   + +      Q  E++  + + D +  +    I     +DRE +  +  ++L K+   +   S+ A++ + +KD NDNAPT+   G           +I E+    T V  +   D+DEGEN  VT  +       L   S  ET    K K  +   + L   +    TI + A D G  P S+   + + + DVNDN P FT S       ENN     V E+   D D   +  LV      PA      +   N    + T  SLDRE+   +  +V+A D  G+P+   T TV V V+D NDN P  +    N + +  +  L P     +TV   D+ + +    ++  +E ++  F I    GTI +     +     +  ++   + G      S  V V I+      N+P I
Sbjct:  134 IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYEL----QAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPP-----RASSALLRVTVLDTND-----NAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGL----ITVQGPVDREDLSTLRFSVLAKDR-GATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQAS--ETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKT--SLDREQRDSYELKVVAADR-GSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSP--VGMVTVIDGDKGENAR---VQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVP--PRSAYVGVTINVLDENDNAPFI 693          

HSP 3 Score: 61.2326 bits (147), Expect = 7.160e-9
Identity = 65/257 (25.29%), Postives = 105/257 (40.86%), Query Frame = 1
Query: 1855 LQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDD--INLVLRSKNPAMLPF---VILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDV----FDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRIENFNINNGGLMAH 2598
            L+  I +QD+NDN P F S  +   I EN    S        D+D   +   +  L++   A   F   V   +  +   L    +LDRE+   ++  +   D  GNP  + +  + V V+D NDN P    P+        +S   P  +  + V AND DQ +    I+Y      +V      +DR  G I  +  + + D+    ++ +V      +   S +  VV+       N+P IE   I   GL+ H
Sbjct:  130 LEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDG-GNPPRASSALLRVTVLDTNDNAPKFERPTYEAE----LSENSPIGHSVIQVKANDSDQGANAE-IDYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDL--STLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIE---IRGIGLVTH 375          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 182.185 bits (461), Expect = 3.438e-46
Identity = 188/675 (27.85%), Postives = 310/675 (45.93%), Query Frame = 1
Query:  589 IGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSV---RILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINV---------DYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEH---FQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVP--SSSAKIEIIIKDQNDNAPTLTYFGTP-SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYL-SIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDD--INLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVS-ANDQDQTSEFNT-IEYHLESES--DVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTA 2538
            IG    +P+ATD+D G N V +Y++  Q        F L V         +L V   LDRE  + Y   +   DGG   + + ++ + + ++D NDN P+F  P Y+  + E  NS     ++++ A D D+G N +I Y F    +   ++     ++ ++G I ++ P+D E  +  +F V+A +       T  ++ A V ++V ++ D    I +         D + N +  + EE      VA+V V+ ++     ++ C +     FQ  L   S+     K K F ++T   +D EK+   +  I+   +VDS  P  SS+  +++ + D NDNAP  T   T  +  EN KPG VV ++ A D D G N  + +S+E    P+ + L +I   +G I+VK+ +D E    Q  +  + V A D G         + + + D NDN PKF  S   F++MEN    S VG + V D D  ++  + L +   N     FVI      I    ++ S DRE+   + FQ+ A D  G P  S    V + V+D+NDN P I  PS    T H +  L P+     TVS    +D  S  N  + Y +   +   +F I    G I   +E+ +   G H + + V + G      +  V++ ++ + A
Sbjct:   22 IGSLFPIPLATDRDAGPNGVASYEL--QAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSAL-LRVTVLDTNDNAPKFERPTYEAELSE--NSPIGHSVIQVKANDSDQGANAEIDYTF---HQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKD----RGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETA----VALVQVSDRDEGENAAVTCVVAGDVPFQ--LRQASETGSDSKKKYF-LQTTTPLDYEKVKDYTIEIV---AVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPE--PAAQGLFTISPENGEIRVKTSLDRE----QRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGD---FVIQNGTGTIL---SSLSFDREQQSTYTFQLKAVDG-GVPPRSAYVGVTINVLDENDNAPFITAPSN---TSHRL--LTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNETLA 656          

HSP 2 Score: 114.005 bits (284), Expect = 5.306e-25
Identity = 144/578 (24.91%), Postives = 236/578 (40.83%), Query Frame = 1
Query:  871 NDNMPQFSSPIYKEFVKEGLNSVRILRLS-ATDPDEGINGKIIYKFDPRFKTGALILDYFSIN--EDSGEIYLKKP-------LDYEKQTFFKFPV-IAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQ--EILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFG---------TPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSL--AQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLR-SKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNV-VID 2526
            NDN P F+SP+    + E  N   +  +  ATD D G NG   Y+     + G    + F +   ED  E   K+P       LD E+   +   + +     PP       S+A + ++VL+  D     N        Y       S    +++ V + ++D   + +      Q  E++  + + D +  +    I     +DRE +  +  ++L K+   +   S+ A++ + +KD NDNAPT+   G           +I E+    T V  +   D+DEGEN  VT  +       L   S  ET    K K  +   + L   +    TI + A D G  P S+   + + + DVNDN P FT S       ENN     V E+   D D   +  LV      PA      +   N    + T  SLDRE+   +  +V+A D  G+P+   T TV V V+D NDN P  +    N + +  +  L P     +TV   D+ + +    ++  +E ++  F I    GTI +     +     +  ++   + G     + V V + V+D
Sbjct:    1 NDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYEL----QAGPEAQELFGLQVAEDQEE---KQPQLIVMGNLDRERWDSYDLTIKVQDGGNPP-----RASSALLRVTVLDTND-----NAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGL----ITVQGPVDREDLSTLRFSVLAKDR-GATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQAS--ETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKT--SLDREQRDSYELKVVAADR-GSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSP--VGMVTVIDGDKGENAR---VQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLD 546          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 178.333 bits (451), Expect = 6.923e-45
Identity = 183/645 (28.37%), Postives = 300/645 (46.51%), Query Frame = 1
Query:  607 LPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTV-ELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVN--PTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLN---NKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPS--SSAKIEIIIKDQNDNAPTLTYFGTP----SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLR----SKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESD--VFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGY 2484
            +P ATD D G N V+ Y++   +     + F L+++ T       +L V + LDRE  + Y   +   DGG T QK+ +  + + + D NDN P F     +  + E       +++L ATD D G N +I Y F  +       L  F++N  +G I +++ LD E+    K  V+A +   TP        + A+V I+V +V D P  I++ Y+    N    + E++  N  +A++TV+ K+ D+   + C +E  +    L +  D  Y      + T+  +D E   + S  I+     DS  PS   +A + + ++D+NDN P    F  P    S+ EN + G  +  I A D+D G+N  + + +     P+  +  +    GV+    + + E            VTA D+G  P  +   + +T+ D NDN PKFT +H  F + EN  K S VG I V D+D  ++  + L     ++N  + P+  + K+N         S DRE+   + F V ATD  G P  S T  V + V+D NDN P++I P  N +   V     P +     V A D D T     ++Y + S ++  +F ID   G I    + A +D+G H + + + + GY
Sbjct:  163 IPSATDPDTGFNGVQHYELLNGQ-----SVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGG-TPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRL--FALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--------ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIER-EVPFHLKAVYDNQYL-----LETSSLLDYEGTKEFSFKIVAS---DSGKPSLNQTALVRVKLEDENDNPPI---FNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLG----PNASFFDLDRKTGVLTASRVFNREEQ----ERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDNENFVLDPYSGVIKSN--------VSFDREQQSSYTFDVKATDG-GQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSV-VAEVFAVDID-TGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGY 760          

HSP 2 Score: 103.99 bits (258), Expect = 6.558e-22
Identity = 106/389 (27.25%), Postives = 175/389 (44.99%), Query Frame = 1
Query: 1438 QEIDREKIPKISTNILCKESVDSHVP--SSSAKIEIIIKDQNDNAPTLTYFGTP-SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYL-SIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTI------MENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFP------SQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPR 2556
            Q +DRE+     T ++  +  D   P  SS+A +++ + D NDN P          I EN   GT V ++ A D D G N  + +       P+ + L ++  T G+I V+  +D E +        + V A+D    P    + I++T  DVNDN P     ++I  I       E +  N+ +  I V DKD   D+N  +       +PF +    +  + L T+  LD E   +F+F+++A+DS G P+ + T  V V++ D+NDN PI   P      S+NN           R     T+SA D+D     + + Y L   +  FD+DR+ G +   R   + +    +  +T  + G   ++S  Q  V++       NSP+
Sbjct:  208 QNLDREQK---DTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIH----KVTVLASDGSSTPARATVTINVT--DVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDT--DVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDS-GKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNR----------RGLYLTTISATDEDSGKNADIV-YQLGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQS--QAAVIVTVLDENDNSPK 571          

HSP 3 Score: 88.9669 bits (219), Expect = 2.983e-17
Identity = 127/500 (25.40%), Postives = 213/500 (42.60%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFS-----SPIYKEFV---KEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLT-----YFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTS--SHMIFTIME-NNMKNSFVGEIEVEDKD 1989
            P+F E  +E+ I E+  +G ++    ATD D G+N    Y    Q        F LN  NT   +TV+    + LDRE T  +   ++A DG  T  +     + I + D NDN P        SPI        K+ +N+ +I  ++ +D D  +NGK+I      F    +     ++ ++   +     LDYE    F F ++A +   P        TA V + + +  D P   N   +     S+ E N+   ++  ++ T +++     I  +L        L          K+  +  ++  +RE+  +    +  +++    + S +A I + + D+NDN+P  T     +F    + EN    + V  I   D+D GEN  VT S+        E   +    GVIK     D E    Q ++ T  V ATD G  P+S+  +++I + DVNDN P   S  S+  F ++  + +  S V E+   D D
Sbjct:  250 PVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALN--NTTGLITVQ----RSLDREETAIHKVTVLASDGSSTPARA---TVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNT-KIALITVSDKDTDVNGKVIC-----FIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPS----LNQTALVRVKLEDENDNPPIFNQPVI---ELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDL--------DRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVI-VTVLDENDNSPKFTHNHFQFF----VSENLPKYSTVGVITVTDEDAGENKAVTLSILNDN----ENFVLDPYSGVIKSNVSFDRE----QQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDID 706          

HSP 4 Score: 75.8702 bits (185), Expect = 2.901e-13
Identity = 87/285 (30.53%), Postives = 127/285 (44.56%), Query Frame = 1
Query: 1528 KIEIIIKDQNDNAPTLTYFGTP----SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGET-DGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDV--HDDINLVLRSKNPAMLPFVILKKANRIFHLNTT-------RSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFP-----IIIFPSQNNATVHVISYLEPRNYKFMTVSANDQD 2325
            KI+II+KD NDNAP    F +P    SI ENT   +      A D D G NG   + +      S+  L I ET +G    + I+       Q  T  + +   D G   KS+   + +T+ DVNDN P F    +   I EN    + V ++   D D+  + +I  +  ++        +     R+F LN T       RSLDRE+       V+A+D    P  +   TV + V D NDN P      II P   N TV+ +S  +P N K   ++ +D+D
Sbjct:  127 KIKIIVKDTNDNAP---MFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQ--SVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQ--------VAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARA---TVTINVTDVNDNPPNIDLRYIISPI--NGTVY-LSEKDPVNTKIALITVSDKD 392          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 177.948 bits (450), Expect = 7.227e-45
Identity = 183/645 (28.37%), Postives = 300/645 (46.51%), Query Frame = 1
Query:  607 LPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTV-ELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVN--PTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLN---NKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPS--SSAKIEIIIKDQNDNAPTLTYFGTP----SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLR----SKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESD--VFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGY 2484
            +P ATD D G N V+ Y++   +     + F L+++ T       +L V + LDRE  + Y   +   DGG T QK+ +  + + + D NDN P F     +  + E       +++L ATD D G N +I Y F  +       L  F++N  +G I +++ LD E+    K  V+A +   TP        + A+V I+V +V D P  I++ Y+    N    + E++  N  +A++TV+ K+ D+   + C +E  +    L +  D  Y      + T+  +D E   + S  I+     DS  PS   +A + + ++D+NDN P    F  P    S+ EN + G  +  I A D+D G+N  + + +     P+  +  +    GV+    + + E            VTA D+G  P  +   + +T+ D NDN PKFT +H  F + EN  K S VG I V D+D  ++  + L     ++N  + P+  + K+N         S DRE+   + F V ATD  G P  S T  V + V+D NDN P++I P  N +   V     P +     V A D D T     ++Y + S ++  +F ID   G I    + A +D+G H + + + + GY
Sbjct:   40 IPSATDPDTGFNGVQHYELLNGQ-----SVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGG-TPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRL--FALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--------ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIER-EVPFHLKAVYDNQYL-----LETSSLLDYEGTKEFSFKIVAS---DSGKPSLNQTALVRVKLEDENDNPP---IFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLG----PNASFFDLDRKTGVLTASRVFNREEQ----ERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDNENFVLDPYSGVIKSN--------VSFDREQQSSYTFDVKATDG-GQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSV-VAEVFAVDID-TGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGY 637          

HSP 2 Score: 103.605 bits (257), Expect = 7.634e-22
Identity = 106/389 (27.25%), Postives = 175/389 (44.99%), Query Frame = 1
Query: 1438 QEIDREKIPKISTNILCKESVDSHVP--SSSAKIEIIIKDQNDNAPTLTYFGTP-SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYL-SIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTI------MENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFP------SQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPR 2556
            Q +DRE+     T ++  +  D   P  SS+A +++ + D NDN P          I EN   GT V ++ A D D G N  + +       P+ + L ++  T G+I V+  +D E +        + V A+D    P    + I++T  DVNDN P     ++I  I       E +  N+ +  I V DKD   D+N  +       +PF +    +  + L T+  LD E   +F+F+++A+DS G P+ + T  V V++ D+NDN PI   P      S+NN           R     T+SA D+D     + + Y L   +  FD+DR+ G +   R   + +    +  +T  + G   ++S  Q  V++       NSP+
Sbjct:   85 QNLDREQK---DTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIH----KVTVLASDGSSTPARATVTINVT--DVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDT--DVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDS-GKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNR----------RGLYLTTISATDEDSGKNADIV-YQLGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQS--QAAVIVTVLDENDNSPK 448          

HSP 3 Score: 88.5817 bits (218), Expect = 3.047e-17
Identity = 119/467 (25.48%), Postives = 199/467 (42.61%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFS-----SPIYKEFV---KEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLT-----YFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVP 1899
            P+F E  +E+ I E+  +G ++    ATD D G+N    Y    Q        F LN  NT   +TV+    + LDRE T  +   ++A DG  T  +     + I + D NDN P        SPI        K+ +N+ +I  ++ +D D  +NGK+I      F    +     ++ ++   +     LDYE    F F ++A +   P        TA V + + +  D P   N   +     S+ E N+   ++  ++ T +++     I  +L        L          K+  +  ++  +RE+  +    +  +++    + S +A I + + D+NDN+P  T     +F    + EN    + V  I   D+D GEN  VT S+        E   +    GVIK     D E    Q ++ T  V ATD G  P+S+  +++I + DVNDN P
Sbjct:  127 PVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALN--NTTGLITVQ----RSLDREETAIHKVTVLASDGSSTPARA---TVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNT-KIALITVSDKDTDVNGKVIC-----FIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPS----LNQTALVRVKLEDENDNPPIFNQPVI---ELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDL--------DRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVI-VTVLDENDNSPKFTHNHFQFF----VSENLPKYSTVGVITVTDEDAGENKAVTLSILNDN----ENFVLDPYSGVIKSNVSFDRE----QQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSP 550          

HSP 4 Score: 75.8702 bits (185), Expect = 2.886e-13
Identity = 87/285 (30.53%), Postives = 127/285 (44.56%), Query Frame = 1
Query: 1528 KIEIIIKDQNDNAPTLTYFGTP----SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGET-DGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDV--HDDINLVLRSKNPAMLPFVILKKANRIFHLNTT-------RSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFP-----IIIFPSQNNATVHVISYLEPRNYKFMTVSANDQD 2325
            KI+II+KD NDNAP    F +P    SI ENT   +      A D D G NG   + +      S+  L I ET +G    + I+       Q  T  + +   D G   KS+   + +T+ DVNDN P F    +   I EN    + V ++   D D+  + +I  +  ++        +     R+F LN T       RSLDRE+       V+A+D    P  +   TV + V D NDN P      II P   N TV+ +S  +P N K   ++ +D+D
Sbjct:    4 KIKIIVKDTNDNAP---MFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQ--SVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQ--------VAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARA---TVTINVTDVNDNPPNIDLRYIISPI--NGTVY-LSEKDPVNTKIALITVSDKD 269          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q5DRF2|PCDAC_PANTR (Protocadherin alpha-12 OS=Pan troglodytes OX=9598 GN=PCDHA12 PE=3 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 5.454e-45
Identity = 181/685 (26.42%), Postives = 309/685 (45.11%), Query Frame = 1
Query:  223 VINISDDTALNIKLYDLKKLIPQTKMTYHLLKSSKAHSYFT---IKNDNLFTNTLVDMDSMCQNVGECCNKAKEICDFSIAIACRENQESEVXXXXXXXXXXXXXXXYPIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLN-SVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGL-NSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRL-EHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPS--SSAKIEIIIKDQNDNAPTLTYFGTPS----ILENTKPGTVVFKIIAQDKDEGENGRVTFSM-----EKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKF------TSSHMIFTIMENNM-KNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVID 2205
            V  I+ D  L     +L +L+P+         +SK H       ++N  LF N+ +D + +C    EC    + I D  + +   + +  ++                P+F ER  ++ +SES  +     L  A+D D G N + TY +S  E      HF L +    + S+  EL + K LDRE T K +  LM IDGG+  + TGS+ I I ++D NDN P F  P YK  + E + N  R+++L+A+DPDEG+NG+I Y            +  FSIN D+GEI +   LD+E+   ++  V A++      I      + V + VL+V D   E+ V  L   +  + E+ +    +A+++V+ +++     + C L  H      L+S    +YK   + +  +  +DRE    +S   L   + D   PS  ++A++ + + D NDNAP    F  P     + EN  PG  +F + A D D  +N  V++S+      + A  S  Y+S+    G +     +D E    +   L   V+A D G+ P  +++ + + + D NDN P        ++   +  ++  ++     V ++   D D   +  L    +  A+   +          ++TTR LD    P+    V+  D  G P  + T TV V +++
Sbjct:   45 VGRIAQDLGL-----ELAELVPRL-----FRVASKRHGDLLEVNLQNGILFVNSRIDREKLCGRSAECSIHLEVIVDRPLQVFHVDVEVKDINDNP------------PVFREREQKVPVSESAPLDSHFPLEGASDADIGVNSLLTYALSLNE------HFELKIKTKKDKSILPELVLRKLLDREQTPKLNLLLMVIDGGKP-ELTGSVQIQITVLDVNDNGPAFDKPSYKVVLSENVQNDTRVIQLNASDPDEGLNGEISYGIKMILPVSEKCM--FSINPDTGEIRIYGELDFEENNAYEIQVNAIDK----GIPSMAGHSMVLVEVLDVNDNVPEVMVTSL---SLPVQEDAQVGTVIALISVSDRDSGANGQVICSLTPHVP--FKLVS----TYK-NYYSLVLDSALDRE---SVSAYELVVTARDGGSPSLWATARVSVEVADVNDNAPA---FAQPEYTVFVKENNPPGCHIFTVSAWDADAQKNALVSYSLVERRVGEHALSS--YVSVHAESGKVYALQPLDHE----ELELLQFQVSARDAGVPPLGSNVTLQVFVLDENDNAPALLATPAGSAGGAVSELVPRSVGAGHVVAKVRAVDADSGYNAWLSYELQPAAVGAHIPFHVGLYTGEISTTRILDEADAPRHRLLVLVKDH-GEPALTSTATVLVSLVE 671          

HSP 2 Score: 96.6709 bits (239), Expect = 7.654e-19
Identity = 148/618 (23.95%), Postives = 262/618 (42.39%), Query Frame = 1
Query:  823 DQKTGSINIAIRIIDENDNMPQF-----------SSPIYKEFVKEGLNSVRILRLSATDPDEGINGKIIYK------FDPRFKTGALILDYFSINEDSG---EIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEH-FQEILSLISKGDESYKVKSFEIRTNQEIDREK--IPKISTNILCKESVDSHVPSSSAKIEIIIK--DQNDNAP--TLTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDI----NLVLRSKNP-AMLPFV-ILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQ--DQTSEFNT-IEYHLESESD----VFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKS--SVQVNVVIDASTAKSNS 2550
            D+     ++ + + D NDN P F           S+P+   F  EG          A+D D G+N  + Y       F+ + KT           +D     E+ L+K LD E+       ++ ++   P      T +  ++I+VL+V D     N    +  +Y +V          ++ + + + D    +   + +  + IL +  K   S    + EIR   E+D E+    +I  N     ++D  +PS +    ++++  D NDN P   +T    P + E+ + GTV+  I   D+D G NG+V  S+        + +S  +    + + S +D ES     +   +VVTA D G        ++S+ + DVNDN P F        + ENN     +  +   D D   +     +LV R     A+  +V +  ++ +++ L   + LD E+     FQV A D+ G P      T+ V V+D+NDN P ++     +A    +S L PR+     V A  +  D  S +N  + Y L+  +      F +    G I T R + ++D   H + + V + G  ++ S  +V V++V +    K++S
Sbjct:  111 DRPLQVFHVDVEVKDINDNPPVFREREQKVPVSESAPLDSHFPLEG----------ASDADIGVNSLLTYALSLNEHFELKIKT----------KKDKSILPELVLRKLLDREQTPKLNLLLMVIDGGKPE----LTGSVQIQITVLDVND-----NGPAFDKPSYKVVLSENVQNDTRVIQLNASDPD--EGLNGEISYGIKMILPVSEKCMFSINPDTGEIRIYGELDFEENNAYEIQVN-----AIDKGIPSMAGHSMVLVEVLDVNDNVPEVMVTSLSLP-VQEDAQVGTVIALISVSDRDSGANGQVICSLTPHV--PFKLVSTYKNYYSLVLDSALDRES----VSAYELVVTARDGGSPSLWATARVSVEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSAWDADAQKNALVSYSLVERRVGEHALSSYVSVHAESGKVYAL---QPLDHEELELLQFQVSARDA-GVPPLGSNVTLQVFVLDENDNAPALLATPAGSAG-GAVSELVPRSVGAGHVVAKVRAVDADSGYNAWLSYELQPAAVGAHIPFHVGLYTGEISTTRILDEADAPRHRLLVLVKDHGEPALTSTATVLVSLVENGQAPKTSS 680          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q9HC56|PCDH9_HUMAN (Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 PE=1 SV=2)

HSP 1 Score: 179.489 bits (454), Expect = 2.208e-44
Identity = 184/645 (28.53%), Postives = 298/645 (46.20%), Query Frame = 1
Query:  607 LPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTV-ELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVN--PTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLN---NKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPS--SSAKIEIIIKDQNDNAPTLTYFGTP----SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLR----SKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESD--VFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGY 2484
            +P ATD D G N V+ Y++   +     + F L+++ T       +L V + LDRE  + Y   +   DGG T QK+ +  + + + D NDN P F     +  + E       +++L ATD D G N +I Y F  +       L  F++N  +G I +++ LD E+    K  V+A +   TP        + A+V I+V +V D P  I++ Y+    N    + E++  N  +A++TV+ K+ D+   + C +E  +    L +  D  Y      + T+  +D E   + S  I+     DS  PS   +A + + ++D+NDN P    F  P    S+ EN + G  +  I A D+D G+N  + + +     P+  +  +    GV+    + D E            VTA D+G  P  +   + +T+ D NDN PKFT +H  F + EN  K S VG I V D D  ++  + L     + N  + P+  + K+N  F        DRE+   + F V ATD  G P  S T  V + V+D NDN P++I P  N +   V     P +     V A D D T     ++Y + S ++  +F ID   G I    + A +D+G H + + + + GY
Sbjct:  163 IPSATDPDTGFNGVQHYELLNGQ-----SVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGG-TPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRL--FALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--------ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIER-EVPFHLKAVYDNQYL-----LETSSLLDYEGTKEFSFKIVAS---DSGKPSLNQTALVRVKLEDENDNPP---IFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLG----PNASFFDLDRKTGVLTASRVFDREEQ----ERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVSF--------DREQQSSYTFDVKATDG-GQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSV-VAEVFAVDVD-TGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGY 760          

HSP 2 Score: 103.99 bits (258), Expect = 5.272e-21
Identity = 106/389 (27.25%), Postives = 175/389 (44.99%), Query Frame = 1
Query: 1438 QEIDREKIPKISTNILCKESVDSHVP--SSSAKIEIIIKDQNDNAPTLTYFGTP-SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYL-SIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTI------MENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFP------SQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPR 2556
            Q +DRE+     T ++  +  D   P  SS+A +++ + D NDN P          I EN   GT V ++ A D D G N  + +       P+ + L ++  T G+I V+  +D E +        + V A+D    P    + I++T  DVNDN P     ++I  I       E +  N+ +  I V DKD   D+N  +       +PF +    +  + L T+  LD E   +F+F+++A+DS G P+ + T  V V++ D+NDN PI   P      S+NN           R     T+SA D+D     + + Y L   +  FD+DR+ G +   R   + +    +  +T  + G   ++S  Q  V++       NSP+
Sbjct:  208 QNLDREQK---DTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIH----KVTVLASDGSSTPARATVTINVT--DVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDT--DVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDS-GKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNR----------RGLYLTTISATDEDSGKNADIV-YQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQS--QAAVIVTVLDENDNSPK 571          

HSP 3 Score: 89.3521 bits (220), Expect = 1.497e-16
Identity = 127/500 (25.40%), Postives = 212/500 (42.40%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFS-----SPIYKEFV---KEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLT-----YFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTS--SHMIFTIME-NNMKNSFVGEIEVEDKD 1989
            P+F E  +E+ I E+  +G ++    ATD D G+N    Y    Q        F LN  NT   +TV+    + LDRE T  +   ++A DG  T  +     + I + D NDN P        SPI        K+ +N+ +I  ++ +D D  +NGK+I      F    +     ++ ++   +     LDYE    F F ++A +   P        TA V + + +  D P   N   +     S+ E N+   ++  ++ T +++     I  +L        L          K+  +  ++  DRE+  +    +  +++    + S +A I + + D+NDN+P  T     +F    + EN    + V  I   D D GEN  VT S+        +   +    GVIK     D E    Q ++ T  V ATD G  P+S+  +++I + DVNDN P   S  S+  F ++  + +  S V E+   D D
Sbjct:  250 PVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALN--NTTGLITVQ----RSLDREETAIHKVTVLASDGSSTPARA---TVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNT-KIALITVSDKDTDVNGKVIC-----FIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPS----LNQTALVRVKLEDENDNPPIFNQPVI---ELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDL--------DRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVI-VTVLDENDNSPKFTHNHFQFF----VSENLPKYSTVGVITVTDADAGENKAVTLSILNDN----DNFVLDPYSGVIKSNVSFDRE----QQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVD 706          

HSP 4 Score: 75.8702 bits (185), Expect = 2.107e-12
Identity = 87/285 (30.53%), Postives = 127/285 (44.56%), Query Frame = 1
Query: 1528 KIEIIIKDQNDNAPTLTYFGTP----SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGET-DGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDV--HDDINLVLRSKNPAMLPFVILKKANRIFHLNTT-------RSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFP-----IIIFPSQNNATVHVISYLEPRNYKFMTVSANDQD 2325
            KI+II+KD NDNAP    F +P    SI ENT   +      A D D G NG   + +      S+  L I ET +G    + I+       Q  T  + +   D G   KS+   + +T+ DVNDN P F    +   I EN    + V ++   D D+  + +I  +  ++        +     R+F LN T       RSLDRE+       V+A+D    P  +   TV + V D NDN P      II P   N TV+ +S  +P N K   ++ +D+D
Sbjct:  127 KIKIIVKDTNDNAP---MFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQ--SVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQ--------VAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARA---TVTINVTDVNDNPPNIDLRYIISPI--NGTVY-LSEKDPVNTKIALITVSDKD 392          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q5DRF1|PCDAD_PANTR (Protocadherin alpha-13 OS=Pan troglodytes OX=9598 GN=PCDHA13 PE=3 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 2.453e-44
Identity = 187/697 (26.83%), Postives = 318/697 (45.62%), Query Frame = 1
Query:  223 VINISDDTALNIKLYDLKKLIPQTKMTYHLLK-SSKAHSYF---TIKNDNLFTNTLVDMDSMCQNVGECCNKAKEICD-----FSIAIACRENQESEVXXXXXXXXXXXXXXXYPIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVT-VELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKE-GLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRL-EHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPS--SSAKIEIIIKDQNDNAPTLTYFGTPS----ILENTKPGTVVFKIIAQDKDEGENGRVTFSM-----EKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKF---TSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDIN--------LVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQN 2211
            V  I+ D  L     +L +L+P+      L + +SK H       ++N  LF N+ +D + +C    EC    + I D     F + +  R+  ++                  PIF E    I ++ES        L  A+D D G N   TY++   +P   +++F L+  N+L  ++ + L + K LDRE   ++S  L A DGG+  + TG++ + I I+D NDN P+F   +YK  V E   N   +++L+ATDPD+G NG I+Y F  R      ++  F+IN ++GEI  K  LD+E++  ++  V AV+      I +     ++ + VL+V D   E+ +  L   +  I E+ + +  +A+++V+ +++     + C L  H      L+S    +YK   + +  +  +DRE    +S   L   + D   PS  ++A + + + D NDNAP    F  P     + EN  PG  +F + AQD D  EN  V++S+      + A  S  Y+S+    G +     +D E    +   L   V+A D G+ P  +++ + + + D NDN P      +     T+ E   ++   G + V+ + V  D          L L +   A +PF +      I   +TTR LD    P     V+  D  G P  + T TV + +++  
Sbjct:   45 VGRIAQDLGL-----ELAELVPR------LFRVASKTHGDLLEVNLQNGILFVNSRIDREELCGRSAECSVHLEVIVDRPLQVFHVEVKVRDINDNP-----------------PIFPESKKRIIVAESRPPETRFPLDGASDADIGVNSALTYRL---DP---NDYFTLDAQNSLEQMSSLSLVLRKTLDREEIQEHSLLLTASDGGKP-ELTGTVQLLITILDVNDNAPEFYQSVYKVTVLENAFNGTLVIKLNATDPDDGTNGDIVYSF--RRPVSPAVVYAFTINPNNGEIRTKGKLDFEEKKLYEISVEAVDKG---NIPM-AGHCTLLVEVLDVNDNAPEVTITSL---SLPIREDTQPSAIIALISVSDRDSGSNGQVTCTLTPHVP--FKLVS----TYK-NYYSLVLDSALDRE---SVSAYELVVTARDGGSPSLWATASVSVGVADVNDNAPA---FAQPEYTVFVKENNPPGCHIFTVSAQDADAQENALVSYSLVERRVGERALSS--YVSVHAESGKVYALQPLDHE----ELELLQFQVSARDSGVPPLGSNVTLQVFVLDENDNAPALLTPGAGSAGGTVSELMPRSVGAGHVVVKVRAVDADSGYNAWLSYELQLAAVG-ARIPFCVGLYTGEI---STTRPLDEVDAPHHRLLVLVKDH-GEPALTATATVLLSLVESG 673          

HSP 2 Score: 109.768 bits (273), Expect = 7.408e-23
Identity = 152/613 (24.80%), Postives = 258/613 (42.09%), Query Frame = 1
Query:  844 NIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINE-------DSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQ-------EILSLISKGDESYKVKSF-------EIRTNQEIDRE--KIPKISTNILCKESVD-SHVP-SSSAKIEIIIKDQNDNAP--TLTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDI----NLVLRS-KNPAMLPFV-ILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPR--NYKFMTVSANDQDQTSEFNT-IEYHLE----SESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNV-VIDASTAKSNSPR 2556
            ++ +++ D NDN P F     +  V E      R     A+D D G+N  + Y+ DP         DYF+++         S  + L+K LD E+       + A +   P      T T  + I++L+V D                    N   F+ ++  VT  EN    ++  +L           +I+    +      V +F       EIRT  ++D E  K+ +IS      E+VD  ++P +    + + + D NDNAP  T+T    P I E+T+P  ++  I   D+D G NG+VT ++        + +S  +    + + S +D ES     +   +VVTA D G         +S+ + DVNDN P F        + ENN     +  +  +D D  ++     +LV R     A+  +V +  ++ +++ L   + LD E+     FQV A DS G P      T+ V V+D+NDN P ++ P   +A    +S L PR      + V     D  S +N  + Y L+         F +    G I T R + + D   H + + V + G  ++ ++  V + ++++  A   S R
Sbjct:  118 HVEVKVRDINDNPPIFPESKKRIIVAESRPPETRFPLDGASDADIGVNSALTYRLDPN--------DYFTLDAQNSLEQMSSLSLVLRKTLDREEIQEHSLLLTASDGGKPE----LTGTVQLLITILDVND--------------------NAPEFYQSVYKVTVLENAFNGTLVIKLNATDPDDGTNGDIVYSFRRPVSPAVVYAFTINPNNGEIRTKGKLDFEEKKLYEISV-----EAVDKGNIPMAGHCTLLVEVLDVNDNAPEVTITSLSLP-IREDTQPSAIIALISVSDRDSGSNGQVTCTLTPHV--PFKLVSTYKNYYSLVLDSALDRES----VSAYELVVTARDGGSPSLWATASVSVGVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSAQDADAQENALVSYSLVERRVGERALSSYVSVHAESGKVYAL---QPLDHEELELLQFQVSARDS-GVPPLGSNVTLQVFVLDENDNAPALLTPGAGSAG-GTVSELMPRSVGAGHVVVKVRAVDADSGYNAWLSYELQLAAVGARIPFCVGLYTGEISTTRPLDEVDAPHHRLLVLVKDHGEPALTATATVLLSLVESGQAPQASSR 681          

HSP 3 Score: 70.0922 bits (170), Expect = 9.764e-11
Identity = 90/352 (25.57%), Postives = 148/352 (42.05%), Query Frame = 1
Query: 1255 NYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHV--------PSSSAKIEIIIKDQNDNAPTLTYFGTPSILENTKPGTVVFKI-IAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVV----------------TATDHGIKPKSTD-LQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVL---RSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFP 2223
            +YS+ EE K   FV  +       DL   +   +     + S          +++  +  N  IDRE+        LC  S +  V        P     +E+ ++D NDN P         I+  ++P    F +  A D D G N  +T+ ++ +     +Y ++             D ++SL Q ++L++V+                TA+D G KP+ T  +Q+ ITI DVNDN P+F  S    T++EN    + V ++   D D   + ++V    R  +PA++    +   N    + T   LD E+   +   V A D  GN   +   T+ VEV+D NDN P
Sbjct:   32 HYSVPEEAKHGTFVGRIA-----QDLGLELAELVPRLFRVASKTHGDLLEVNLQNGILFVNSRIDREE--------LCGRSAECSVHLEVIVDRPLQVFHVEVKVRDINDNPPIFPESKKRIIVAESRPPETRFPLDGASDADIGVNSALTYRLDPN-----DYFTL-------------DAQNSLEQMSSLSLVLRKTLDREEIQEHSLLLTASDGG-KPELTGTVQLLITILDVNDNAPEFYQSVYKVTVLENAFNGTLVIKLNATDPDDGTNGDIVYSFRRPVSPAVVYAFTINPNNG--EIRTKGKLDFEEKKLYEISVEAVDK-GNIPMAGHCTLLVEVLDVNDNAP 348          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q71M42|PC11X_PANTR (Protocadherin-11 X-linked OS=Pan troglodytes OX=9598 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 2.958e-44
Identity = 188/660 (28.48%), Postives = 302/660 (45.76%), Query Frame = 1
Query:  604 TLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTV-ELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNK--NYSIVEEN-KSNFFVAIVTVTSKENDLFRSIQCRLEH-----FQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTY-FGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDD--INLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSA-NDQDQTSEFNTIEYHL--ESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYT-SMKSSVQVNVVIDAS 2532
            TLP A D D G N V+ Y++ + +     N F L+V+ T     + +L V K LDRE  + Y   +   DGG   Q++ +  + + + D NDN P F     +  + E       + +L ATD D G N KI + F       A  L  F +N  +G I +K+PLD E+    K  V+A +        L  + A V ++V +V D    I++ Y+ N   +  ++ EN   N  +A++TVT K+ D    + C  +H      + + S             F + T   +D E   + +  +L  ++    + + SA + I +KD+NDNAP  T  F T SI EN  PG  + K+ A D D G N  + + +   A P     S+    G++ V   +D E       T    + A D+G+ P ++++ + ++I D NDN P FT +   F + EN  ++  VG I V D D  D+  + L +  +N     F I  +   I       S DREK   + F V A D  G  + S +  V + V+D NDN P+ I P  N +   V+    P    F  ++  ND    +E   + Y +   +  D+F ID++ G I    +   +D+G H + +   + G   S+ S V VN+ ++ S
Sbjct:  159 TLPAAVDPDVGTNGVQNYELIKSQ-----NIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGG-FPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRL--FHLNATTGLITIKEPLDREETPNHKLLVLASDGG------LMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFS-----------NQFLLETAAYLDYESTKEYAIKLLAADAGKPPL-NQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEF---SLDRRTGMLTVVKKLDREKEDKYLFT----ILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD---FTIDSQTGVI---RPNISFDREKQESYTFYVKAEDG-GRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVMAVDNDTGMNAE---VRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNES 775          

HSP 2 Score: 72.0182 bits (175), Expect = 3.017e-11
Identity = 124/481 (25.78%), Postives = 195/481 (40.54%), Query Frame = 1
Query:  535 YPIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFS-----SPIYKEFVKE---GLNSVRILRLSATDPDEGINGKIIYKFDPR--FKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPT-PPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTN-----QEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIK--DQNDNAPTLTY----FGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSM--EKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKF 1905
            +P+F E  IE+ I E+  +G ++T   ATD D G N    +  S          F LN    L      + + +PLDRE T  +   ++A DGG    +     + + + D NDN+P        +P+    V      LN+ +I  ++ TD D   NG++    D    F+   +  + F +   +        LDYE    +   ++A +   PP+       +A + I V +  D        ++     SI E N     +  V+ T  ++     I   L            G ++    S + RT      +++DREK  K    IL K   D+ VP  ++ + + +   DQNDN+P  T+    F  P   EN      V  I   D D G+N  VT S+  E   F      +I    GVI+     D E       + T  V A D G   +S+  +++I + DVNDN P F
Sbjct:  246 HPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGL------ITIKEPLDREETPNHKLLVLASDGGLMPARA---MVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNT-KIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAY-------LDYESTKEYAIKLLAADAGKPPL-----NQSAMLFIKVKDENDNAPVFTQSFV---TVSIPENNSPGIQLTKVSATDADSGPNAEINYLL------------GPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAK---DNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVP---ENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDF------TIDSQTGVIRPNISFDREKQ----ESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVF 673          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q6WYY1|PC11X_PANPA (Protocadherin-11 X-linked OS=Pan paniscus OX=9597 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 3.252e-44
Identity = 188/660 (28.48%), Postives = 302/660 (45.76%), Query Frame = 1
Query:  604 TLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTV-ELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNK--NYSIVEEN-KSNFFVAIVTVTSKENDLFRSIQCRLEH-----FQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTY-FGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDD--INLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSA-NDQDQTSEFNTIEYHL--ESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYT-SMKSSVQVNVVIDAS 2532
            TLP A D D G N V+ Y++ + +     N F L+V+ T     + +L V K LDRE  + Y   +   DGG   Q++ +  + + + D NDN P F     +  + E       + +L ATD D G N KI + F       A  L  F +N  +G I +K+PLD E+    K  V+A +        L  + A V ++V +V D    I++ Y+ N   +  ++ EN   N  +A++TVT K+ D    + C  +H      + + S             F + T   +D E   + +  +L  ++    + + SA + I +KD+NDNAP  T  F T SI EN  PG  + K+ A D D G N  + + +   A P     S+    G++ V   +D E       T    + A D+G+ P ++++ + ++I D NDN P FT +   F + EN  ++  VG I V D D  D+  + L +  +N     F I  +   I       S DREK   + F V A D  G  + S +  V + V+D NDN P+ I P  N +   V+    P    F  ++  ND    +E   + Y +   +  D+F ID++ G I    +   +D+G H + +   + G   S+ S V VN+ ++ S
Sbjct:  159 TLPAAVDPDVGTNGVQNYELIKSQ-----NIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGG-FPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRL--FHLNATTGLITIKEPLDREETPNHKLLVLASDGG------LMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFS-----------NQFLLETAAYLDYESTKEYAIKLLAADAGKPPL-NQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEF---SLDRRTGMLTVVKKLDREKEDKYLFT----ILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD---FTIDSQTGVI---RPNISFDREKQESYTFYVKAEDG-GRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVMAVDNDTGMNAE---VRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNES 775          

HSP 2 Score: 72.0182 bits (175), Expect = 3.148e-11
Identity = 124/481 (25.78%), Postives = 195/481 (40.54%), Query Frame = 1
Query:  535 YPIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFS-----SPIYKEFVKE---GLNSVRILRLSATDPDEGINGKIIYKFDPR--FKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPT-PPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTN-----QEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIK--DQNDNAPTLTY----FGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSM--EKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKF 1905
            +P+F E  IE+ I E+  +G ++T   ATD D G N    +  S          F LN    L      + + +PLDRE T  +   ++A DGG    +     + + + D NDN+P        +P+    V      LN+ +I  ++ TD D   NG++    D    F+   +  + F +   +        LDYE    +   ++A +   PP+       +A + I V +  D        ++     SI E N     +  V+ T  ++     I   L            G ++    S + RT      +++DREK  K    IL K   D+ VP  ++ + + +   DQNDN+P  T+    F  P   EN      V  I   D D G+N  VT S+  E   F      +I    GVI+     D E       + T  V A D G   +S+  +++I + DVNDN P F
Sbjct:  246 HPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGL------ITIKEPLDREETPNHKLLVLASDGGLMPARA---MVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNT-KIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAY-------LDYESTKEYAIKLLAADAGKPPL-----NQSAMLFIKVKDENDNAPVFTQSFV---TVSIPENNSPGIQLTKVSATDADSGPNAEINYLL------------GPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAK---DNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVP---ENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDF------TIDSQTGVIRPNISFDREKQ----ESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVF 673          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A0R3UIX6 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS7416 PE=4 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 9.114e-68
Identity = 236/799 (29.54%), Postives = 360/799 (45.06%), Query Frame = 1
Query:  589 IGHTITLPVATDKDFGNNQVETYKISRQEPRTF-----------DNHFRLNVLNTLNSVT-VELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGS------INIAIRIIDENDNMPQFSSPIYKEFVKEGLN--------------------SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAV---------NPTPPVTI----TLYTSTASVEISVLNVYDEPLEINVDYLNNK--------NYSIVEENKSNF-FVAIVTVTSKENDLFRSIQCRLEHFQEILS----LISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVD--------------------SHVP-SSSAKIEIIIKDQNDNAPTLT-------YFGT--------PSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFP-----SLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKAN-----------RIFHLNTTRSLDREKDPKFNFQVIATDSLGN------PTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSE---FNTIEYHLESE----------------------SDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKS 2544
            IG    LP+A D D     V  Y      P  +           +   R  + ++ N +T + LK+ KPLD E    Y+F + A+DG + ++ T +      +++ I + D NDN P F  P  K +     N                       IL+L A D D   N KI Y F P   T   + +YF ++  SG ++L+KPLDYE QT F F V A          NPT    +    TL+T+TA V I+V++  DE   I VD+++N          Y+ VEEN     F+A +  T ++  L   + C  +      S    L SK   +     F++    EI R++I ++   +L +E++D                       P +SS  + I ++D+NDNAP +         +G         P + EN   G++V ++ A D DEGENGR+++S+EK+  P        +  I E  G I  +  ID E+     + +T+ V  +D+G+ PKS   +I I I+D NDN P F      F +MEN      VGEI V DKD   +I L    +    LPF I +  +            +F LNTTR LDRE +  F F ++ATD           T + T TV+V V ++NDN P+IIFP + N T + +S  E +N++ +T++AND+D +     F  ++  +E+                       SD  DI+   G +F  R+M   D G H+ K+ V + G     SS+   V++D S+ +S
Sbjct:  169 IGTKFPLPLARDPDTSQYSVSAYTAEPGLPPEWSLVVETSGSGEEMSMRPKMGSSTNKITGLYLKLQKPLDHEKRKNYTFKIRALDGLEANEITPTGNRKDILHVFIYVEDINDNGPVF-RPREKSYSGVPTNVQLSDWMVTYTATVPESKWIKDPILKLEADDLDGPANSKIHYYFAP--ATSKQVREYFKLDSVSGYLFLRKPLDYELQTEFSFRVTATDVKEESLRGNPTQSQPVQSPSTLHTATAQVVITVIDTNDETPAIEVDFISNGPSKSPLMTKYAEVEENAPPPQFIASIQATDRDAGLSGQVNCIQQPVVNPSSIKAGLWSKPTAAENSSQFQL---DEI-RQEIGRVQYRLLTREALDREDTENGGAYRQVKIICTDAGQPPRTSSTFVNIRVRDENDNAPKIILRQPPDYLYGLESSETDMWPFVFENAPVGSLVTRVNASDLDEGENGRLSYSIEKTEQPDDTVNPFNFFQINEKTGDITTRIEIDREAFEPPLSCVTLKVKVSDNGVPPKSATQEIKIYIRDENDNGPVFQRQEYQFHVMENLPAGYAVGEILVTDKD-EGEIKLGFGMQPHGPLPFTIWQSPSGADNEHKPYSMTLFILNTTRPLDREAEHAFRFTLLATDGPSGYGRSRIGTATATATVEVFVENENDNDPVIIFPQKQNKTFY-LSCHEKKNFELLTINANDKDPSENPHIFELVKSAIEARMINQSSTSNFTKEEGEAGSFRVSDFLDIEPTTGIVFLSRDMKSEDKGVHIFKVQVTDGGVPPRSSSITFFVLVDNSSPRS 958          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A0R3TSV2 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS10747 PE=4 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 1.052e-66
Identity = 237/799 (29.66%), Postives = 358/799 (44.81%), Query Frame = 1
Query:  586 KIGHTITLPVATDKDFGNNQVETYKISRQEPRTF-----------DNHFRLNVLNTLNSVTVE------LKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSIN------IAIRIIDENDNMPQF---SSPIYKEFVKEGLNSV----------------RILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVN-------------PTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNK--------NYSIVEENKSNF-FVAIVTVTSKENDLFRSIQCRLEHFQEIL----------SLISKGDESYKVKSFEIR-----------TNQEIDREKIPKIST----NILCKESVDSHVPSSSAKIEIIIKDQNDNAPTL--------TYFGTPS-------ILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFP-----SLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANR-----------IFHLNTTRSLDREKDPKFNFQVIATDSLGNPT----NSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQT------------SEFNTIEYHLESE----------SDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKS 2544
            ++G    LP+A+D D     V  Y    + P  +           DN+    V  ++ S +V       LK+ KPLD ET  K+SF + A+DG + ++    +N      + I + D NDN P F     P      K  +N+                  IL+L A D D   N K+ Y F P   T   + +YF++N  +G ++L+KPLDYE Q+ + F VIA +                P +  ++ +TA V I+V +  DE  EI +D+++++         Y+ +EEN     F+A +  T ++  +   + C     Q++L          S  S    S   +  EIR           T + +DRE I          I+C + +     +SSA + I I+D+NDNAPT+         Y   PS       + EN   G+++ ++ A D DEGENGR+TFS      P      L    I    G I  K  ID E+     +++ + V A+D+G+ PKS    I I I+D NDN P F  S   F +MEN      VG+I V DKD   +I L         LPF I     +            F LNTTR LDRE +  F F +IATD           S T TV++ V ++NDN P+IIFP + N T + +S+ E +N++ +T++AND+D +            S+   I Y  E+E          SD  DI+   G +F  R+M   D G H+ K+ V + G     SS+   V++D S+ ++
Sbjct:  170 EVGARFPLPLASDPDTRQFSVNAYVAEPEMPSEWSLVTETSGGETDNYIFSKVSPSMISSSVHKITGLYLKLQKPLDHETKMKFSFKIRALDGSEANEYAPVVNRKDILQVYIYVEDINDNGPVFRPQGKPYPVAPPKAQINNWIITYTATVPESKWIKDPILKLVADDRDGPANSKVGYYFAP--ATSKHVQEYFTLNPLNGYLFLRKPLDYELQSEYSFRVIATDMPEDNLRVGIVHGQVSPSSSNIHIATAQVVITVTDTNDEAPEIEIDFISSEPNASPMATKYAEIEENAPPPQFIASIQATDRDAGMSGQVSCAQ---QQVLNPSSSLWPRPSQTSMNTSSSPFQLDEIRQENGRVQYRLLTREALDREDIENGGAYRQVKIVCTD-MGRPPRASSAFVNIRIRDKNDNAPTINLRRPTDFMYSLKPSDGDKWPYVYENAPVGSLITRLNASDLDEGENGRLTFSFVADELPIGSVNPLTLFQINAKTGDITTKVEIDREAYDPPLSSVLLRVKASDNGVPPKSATQDIRIYIRDENDNWPVFQRSEYQFHVMENLDAGYAVGDILVTDKD-EGEIKLTFGMHTYGPLPFTIWSCPYQDDGEHGSYSIYRFILNTTRPLDREVESAFKFTLIATDGGTGQGKSKFGSATATVEIIVENENDNDPVIIFPQKQNKTFY-LSWREKKNFELLTINANDKDPSENPHIFELMKGMSDVQLINYSKENETKKDAEFTLSSDFLDIEPTTGIVFLSRDMRAEDKGIHIFKVQVTDAGVPPRSSSITFFVLVDDSSPRT 960          
BLAST of Protocadherin-9 vs. TrEMBL
Match: U6IWT9 (Protocadherin 11 OS=Echinococcus granulosus OX=6210 GN=EGR_01638 PE=4 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 9.017e-65
Identity = 229/789 (29.02%), Postives = 367/789 (46.51%), Query Frame = 1
Query:  586 KIGHTITLPVATDKDFGNNQVETYKISRQEPRTF---------DNHF---RLNVLNTLNSVT-VELKVFKPLDRETTNKYSFDLMAIDGGQTDQ------KTGSINIAIRIIDENDNMPQFSSPIYKEFV----KEGLNSVR----------------ILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIA------------VNPTP-PVTITLYTSTASVEISVLNVYDEPLEINVDYLNNK--------NYSIVEENKSNF-FVAIVTVTSKENDLFRSIQCRLEHFQEIL----SLISKGDESYKVK---------SFEIRTNQEIDREKIPKIST----NILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTY-------FGT--------PSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPS-----LEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRI-----------FHLNTTRSLDREKDPKFNFQVIATDSLGNPTNS----VTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTS------------EFNTIEYHLESE----------SDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSN 2547
            ++G    LP+A D D     V  Y    + P  +         + +F   +++  ++ N +T + LK+ K LD ET  K++F + A+DG + +       +   + + I + D NDN P F  P  K +     K  L++                  IL+L A D D   N K+ Y F P   T   + ++F++N  +G ++L+KPLDYE Q+ + F VIA            V+  P   + +L+T+TA V I+V +  DE  EI VD+++++         Y+ +EEN +   F+A +  T ++  L   + C  +    +     + I+  +  +++           + + T + +DRE +          I+C + +     +SS  ++I I+D+NDN PT+         +G         P + EN   G++V ++ A D DEGEN R+TFS      PS     L    I E  G I     ID E+     +++ + V  +D+G  PKS   ++ I I D NDN P F  +   F +MEN      VGEI V DKD   +I L    ++   LPF I     R            F LNTTR LDRE + KF F ++ATD  G  + S     T TV++ V ++NDN P+IIFP + N T + +S+ E +N++ +T++AND+D +             +   I Y  E+E          SD  DI+   G IF  R+M + D G HV K+ V + G     SS+   V++D S+ +S+
Sbjct:  169 EVGARFPLPLARDPDTRQYSVNAYVADSEIPSEWSLVTETASGEENFIYSKVSPSSSFNRITGLYLKLQKSLDYETKKKFTFKIRALDGSEVNDFAPIGNRKDVLQVYIYVEDINDNGPVFR-PQRKSYSLTPSKAQLSNWMVTYTATVPESKWIKDPILKLVADDLDGPANSKVGYYFAP--ATSKQVQEHFNLNPLNGYLFLRKPLDYELQSEYSFRVIATDMPEESPRSGMVHGQPFQTSPSLHTATAQVVITVTDTNDEAPEIEVDFISSEPNTSPLAIKYAEIEENAAPPQFIASIQATDRDGGLSGQVSCVQQPVMALWLRPTTAINSTNSPFQLDEIRQENGRVQYRLLTRKALDREDMENGGAYRQVKIICAD-MGQPPRTSSTFVKIRIRDKNDNTPTINLRRSADYAYGLKSIEGDKWPFVFENAPVGSLVTRLNASDLDEGENSRLTFSFVADEPPSGTISPLSLFQINEKTGDITTCMDIDREAYDPPLSSVVLKVKVSDNGTPPKSATQEVRIHILDENDNDPVFQRTEYQFHMMENLPTGYAVGEILVTDKD-EGEIKLSFGMQSYGPLPFTIWPSPFRSGIEHGAYSMTRFILNTTRPLDREVEHKFKFTLLATDGPGGHSKSRAGTATATVEIVVENENDNDPVIIFPQKQNKTFY-LSWREKKNFELLTINANDKDPSENPHIFDLMRGPLDIQMINYSSENETKKDAEVIQSSDFLDIEPTTGIIFLSRDMREEDKGVHVFKVQVTDAGVPPRSSSITFFVLVDDSSPRSS 951          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A0R3X140 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS6873 PE=4 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 7.224e-64
Identity = 228/791 (28.82%), Postives = 360/791 (45.51%), Query Frame = 1
Query:  586 KIGHTITLPVATDKDFGNNQVETYKISRQEPRTF---------DNHF----RLNVLNTLNSVT-VELKVFKPLDRETTNKYSFDLMAIDGGQTDQ------KTGSINIAIRIIDENDNMPQF--------SSPIYKEFVKEGLNSVR-----------ILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVI-----------AVNPTPPVTIT--LYTSTASVEISVLNVYDEPLEINVDYLNNK--------NYSIVEENK-SNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKS----------------FEIRTNQEIDREKIPKIST----NILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTY-------FGT--------PSILENTKPGTVVFKIIAQDKDEGENGRVTFSM-----EKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVI----LKKAN-------RIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTG----TVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTS------------EFNTIEYHLESE----------SDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKS 2544
            ++G    LP+A D D     V  Y    + P  +         + +F      +  +  N +T + LK+ KPLD ET  K++F + A+DG + ++      K   + I I + D NDN P F        S+P   +     +               IL+L A D D   N K+ Y F     T   + +YF++N  +G ++L+KPLDYE Q+ F F VI           AV  + P   +  L+T+TA V I+V +  DE  EI VD+++++         Y+ +EEN     F+A +  T ++  L   + C     Q ++ L  K   +  + S                + + T + +DRE +          I+C + +     +SS  + I I+D+NDN PT+         +G         P + EN   G++V ++ A D DEGENGR+TFS      +  A   L    + E  G I     ID E+     +++ + V  +D+G  P+ T  +I + I D NDN P F  +   F +MEN      VGEI V DKD   ++ L    ++   LPF I    L   N         F LNTTR LDRE +  F F ++ATD  G  + S +G    T+++ V ++NDN P+IIFP + N T + +S+ E +N++ +T++AND+D +             +   I Y  E+E          SD  DI+   G +F  R+M + D G HV K+ V + G     +S+   V++D S+ +S
Sbjct:  169 EVGSRFPLPLARDPDTRQYSVNAYMADPEIPSEWALVTETANGEENFIYSKLSSSTSPSNRITGLYLKLQKPLDHETKKKFAFKIRALDGSEMNEITPISNKKDILQIYIYVEDVNDNGPVFRPQRKSYSSTPTKAQLANWIVTYTATVPESRWIKDPILKLVADDMDGPANSKVGYYF--AAATSKQVQEYFNLNPLNGYLFLRKPLDYELQSEFSFRVIATDMPEESSRSAVAHSHPFQTSSNLHTATAQVVITVTDTNDEAPEIEVDFISSEPNTSPLAIKYAEIEENALPPQFIASIQATDRDAGLSGQVSCVQ---QPVMVLWPKPTTAMNITSSPFQLDEIRQENGRVQYRLLTREALDREDMESGGAYRQVKIICTD-MGRPPRTSSTFVNIRIRDKNDNTPTINLKPLADQVYGLKSLEGDKWPFVYENAPVGSLVTRLNATDLDEGENGRLTFSFIADEPQSGAISPLSLFQVNEKTGDITTSMEIDREAYDPPLSSVVLQVKVSDNGTPPRFTTQEIRVYILDENDNDPVFQRTDYQFHVMENLPSGYAVGEILVTDKD-EGEVKLSFGMQSYGPLPFTISPSQLHGENDHNAYSMTRFILNTTRPLDREVEHNFKFTLLATDGFGGHSRSRSGTATATIEIFVENENDNDPVIIFPQKQNKTFY-LSWREKKNFELLTINANDKDPSENPHIFDLIKGRLDVQMINYSSENETKKIAEITQSSDFLDIEPTTGIVFLSRDMREEDKGVHVFKVQVTDAGVPPRSTSITFFVLVDDSSPRS 951          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A0R3SLI4 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS5797 PE=4 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 7.269e-64
Identity = 231/797 (28.98%), Postives = 358/797 (44.92%), Query Frame = 1
Query:  586 KIGHTITLPVATDKDFGNNQVETYKISRQEPRTF-----------DNHFRLNVLNTL-----NSVT-VELKVFKPLDRETTNKYSFDLMAIDGGQTDQ------KTGSINIAIRIIDENDNMPQFSS-----PI-------------YKEFVKEG-LNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVN-------------PTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLN--------NKNYSIVEENKSNF-FVAIVTVTSKENDLFRSIQCRLEH-FQEILSLISKG------------------DESYKVKSFEIRTNQEIDREKIPKIST----NILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTY-------FGT--------PSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFP-----SLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANR-----------IFHLNTTRSLDREKDPKFNFQVIATDSL----GNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQT------------SEFNTIEYHLESE----------SDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKS 2544
            ++G    LP+A+D D     V  Y    + P  +           DN+    V  ++     N +T + LK+ KPLD ET  K+SF + A+DG ++++      +   + + I + D NDN P F       P+             Y   V E       IL+L   D D   N K+ Y F P   T   + +YF++N  +G ++L+KPLDYE Q+ + F VIA +                P +  ++T+TA V I+V +  DE  EI VD+++           Y+ +EEN     F+A +  T ++  +   + C  +  F    SL  +                    E+ +V+ + + T + +DRE            I+C + +     +SS  + I I+D+NDNAPT+         +G         P + EN   G++V ++ A D DEG+NGR+TFS      P      L    I E  G I  K  ID E+     +++ + V  +D+G+ PKS    + I I+D NDN P F  +   F IMEN       GEI V DKD   +I L         LPF I   + +            F LNTTR LDRE +  F F +IATD       +   S T TV+V V ++NDN P+IIFP + N T + +S+ E +N++ +T++AND+D +            S+   + Y  E++          SD  DI+   G +F  R+M   D G HV K+ V + G     SS+   V++D S+ ++
Sbjct:  170 EVGARFPLPLASDPDTRQFSVNAYVAEPEMPSEWSLVTETSGGESDNYIFSKVSPSMVSSPANKITGLYLKLQKPLDHETKMKFSFKIRALDGSESNEYAPVSNRKDILQVYIYVEDINDNGPVFRPQGKPYPVAPPKAQISNWMVTYTATVPESKWIKDPILKLITDDIDGPANSKVSYYFAP--ATSKHVQEYFTLNPLNGYLFLRKPLDYELQSEYSFRVIATDMPEDNLRGGVIHGQVSPSSSNIHTATAQVVITVTDTNDEAPEIEVDFISIEPNASPMATKYAEIEENAPPPQFIASIQATDRDAGMSGQVSCVQQQVFNPSSSLWPRPSKSSMNISSSPFQLDEIRQENGRVQ-YRLLTREALDREDTENGGAYRQVKIICTD-MGRPPRASSTFVNIRIRDKNDNAPTINLRRPTDFIYGLKPSDGDKWPYVYENAPVGSLVTRLNASDLDEGDNGRLTFSFVADELPVGSVNPLTLFQINEKTGDITTKVEIDREAYDPPLSSVLLRVKVSDNGVPPKSATQDVRIYIRDENDNGPVFQRTEYQFQIMENLPAGYAAGEILVSDKD-EGEIKLTFGMHTYGPLPFTIWPCSYQGGGEHGSYSMYRFILNTTRPLDREVEHSFKFTLIATDGTTGQGKSKVGSATATVEVIVENENDNDPVIIFPQKQNKTFY-LSWREKKNFELLTINANDKDPSENPHIFELMKGASDTQMVNYSNENDTKKDAEFTQSSDFLDIEPTTGIVFLSRDMRAEDKGIHVFKVQVTDAGVPPRSSSIAFFVLVDDSSPRT 960          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: ENSAMXT00000036470.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:10716691:10726912:1 gene:ENSAMXG00000037804.1 transcript:ENSAMXT00000036470.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 227.639 bits (579), Expect = 5.847e-61
Identity = 232/817 (28.40%), Postives = 387/817 (47.37%), Query Frame = 1
Query:  223 VINISDDTALNIKLYDLKKLIPQTKMTYHLLKSSKAHSYFTIKNDNLFTNTLVDMDSMCQNVGECCNKAKEICDFSIAIACRENQESEVXXXXXXXXXXXXXXXYPIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALIL-DYFSINEDSG-------EIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNY--SIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYK----VKSF--EIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFG-TPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLE-----YLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVL-----RSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHV--ISYLEPRNYKFMTVSANDQDQTSEFNT-IEYHLESE--SDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRIENFNI 2574
            V N++ D  LNI + DL     + +M + ++ S K+    ++K   LF    +D +++C  + +C    + +    + +   E    ++                P+F      + I+E   +G   TLP+A D D G+N V+ YK+S  E      +F LNV N  +S +VEL + K LDRET +     L AIDGG+    +G+  IAI I+D NDN P FS  +YK  VKE      ++L LSATD DEG+N +I Y      + G L   +YFS+N  SG       ++ L+K LD EKQ   +  + A++   P      + T  + I+V++V D     N    + + Y  S++E       V  +  T  +  L   I         + SLIS G E +     + S   EI     +DRE       +   ++   S   +S  K+ I + D ND+ P ++    T ++ E+   GT V  I   D D G+NG V+  ++ +   +L+     Y S+        V   +D E  + Q++   + + ATD G  P S+ + +++ I DVNDN P+F+    +F + EN+   + +  +  +D DV+++  +V      ++ + + +  V +   +   +  + +S + E+   F F+V ATDS G P  S   TV+V ++D+NDN P+I+ P     +++   I Y     Y    V A D D  S +N  + YH+     +++F I    G I T+R M+ +D+  H + ITV + G  S+ ++V V+VV+ A +  S  P +    I
Sbjct:   44 VGNVAKD--LNINVQDL-----EARM-FRIVSSRKSFD-VSLKTGALFVTDRIDREALCSTIKKCSMHIEAMAQNPLKLFRIEVHIMDINDNA------------PLFPVSKQILNITELSAVGEKFTLPLAEDPDTGSNAVKNYKLSPNE------YFSLNVQNGEDSGSVELVLQKALDRETQSVIHLILTAIDGGKP-PLSGTTEIAILILDVNDNSPVFSQSLYKVKVKENAAFGTKVLSLSATDLDEGLNSEITYAI---IRQGTLSANEYFSLNVQSGGEQNISPQLVLQKALDREKQATVQLILTALDGGRP----HRSGTLDLSINVIDVND-----NTPAFSKEMYKVSVLENTLPGTPVIKLNATDLDAGLNGEI---------VYSLISHGKEKWADIFAINSITGEITVKGPLDREDTAAFELHAQAQDK-GSSPRASHCKVLIEVLDVNDSPPVISVTSLTSTVREDATTGTAVGLITIADNDIGKNGEVSAKVKGTGPFALQASYKNYYSL-------VVNGPLDRED-MPQYS---VTILATDKGTPPLSSSIVLAVDIADVNDNAPRFSDIVTVFYVKENSPSGNIIATVTAQDPDVNENAQIVYSLINRKNMDSSWMSMVDINPVSGDIY--SKQSFNYEEVKSFQFKVQATDS-GAPPLSSNVTVNVFIVDENDNRPVILPPYSEAGSLNTENIPYSAEAGYFVGKVRAIDAD--SGYNALLSYHITEPKGNNLFRIGSSSGEIRTKRRMSDNDLKTHPLVITVCDHGEPSLSATVSVDVVV-AESMDSVRPSLREVQI 793          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: ENSAMXT00000049785.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:10740740:10748152:1 gene:ENSAMXG00000032814.1 transcript:ENSAMXT00000049785.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 181.03 bits (458), Expect = 2.509e-46
Identity = 205/687 (29.84%), Postives = 333/687 (48.47%), Query Frame = 1
Query:  199 IKKNTCMEVINISDDTALNIKLYDLKKLIPQTKMTYHLLKSSKAHSYFTIKNDNLFTNTLVDMDSMCQNVGECCNKAKEICDFSIAIACRENQESEVXXXXXXXXXXXXXXXYPIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLN-TLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFGTP----SILENTKPGTVVFKIIAQDKDEGENGRVTFSM--------EKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHM-IFTIMENNMKNS-----FVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILK-KANRIFHLNTTRSLDREK------DPKFNFQVIATDSLGNPTNSVT 2178
            +KK T   V N++ D  LN+ + +L     Q++M   +  S+K +    +K   LF N  +D + +C+        +K+ C  +I +      ++ +    +++++ D NDN P F    +   I E+V  G   +LP+A D D G N +++Y +S  E      HF L+V +    SV+ EL + KPLDRE  +     L A+DGG+   K+ +++I + ++D NDN P FS P+YK  VKE L    +I+ ++ATD DEG NG+I+Y    +    A  L  FSINE +GEI +K  +DYE+    +  + A + +    +TL      V I V +V D   EI V  L +   SI E+ K    VA++TVT K++     + C++           +   SYK  S+ +  N+ +DRE + + +  ++  +     + SS+A I + I D NDN+P    F  P    S+ EN+  G ++  I A D D GEN  V++S+        + S   ++ YL+ GE   +  ++S    E+   QF      V ATD GI   S+++ +++ I D NDN P   + +    T+   N+  S     FVG+I   D D          S   A+L + I + K N +F + ++    R K      D K +  V+     G P+ S T
Sbjct:   36 VKKGTV--VGNLAKD--LNVDVQEL-----QSRMLQVVAGSNKRYFDVNLKTGVLFVNDRLDREELCE--------SKQKCSLNIEVMA----QNPIKLYRVEVNVADINDNSPFFPLETLVKNIIENVVPGDRFSLPLARDLDVGMNSLKSYTLSPNE------HFSLDVQSYGEQSVSAELVLQKPLDREKQSIVKLKLTAVDGGKP-AKSATMDIIVNVLDINDNNPVFSKPLYKIKVKENLPFGTKIITVAATDSDEGTNGEIMYSLVEQDGNSASRL--FSINEVNGEISVKGNIDYEENPAIELRIQAQDKSSSPRLTL----CKVLIEVEDVNDNAPEILVTLLRS---SISEDIKPGADVALITVTDKDDGKNGKVDCKIVGTSPF-----RLQLSYK-NSYSLIVNEPLDRELVSQYNITVIASDEGSPSL-SSTAVITVHISDVNDNSPV---FQAPVIHISVKENSPVGGLLATITAHDSDIGENAHVSYSLIDGESSRTQVSTLMNINYLT-GE---LYSLQSFNYEETKQIQFK-----VQATDAGIPALSSNVTVNVFILDENDNRPVILAPYSEAGTVNTENIPYSAEAGYFVGKIRAVDAD----------SGYNALLSYHITEPKGNNLFRVGSSSGEIRTKRRMSDNDLKTHPLVLTVSDHGEPSLSAT 656          

HSP 2 Score: 134.035 bits (336), Expect = 2.007e-31
Identity = 159/571 (27.85%), Postives = 263/571 (46.06%), Query Frame = 1
Query:  847 IAIRIIDENDNMPQFS-SPIYKEFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDS--GEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISK-GDESYKVKSF-----EIRTNQEIDREKIPKISTNILCKESVDSHVPSSS-AKIEIIIKDQNDNAP-TLTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDD--INLVLRSKNPAMLPFVILKKANRI-FHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHV--ISYLEPRNYKFMTVSANDQDQTSEFNT-IEYHLESE--SDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSS 2502
            + + + D NDN P F    + K  ++  +   R     A D D G+N    Y   P        LD  S  E S   E+ L+KPLD EKQ+  K  + AV+   P      ++T  + ++VL++ D     N    +   Y I  +    F   I+TV + ++D          + + + SL+ + G+ + ++ S      EI     ID E+ P I   I  ++   S  P  +  K+ I ++D NDNAP  L      SI E+ KPG  V  I   DKD+G+NG+V   +  ++ P    LS   +  +I V   +D E  ++Q+    I V A+D G    S+   I++ I DVNDN P F +  +  ++ EN+     +  I   D D+ ++  ++  L     +      L   N +   L + +S + E+  +  F+V ATD+ G P  S   TV+V ++D+NDN P+I+ P     TV+   I Y     Y    + A D D  S +N  + YH+     +++F +    G I T+R M+ +D+  H + +TV + G  S+ ++
Sbjct:  116 VEVNVADINDNSPFFPLETLVKNIIENVVPGDRFSLPLARDLDVGMNSLKSYTLSPNEH---FSLDVQSYGEQSVSAELVLQKPLDREKQSIVKLKLTAVDGGKPAK----SATMDIIVNVLDIND-----NNPVFSKPLYKIKVKENLPFGTKIITVAATDSD-------EGTNGEIMYSLVEQDGNSASRLFSINEVNGEISVKGNIDYEENPAIELRIQAQDK--SSSPRLTLCKVLIEVEDVNDNAPEILVTLLRSSISEDIKPGADVALITVTDKDDGKNGKVDCKIVGTS-PFRLQLSYKNSYSLI-VNEPLDREL-VSQYN---ITVIASDEGSPSLSSTAVITVHISDVNDNSPVFQAPVIHISVKENSPVGGLLATITAHDSDIGENAHVSYSLIDGESSRTQVSTLMNINYLTGELYSLQSFNYEETKQIQFKVQATDA-GIPALSSNVTVNVFILDENDNRPVILAPYSEAGTVNTENIPYSAEAGYFVGKIRAVDAD--SGYNALLSYHITEPKGNNLFRVGSSSGEIRTKRRMSDNDLKTHPLVLTVSDHGEPSLSAT 656          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 181.03 bits (458), Expect = 4.814e-46
Identity = 226/856 (26.40%), Postives = 370/856 (43.22%), Query Frame = 1
Query:  157 MHVSYVWYLWLILFIKKNTCMEVINISDDTALNIKLYDLKKLIPQTKM------------TYHLLKSSKAHSYFTI--KNDNLFTNTL-VDMDSM--CQNVGECCNKAKEICDFSIAIA-CRENQESEVXXXXXXXXXXXXXXXYPIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNS---VRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYS-----IVEENKSNFFVAIVTVTSKENDLFRSIQCRLEH---FQEILSLISKGDESYK-VKSFEIRTNQEIDREKIPKISTNILCKESVDSHVP--SSSAKIEIIIKDQNDNAPTLTYFGTP----SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESES--DVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRIENFNINNGGLMAHNSFS 2610
            M  S  W+L   L +           S ++AL   LY +++  P   +            + HL K      Y  +  K   +FT  + +D +++  C+  G+ C       +F +++    +NQ   +I   I++   + N   P F    + + + E+  +G T  +P ATD+D   N V  Y +S     +    F L + N       +L V   LDRE  + Y   + A+DGG T  +  S  + + I D NDN PQF    Y+  V E  NS     +L++ A D D G NG+I Y      +    +     I   +G I +K PLD E+ + FKF VIA +  P    +  +ST  V I V +  D    + +  +  + +S     I E+      VA+V V+ K+      + C +     FQ    L   GD S    K + ++T   +D E+I      I+    VDS  P  SS+  + + + D NDN+P    F  P       E  +PG  V  +IA D D G N  + +S+   +  +     I  + G ++ +S +D E            VTA D G+        + I + D NDN PKF  S   F+++EN    S VG + V D D  ++  + L S  P +  FV+      I    ++ S DREK+  + F++ A D    P +S  G V + V+D+NDN P++  PS  N++   +S L   +     V A D D  S    + Y +   +  ++F I   +G I   +E+ +   G H + + V + G  S  +   V++ ++ +   SN   +E       GL+ H+ ++
Sbjct:    1 MDFSVGWFLLFALLVD----------SINSALGGILYHVREEQPPNTLIGSLAADQGLPDSGHLYKLEVGAPYLRVDGKTGEIFTTEIPIDRETLKDCRIKGKPC-----FLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNT--PQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEAS--ALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGG-TPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSE--NSPVGYSVLQVKANDSDLGPNGEIEYTI---HQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGP----SPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQ----LRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVA---VDSGNPALSSTNSLRVQVTDTNDNSPI---FSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSS-TRGLFEIDPSSGEVRARSPLDREHK----ERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQL-SVEPDVGNFVVQNGTGTIL---SSISFDREKESSYTFRLKAVDGGEPPRSSYVG-VTINVLDENDNAPVVTKPS--NSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELV-YSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYVNETI--SNVSLVE-------GLVGHSLYT 795          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 181.415 bits (459), Expect = 6.034e-46
Identity = 226/856 (26.40%), Postives = 370/856 (43.22%), Query Frame = 1
Query:  157 MHVSYVWYLWLILFIKKNTCMEVINISDDTALNIKLYDLKKLIPQTKM------------TYHLLKSSKAHSYFTI--KNDNLFTNTL-VDMDSM--CQNVGECCNKAKEICDFSIAIA-CRENQESEVXXXXXXXXXXXXXXXYPIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNS---VRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYS-----IVEENKSNFFVAIVTVTSKENDLFRSIQCRLEH---FQEILSLISKGDESYK-VKSFEIRTNQEIDREKIPKISTNILCKESVDSHVP--SSSAKIEIIIKDQNDNAPTLTYFGTP----SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESES--DVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRIENFNINNGGLMAHNSFS 2610
            M  S  W+L   L +           S ++AL   LY +++  P   +            + HL K      Y  +  K   +FT  + +D +++  C+  G+ C       +F +++    +NQ   +I   I++   + N   P F    + + + E+  +G T  +P ATD+D   N V  Y +S     +    F L + N       +L V   LDRE  + Y   + A+DGG T  +  S  + + I D NDN PQF    Y+  V E  NS     +L++ A D D G NG+I Y      +    +     I   +G I +K PLD E+ + FKF VIA +  P    +  +ST  V I V +  D    + +  +  + +S     I E+      VA+V V+ K+      + C +     FQ    L   GD S    K + ++T   +D E+I      I+    VDS  P  SS+  + + + D NDN+P    F  P       E  +PG  V  +IA D D G N  + +S+   +  +     I  + G ++ +S +D E            VTA D G+        + I + D NDN PKF  S   F+++EN    S VG + V D D  ++  + L S  P +  FV+      I    ++ S DREK+  + F++ A D    P +S  G V + V+D+NDN P++  PS  N++   +S L   +     V A D D  S    + Y +   +  ++F I   +G I   +E+ +   G H + + V + G  S  +   V++ ++ +   SN   +E       GL+ H+ ++
Sbjct:   37 MDFSVGWFLLFALLVD----------SINSALGGILYHVREEQPPNTLIGSLAADQGLPDSGHLYKLEVGAPYLRVDGKTGEIFTTEIPIDRETLKDCRIKGKPC-----FLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNT--PQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASA--LFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGG-TPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSE--NSPVGYSVLQVKANDSDLGPNGEIEYTI---HQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGP----SPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQ----LRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVA---VDSGNPALSSTNSLRVQVTDTNDNSPI---FSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSS-TRGLFEIDPSSGEVRARSPLDRE----HKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQL-SVEPDVGNFVVQNGTGTIL---SSISFDREKESSYTFRLKAVDGGEPPRSSYVG-VTINVLDENDNAPVVTKPS--NSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELV-YSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYVNETI--SNVSLVE-------GLVGHSLYT 831          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: ENSAMXT00000034478.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:10757013:10760663:1 gene:ENSAMXG00000031253.1 transcript:ENSAMXT00000034478.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 178.718 bits (452), Expect = 1.092e-45
Identity = 194/686 (28.28%), Postives = 335/686 (48.83%), Query Frame = 1
Query:  100 WL*AILQFNVFNRNILFEKMHVSYVWYLWLILFIKKNTCMEVINISDDTALNIKLYDLKKLIPQTKMTYHLLKSSKAHSYFTIKNDNLFTNTLVDMDSMCQNVGECCNKAKEICDFSI-AIACRENQESEVXXXXXXXXXXXXXXXYPIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKE-GLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVP--SSSAKIEIIIKDQNDNAPTLTYFG-TPSILENTKPGTVVFKIIAQDKDEGENGRVTFSM---EKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHM-IFTIMENNMKNS-----FVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILK-KANRIFHLNTTRSLDREK 2112
            W+ A+L    ++    F +  +SY     +   +KK     V N++ D  LNI + +L     Q++M   +  S+K +    +K   LF N   D + +C+         K+ C  +I A+A     ++ +    I+++I D NDN P+F+ + + + ISE+V  G   +LP+A D D G + V+ YK+S  E      +F ++V  +  S + EL + K +DRE        L A DGG+   ++G++ I + ++D NDN P FS P+YK  V+E      +IL +SATD DEGING+++Y      ++   +++ FSIN  SG+I +K  +DYE+    +  + A + +     +       V I VL+V D   E++V  L +   S+ E+ K     A+VTV+ +++     + CR      + +L  K   SYK  S+ +  N+ +DRE + + +  I+     D  +P  SS+  + +++ D NDN P       + ++ EN+  G ++  I AQD D+GENG+V++S+   E +       +++    G +      D E +      +   V ATD G  P S+++ +++ I D NDN P   S +    ++   N+  S     FVG+I   D D          S   A+L + I + K N +F + ++    R K
Sbjct:   12 WIRALLLLFWWD----FSRCQISYS----ISEEVKKGAV--VGNLAKD--LNIDVQEL-----QSRMFQVVAGSNKRYFDVNLKTGVLFVNDRFDREELCER--------KQKCSLNIEAMA-----QNPLTLYRIEVNILDINDNSPVFSLQTLLLNISENVLPGDRFSLPLAHDMDVGTHAVKNYKLSANE------YFSIDVQISGESASAELVLQKAIDREKQALVKLTLTATDGGKP-PRSGTLEILVNVLDINDNYPVFSQPLYKVKVQENAAVGTKILTVSATDLDEGINGEVVYAIVGHERSS--VVNLFSINPHSGDITVKGNIDYEENAAIELRIQAHDKSH----SPRHGNCKVLIEVLDVNDNAPEVSVTLLMS---SVSEDTKPGTGFALVTVSDQDSGTSGKVDCR------VTALPFKLQSSYK-NSYSLIVNEPLDRECVSQYNVTIVAN---DEGIPPLSSTMVLHVLVSDVNDNVPLFPALVISINVQENSPAGVLLSTITAQDVDDGENGQVSYSLINGEGTGTLVSTLMNLNSLTGELYCLQSFDYEDT----KQIQFKVQATDSGTPPLSSNVTVNVFILDENDNRPVILSPYSETGSVNTENIPYSADAGYFVGKIRAIDAD----------SGYNALLSYHITEPKGNNLFCIGSSSGEIRTK 627          

HSP 2 Score: 129.798 bits (325), Expect = 4.139e-30
Identity = 157/576 (27.26%), Postives = 252/576 (43.75%), Query Frame = 1
Query:  847 IAIRIIDENDNMPQFSSPIYKEFVKEG-LNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSIN------EDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSI-VEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSF-------EIRTNQEIDREKIPKISTNILCKESVDSHVPS-SSAKIEIIIKDQNDNAPTLTY-FGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINL---VLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHV--ISYLEPRNYKFMTVSANDQDQTSEFNT-IEYHLESE--SDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKS 2499
            I + I+D NDN P FS       + E  L   R     A D D G +    YK            +YFSI+        S E+ L+K +D EKQ   K  + A +   P      + T  + ++VL++ D     N    +   Y + V+EN +   V    +T    DL   I        E++  I   + S  V  F       +I     ID E+   I   I   +   SH P   + K+ I + D NDNAP ++      S+ E+TKPGT    +   D+D G +G+V   +  +A P     S   +  +I V   +D E  ++Q+    + + A D GI P S+ + + + + DVNDNVP F +  +   + EN+     +  I  +D D  ++  +   ++  +    L   ++   +    L   +S D E   +  F+V ATDS G P  S   TV+V ++D+NDN P+I+ P     +V+   I Y     Y    + A D D  S +N  + YH+     +++F I    G I T+R M+ +D+  H + ITV + G  S+ +
Sbjct:  117 IEVNILDINDNSPVFSLQTLLLNISENVLPGDRFSLPLAHDMDVGTHAVKNYKLSAN--------EYFSIDVQISGESASAELVLQKAIDREKQALVKLTLTATDGGKPPR----SGTLEILVNVLDIND-----NYPVFSQPLYKVKVQENAA---VGTKILTVSATDLDEGIN------GEVVYAIVGHERSSVVNLFSINPHSGDITVKGNIDYEENAAIELRIQAHDK--SHSPRHGNCKVLIEVLDVNDNAPEVSVTLLMSSVSEDTKPGTGFALVTVSDQDSGTSGKVDCRV--TALPFKLQSSYKNSYSLI-VNEPLDREC-VSQYN---VTIVANDEGIPPLSSTMVLHVLVSDVNDNVPLFPALVISINVQENSPAGVLLSTITAQDVDDGENGQVSYSLINGEGTGTLVSTLMNLNSLTGELYCLQSFDYEDTKQIQFKVQATDS-GTPPLSSNVTVNVFILDENDNRPVILSPYSETGSVNTENIPYSADAGYFVGKIRAIDAD--SGYNALLSYHITEPKGNNLFCIGSSSGEIRTKRRMSDNDLKTHPLVITVCDHGEPSLSA 654          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 161.77 bits (408), Expect = 2.649e-40
Identity = 172/673 (25.56%), Postives = 295/673 (43.83%), Query Frame = 1
Query:  583 VKIGHTITLPVATDKDFGNNQV--ETYKI-SRQE------PRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPT-PPVTITLYTSTASVEISVLNVYDEPLEINVDYL--NNKNYSIVEENKSNFFVAIVTVTSKE-----NDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFGTPSILENTKP-GTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLN-------TTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLES-ESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVI 2523
              +G  + L  A D+D G N V    YKI S  E      PR       L++  T            PLDRE    Y+  + A DGG + ++ G + + + + D NDN P F  P Y+  V E       LR    D      G +   FDP+                +G +  ++PLD+E +  +   + A +   PP++       A+  I +L+V D    I   YL    ++ S+ E        A+VTVT  +      +L  SI    E    +L   + G    +V    ++   ++DRE+IP  +  IL  ++      S++A + + + D ND+AP        + L    P G+ V  + A D D G N ++ +S+       L + S+ E+ G++     +D E +    +++ + ++A D G +PK+    +++T+ DVND  P FT +  + T +EN++   FV  +   D D+ +  N  +R      +P     +   +F L+       T +SLDRE+  ++   V A D  G+P    T  V V V D NDN P + +P Q  A+   I   EP      TV+A D D+ +   T+ Y L + ++  F ++   G + TR  + + +   + +++T  + G+   +S   V + +
Sbjct:   37 AAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATT-----------GPLDREANPSYALAVQAEDGG-SPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAALR----DLLHRGRGPLAVPFDPK----------------TGMVSTRQPLDFEARRQYTLSLRAADGGNPPLS-----GRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLH--APGVPGLRV----LKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGN--DLGWFSVDESTGLVTTDGKVDREVA----SSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGE--NGTVRYNFDPDMP----AQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDR-GSPPLGSTAKVTVVVGDLNDNHP-VFYPVQYFAS---ILENEPGGTAVTTVTATDPDRGAN-GTVRYQLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITV 648          

HSP 2 Score: 134.42 bits (337), Expect = 6.199e-32
Identity = 153/612 (25.00%), Postives = 278/612 (45.42%), Query Frame = 1
Query:  742 LKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVRILR-LSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIA----VNPTPPVTITLYTSTASVEISVLNVYDEP-LEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSF--EIRTNQEIDREKIPKISTNILCKESVDSHVP--SSSAKIEIIIKDQNDNAPT---LTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVI--DQNDNFPIIIFPSQNNATVHV-ISYLEPRNYKFMTVSANDQDQTSEFNTIEYHL--ESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVI 2523
            LKV   LDRE    Y+  ++A D G+   ++ + ++ + + D ND+ P+F+   Y   + EG  +   ++ ++A D D G+N K+ Y            L +FS++E +G +     +D E  +     + A      P      T YTS   + +++L+V DEP L     Y+     + VE +    FV  V+V++ ++DL  +   R     +   + ++  E +++ S   ++ T + +DRE++ +     L  ++ D   P   S+AK+ +++ D NDN P    + YF   SILEN   GT V  + A D D G NG V + +            +    G +  +  +D E    +     + VTA D G     +   ++IT+ D  D  P F      F + EN    + VG +     D++ ++  ++ S +     F I     RIF  N   ++DRE+   +  +V+A       +  V G   V V+  D N++ P+      + A+  V I+  EP N +F +V A D+D + +   ++Y +   +  + F I   +G ++ R E+ +    E+ + ++  + G   + SSV VNV +
Sbjct:  292 LKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSI-----VSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPK-----TAYTS---LTVTLLDVNDEPPLFTQTKYV----ATAVENSLPGLFV--VSVSAADSDLGENGTVRYNFDPD---MPAQYREMFRLDSLTGKVTTLKSLDREELEEYP---LVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFA--SILENEPGGTAVTTVTATDPDRGANGTVRYQLTAG---DAARFQVNAVTGAVSTRVSLDRE----ERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNANVTYLIVSGD-QRGSFSIEWSGGRIFTAN---AIDREEQAFYQLRVVAN------SGGVAGEASVSVLVHDVNNHAPVF-----DRASYEVSIAEDEPVNSRFFSVRATDKD-SGKNGEVKYEIGEGNGGEKFGI-FPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTV 852          

HSP 3 Score: 122.865 bits (307), Expect = 2.346e-28
Identity = 133/537 (24.77%), Postives = 227/537 (42.27%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRET------TNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGL-NSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNP-TPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEII-IKDQNDNAPTLTYFGT-PSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIK---PKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDRE 2109
            P+FN  +      E  ++G  +    ATD D G+N   TY   + +           V   L+S T  +   +  DRE          +SF ++A DGG+         + + + D NDN PQF+  +Y+  V E   N  ++LR++A+D DEG+NG + Y  +   + G      F+++  +G+I L   LD E+   +   V A +  T P+      ++ +V + VL+  D P       L     S+     +     ++T+T+ + D   S   R      I++  +    +    +  +   + +D E       N+  ++      P SSA I ++ ++D NDN P         SI+EN   GT V  + A+D D   NG + +S+ +  FP   + +I    G I   + ID E +   F    + V ATD  I     +S    +++ + D NDN P+F +   I          S VG ++  D D  +  N  +R         ++ +   R   + T+  LDRE
Sbjct:  860 PLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQ-----------VNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGK-----FTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLA-----ASCTVAVQVLDENDNPPRFTESLL-----SVDALESTRVGELLITLTASDEDTGPSGDVRYA----IVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDG--GRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQ-FPPGAHFTIDPESGEICTAAEIDREVTGGLFE---VTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGLRAAAGSVVGTLQASDPDEAE--NAAVRYAVTGGDAAILFRLDRRTGIIETSTELDRE 1358          

HSP 4 Score: 117.857 bits (294), Expect = 9.059e-27
Identity = 155/626 (24.76%), Postives = 274/626 (43.77%), Query Frame = 1
Query:  616 ATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYK-EFVKEGLNSVRILRLSATDPDEGINGKIIYKFD-PRFKTGALILDYFSINEDSGEIYLKKPLDYEK------QTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYK----VKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLT-YFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVE--DKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDRE-KDPKFNFQVIATDSL--GNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLES--ESDVFDIDRQEGTIFTRREMAK 2433
            ATDKD G N    Y+I        +   +  +         +L V   LDRET  +YS  + A+D G  +  + S+ + + ++D NDN P F+S  Y   F +E      +  + ATD D G NG + Y F+ P+          F ++ ++G I   +  D E          F F V+A +   P  +      A+V++ V +V D P +    +  +   + V E+ SN    ++ VT+  +D+   +   L +       I++G+E  K      + +I     +DRE+    +  +   +S  S + ++S  + + + D+NDN P  T    +   LE+T+ G ++  + A D+D G +G V +++   A  +    +I  + G + +   +D E+         + V+A D G  P+S+   + + ++D NDN P F    +  +IMEN    + V  +     D DV+ +++  +  + P    F I  ++  I    T   +DRE     F   V ATD     +   S    V V V D+NDN P  + P+     + V            T+ A+D D+ +E   + Y +     + +F +DR+ G I T  E+ +
Sbjct:  782 ATDKDSGKNGEVKYEIGEG-----NGGEKFGIFPD-----GQLYVRYELDRETREEYSLTVSAMDTG-VEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVN--------FELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPL---QDRATVQVFVQDVNDNPPQ----FAKSVYQASVSESASN-LTQLLRVTA--SDVDEGVNGALRY------AINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPL-AASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAI--VAGNTHATFAIDRSTGSVFLARRLDFETQ----RLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEIC---TAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPT----AILVDGLRAAAGSVVGTLQASDPDE-AENAAVRYAVTGGDAAILFRLDRRTGIIETSTELDR 1357          

HSP 5 Score: 112.464 bits (280), Expect = 3.521e-25
Identity = 136/568 (23.94%), Postives = 236/568 (41.55%), Query Frame = 1
Query:  592 GHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIY-----KEFVKEGLNSVRILR-LSATDPDEGINGKIIYKFDPR----FKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVK---SFEIRTNQEIDREKIPKISTNILCKESVDSHVP----SSSAKIEIIIKDQNDNAPTLTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSME-------KSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFP 2223
            G  I    ATD D G N + TY +       F       V++  + V   L+  + LDRE    Y   + A DG  T      +++A+R  D NDN P+FS   Y     ++   +G  +  ++  + A D D G  G++ Y   P     +  GA     F ++  +G + + +PLD E +  +     A +           +TA + ++VL+  D     N   + N + +      +    +++ +++ ++D    +   LE        IS GD   +       ++   + +DRE+  +   N++ + S  +  P    SS+ ++ +I+ D NDNAP  T   +    E++  G VV  + A D D G N  V +++          A       ++    G +++   +D E+   Q   LT++  A D G  P ++   +++T+ D NDN P+F        I E+    + V  +   D D  +  N  LR    +  P    +    +  L   R LDRE+   +   V A D  G P  S T +V V + D ND  P
Sbjct: 1532 GEVIFTLSATDADQGQNALVTYSVLSGSEGAF-------VVDAASGV---LRASRRLDREERASYLLTVRASDG--THATDARLSVAVR--DANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGA-----FGLHPVTGALNVTRPLDRESRACYVLRARATDGGG------LAATARLYVNVLDAND-----NAPSVQNDSLAAEVPEDAPPGTSLLRISATDDD--EGVNAELEFS------ISSGDPEGRFAVGNDGQLSVARALDRER--QSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREAR--QSYALTVL--AVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPD--EGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDG-GGPARSDTASVRVTLSDVNDCSP 2052          

HSP 6 Score: 107.842 bits (268), Expect = 8.361e-24
Identity = 150/621 (24.15%), Postives = 266/621 (42.83%), Query Frame = 1
Query:  760 LDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEG--LNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYD-EPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREK-IPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLT-YFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSM----EKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDV--HDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLE--PRNYKFMTVSANDQDQTSEFNT-IEYHLESE---SDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFN-----PGYTSMKSSVQVNVVIDASTAKSNSPR 2556
            +DRE    Y   ++A  GG      G  ++++ + D N++ P F    Y+  + E   +NS R   + ATD D G NG++ Y+       G    + F I  D G++Y++  LD E +  +   V A++      +   +S+ +V ++VL+V D +PL  +  Y+    +   EE +    V  V  T  +      +    E  Q    L S   E+ ++ S  +   + + R+      S +++  +          A +++ ++D NDN P         S+ E+    T + ++ A D DEG NG + +++    E   F      ++  + G I +   +D E +     + T+VV+ATD G  P +    +++ + D NDN P+FT S +    +E+      +  +   D+D     D+   + + N     F I +    +F     R LD E    +   V A D  G P  S    + V V D NDN P  + P    A++     +E  P   + +TV+A D D  ++ N  + Y +  +      F ID + G I T  E+ +   G  + ++TV       P +T  + S   NV +  +    N+PR
Sbjct:  719 IDREEQAFYQLRVVANSGG----VAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNS-RFFSVRATDKDSGKNGEVKYEIGE--GNGG---EKFGIFPD-GQLYVRYELDRETREEYSLTVSAMD----TGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYV----FHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELDS---ETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKF------TVDASTGQITLLGSLDREET----ASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGN-THATFAIDRSTGSVF---LARRLDFETQRLYRLNVSAEDG-GRPPRSSATILVVHVRDFNDNPPAFL-PGDVFASI-----MENIPIGTRVITVTARDPD--ADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTG-GLFEVTVRATDKAIPVHT--RRSALKNVTVLVTDENDNAPR 1291          

HSP 7 Score: 86.2705 bits (212), Expect = 3.075e-17
Identity = 78/287 (27.18%), Postives = 125/287 (43.55%), Query Frame = 1
Query: 1516 SSSAKIEIIIKDQNDNAPTLTYFGTPS----ILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKN-----SFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFH-------LNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQ 2328
            SS  ++EI ++D NDN P    F  P     + ENT  G V+F + A D D+G+N  VT+S+      S     +    GV++    +D E   +    LT+  +   H     +TD ++S+ ++D NDN P+F+     F + E+   +     + +G +   D D      +       A+ P      A+  F        LN TR LDRE    +  +  ATD  G    + T  + V V+D NDN P +    QN++    +    P     + +SA D D+
Sbjct: 1497 SSFNQVEISVEDVNDNPPV---FAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSG---SEGAFVVDAASGVLRASRRLDREERASYL--LTVRASDGTH-----ATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTY-----ALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGG---LAATARLYVNVLDANDNAPSV----QNDSLAAEVPEDAPPGTSLLRISATDDDE 1758          

HSP 8 Score: 53.9138 bits (128), Expect = 2.297e-7
Identity = 61/259 (23.55%), Postives = 104/259 (40.15%), Query Frame = 1
Query: 1840 PKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIF-------HLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYK----FMTVSANDQDQTSEFNTIEYHLESESD------VFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRIEN 2565
            P S+  Q+ I+++DVNDN P F    M   + EN  +   +  +   D D         + +N A++ + +L  +   F        L  +R LDRE+   +   V A+D     T++    + V V D NDN P     S++  +  V     P          TV A D D +  F  + Y L    D       F +    G +   R + +     +V++    + G  +  + + VNV+     A  N+P ++N
Sbjct: 1495 PMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDAD---------QGQN-ALVTYSVLSGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASDG----THATDARLSVAVRDANDNSPRF---SRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDAD-SGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNVL----DANDNAPSVQN 1731          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.918 bits (398), Expect = 1.612e-39
Identity = 193/775 (24.90%), Postives = 333/775 (42.97%), Query Frame = 1
Query:  379 VDMDSMCQNVGECCNKAKEICDFSIAIACRENQESEVXXXXXXXXXXXXXXXYPIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVE------------------LKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYK-----EFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLK--KPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISV-LN-------VYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIK--DQNDNAPTLTYFGTP------------SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPS--LEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKF------TSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTI-EYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDAST 2535
            +D +++C    + C     +    +A   +    S +   D+++ +RD ND+ P F   ++ + ISES  +G  + LP A D D G N ++ Y+IS        +  +L   + + S   +                  L++ + LDRE    Y   L   DGG   + +GS+ + I ++D NDN P F  P  +     E  K G +   +++L A DPD G NG I Y F  +  + A       ++  +G + ++  + LD E     +  V+A +          + +ASV ++V LN       V+ E + +  +YL +    IVE   S   V +++V+  +     ++  RLE F     L S      KV+ F ++T + +D E+  + + ++L   + D   P  S  + +II   D NDN P    F  P            S+ EN   GTVV  ++A D D G NG +TF++ + A      E  S+    G + + + +D E  +       + V A D G   +     + +T+ D NDN P F      T+    F + E     ++VG +   D D  D+  + L     A   ++          + T   LDRE   ++   V A DS G P  S +  V + V D NDN P+I  P+ N+   HV ++        ++V+AND D       + E    +   +F ++   G +   R ++  D G H + + V + G +  +    V+ +++A+ 
Sbjct:   89 LDREALCMEEPDACRSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAAS----GDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNP-KLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTS---VVQLRAADPDAGPNGAIAYSFHTKLTSLA-TQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQ------LSRSASVTVTVELNDDNDNAPVF-EVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLE-FPTGAELASPN----KVQ-FLLKTTRLLDYEEAQQYNVSVL---AADRGTPKLSKLLNLIISVVDINDNTPV---FMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRM----RYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDS-GRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLYEIIGGNPKGIFLLNADSGALSLARTVSSLDEGLHRLVVRVRDRGGSGSRRVRAVSGLLEAAA 830          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 146.362 bits (368), Expect = 6.289e-36
Identity = 161/585 (27.52%), Postives = 250/585 (42.74%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKE-GLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIV---EENKSNFFVAIVTVT---SKENDLFRSIQCRLE---HFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIK--DQNDNAPTL---TYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLE---YLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHM-----IFTIMENNMKNSFVGEIEVEDKDVHDDINLVLR--SKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDN 2217
            P F    + +EISESV +G  + L  A D D G N +  Y +   E   F    R     T  +   EL V   LDRE   +Y+  L A DGG    ++G+  + I ++D NDN P F+       V+E       +L L+ATD DEG NG+++Y F       A +   F ++  +G++ LK  LD+E  + ++  + A +  P    +   +   V + V ++ D   EI +D++       V   E      FV +VTV+   S EN L   + C L    HF+    L+   D+      + + TN  +DRE   +++   L  E+ D   P   A  +  ++  D+NDN P     TY    S+LEN  PG  V  + A D D   NG + +++ +S         Y+SI  + G I     +D E+     T+LT  V A D G+ P  T+  +S+ I D NDN P  T   +     +  +  +      V  +   D D   +  L  R    N   L F I +    +F  N     D       +  V+     G+P  S T  +++ V    D 
Sbjct:  134 PDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENE--RFGLALRAR---TDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDP-PRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSS--PVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGP----SSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGL---VACHLRGHPHFK----LLPYRDD------YVVVTNSSLDRE---QMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTY--EASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEA----MTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERNL-FRINRLGGEVF-TNAASVTDAAASATRHSLVVMVRDRGSPALSATAAIEIRVGAHGDG 682          

HSP 2 Score: 96.6709 bits (239), Expect = 1.617e-20
Identity = 136/595 (22.86%), Postives = 239/595 (40.17%), Query Frame = 1
Query:  841 INIAIRIIDENDNMPQFS-SPIYKEFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFV------AIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKV------KSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTL-------TYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDV-HDDI---NLVLRSKNPAMLP--FVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNT-IEYHL--ESESDVFDIDRQEGTIFTRREM---AKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDA 2529
            ++  + ++D ND+ P F+ S ++ E  +      R+    A D D G N    Y  D   + G L L   +      E+ +K  LD E++  +   + A +   P      + T  V I+VL+             +N N  +  +   N  V        V +T    D+         + + + S  S  D   +       K+ ++    ++D E   +   +I  ++   S +P+   K+ + ++D NDNAP +       +   T  + E     + V  +   D D  ENG V   +     P  + L     D V+   S +D E    Q     +V+ A+D G  P+    Q ++ + D NDN P+F  S    +++ENN   ++V  +   D D  H+ +   N+V      A +     I   +  I+ L   R LD E      FQV A D  G P      TV V ++D+NDN P++  P   N T  V+         ++      +D  SE N  + Y +   +E ++F I+R  G +FT       A +    H + + V + G  ++ ++  + + + A
Sbjct:  120 VHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFG-LALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPP----RSGTTLVRITVLD-------------SNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEG-----PNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAH-CKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLR--GHPHFKLLPY-RDDYVVVTNSSLDRE----QMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYAL---RPLDYEAMTSLTFQVQARDD-GVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGT-GVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERNLFRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDRGSPALSATAAIEIRVGA 678          

HSP 3 Score: 58.151 bits (139), Expect = 1.067e-8
Identity = 69/285 (24.21%), Postives = 116/285 (40.70%), Query Frame = 1
Query: 1732 ETDGVIKVKSIIDCESSLAQFTTLTI---VVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDV--------HDDIN----LVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESD-----VFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVID 2526
            E DG +  + +ID E    Q  +  I   V+     G+      +   + + D+ND+ P F  S M   I E+    + V      D DV        H D N    L LR++              +   L     LDRE++ ++  Q+ A D  G+P  S T  V + V+D NDN P+    +Q +  V V     P     +T++A D D+      + Y   S  D     +F +D + G +  + ++      E+ I I   + G +S+ +  +V V ++
Sbjct:   79 EADGTVSAREVIDREQQCGQAPSCVIRFDVLCTLPRGLFQL---VHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFGLALRART----------DGAKYAELVVKSRLDREQEGEYTLQLTAWDG-GDPPRSGTTLVRITVLDSNDNSPVF---AQTSCNVTVREDATPGTV-LLTLNATDVDEGPNGEVV-YSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVE 344          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004042.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.88 bits (333), Expect = 2.433e-31
Identity = 165/696 (23.71%), Postives = 291/696 (41.81%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNS-VRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDE-SYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSA--KIEIIIKDQNDNAPTLT---YFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFT--IMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMT--VSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREM---------AKSDIGEHVIKITVFNPGYTSMKS--SVQVNVVIDASTAKSNSPRI 2559
            P F    +   + E   IG  + L  ATD D G N + +Y++     R  D HF      ++N  T ++     LDRE    Y  ++ A+DGG T   + S  + + + D ND+ P+F +  Y  +      +   +  ++A D D G NG + +        G      FS++   G I+  + L   +        ++    PP          S   +V   + +  E        +++S  E+      + +V   S       S          + S  + GD  +   +S E+  ++ +D E         L  E+ DS  P  SA  K+E+ + D NDNAP  +   ++    + ENT P T+V  + A DKD G NG+V +S+      ++    +    G I+  S +D E       +  + V ATD G   +   +++ I++ D NDN P+FT    IF+  + E+      V  +   D D   +  +     +P+ LPF I      I     +R L+RE    +  +V A+D    P  +V+  V + V D NDN P      +   T + I + EP   + +   VSA+D D  +    + + + S+++ F + R  G I + R +         + +++ ++   +T  + G   + S  +V +N+V+      +N+PR 
Sbjct:   24 PRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRL-----RGGDGHF------SVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAG------FSVDPRRGVIHAARALQGPRDDLTLTVRVSDGGAPP---------RSAVTTVTVRFRDAGEFPRFAPGPRSFSFREDQPPGTTITVVAARSSRRAGPVSYH--------LASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYE---LVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWA--KVPENTPPRTIVV-LTAVDKDSGINGQVDYSIIDGNIGNV--FRVNPNSGEIRSVSTLDRE----NVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFT---QIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPS-LPFSIHPSTGEI---TVSRRLNREDRSGYAVKVRASD----PAWTVSTDVTIVVDDVNDNAP------RFGQTAYYIEFPEPSEGEALVARVSASDADDGAN-GQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVV----PNANAPRF 651          

HSP 2 Score: 115.161 bits (287), Expect = 5.968e-26
Identity = 160/661 (24.21%), Postives = 276/661 (41.75%), Query Frame = 1
Query:  595 HTITLPVATDKDFG-NNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKE-GLNSVRILRLSATDPDEGINGKIIYK-FDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSI--VEENKSNFFVAIVTVTSKEND----LFRSIQCRLEHFQEILSLISKGDESYKVKSFE-IRTNQEIDREKIPKISTNILCKESVDSHVP--SSSAKIEIIIKDQNDNAPTL--TYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKD--VHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVH--VISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVI 2523
             TI +  A DKD G N QV+   I         N FR+N        + E++    LDRE    Y   + A D G   Q   ++ + I + DENDN P+F+  I+   V+E       +LR+S  D DEG N  I +   DP           FSI+  +GEI + + L+ E ++ +   V A +P        +T +  V I V +V D     N        Y I   E ++    VA V+ +  ++     +F  ++ + E+F+        G +S ++ S   +R            ++       ++D   P  SS A + I I   N NAP      + TP +    + GT +  + A D D   NG++ +S+          +  G   G + +++ +  ++     +  ++ V A D G  P S+     I++ + N   P+F    +  ++ EN+   S +  +   D D  V+  I   + S + + L F I + +  +  +     LD E +  +N  V A D         +G V + V D NDN P++      NA+ +  VI    P     + + A D D  S   T+    + E+D+F ++++ G + T+  +       + + +  FN   T   S+ QV+V I
Sbjct:  352 RTIVVLTAVDKDSGINGQVDYSIIDGN----IGNVFRVN------PNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHC-TVKVLISVTDENDNSPRFTQ-IFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLP--------FSIHPSTGEITVSRRLNREDRSGYAVKVRASDPA-------WTVSTDVTIVVDDVND-----NAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFR-------VGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTP-VAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVDAG---GFLHLRASLAGDAG----SIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGL-FDISRASGDVLLVG---ELDYETEKLYNLSVCAADGGWQAKTECSG-VSISVTDVNDNPPML------NASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQI 954          

HSP 3 Score: 114.775 bits (286), Expect = 7.251e-26
Identity = 159/601 (26.46%), Postives = 249/601 (41.43%), Query Frame = 1
Query:  592 GHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNS-VRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDE-PLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKES-------VDSHVPSSSAKIEIIIKDQNDNAPTLT---YFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDV---HDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQ-NNATVHVISYLEPRNYKFMT-VSANDQDQTSEFN 2343
            G ++    ATD D G N    Y I+  +          + L  ++  + ++ +   LD ET   Y+  + A DGG    KT    ++I + D NDN P  ++  Y   + E   S   +L + A D D   N   +Y  D          D F +N+ +G +  +  LDYE +  ++  V A N       T + STA V + +  V +  P  +  +Y    N+ + E       V  V  T ++  +  ++   L  F E  S   KG  S    + EI  + ++DRE+    +  ++ K +       VD  +      + + I D ND  P  +   Y G   + E    GT V  + A D D     R TFS    +  +    SI    G+I V S +D ES       LT+V  A D G  P +    + + ++DVNDN P   +S     + EN      V  +E  D D+          L   +PA   +  L  +     L T R +DRE+ P+F+  V   D+ G+P  + T T+ + V+DQNDN      PS+  +  VHV  +  P    F+  V   D D +  FN
Sbjct:  771 GSSLARVTATDTDAGVNGAIVYSIASGD---------GSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGW-QAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEA------DLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFN----YPDTFHYSTAQVHVQITGVNEYFPRFVQREY----NFVVSESAPVGAPVGSVFATDRDAGIDGTVFYML--FGESRS---KG-FSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVL------VNVAITDAND-PPVFSSALYHG--RVSEAASVGTHVVGVSAHDFDSPPGWR-TFSFLIQSGNAGRAFSINAHTGLIVVASPLDRES--VPLYNLTVV--AVDMGEPPATGTTVVVVALEDVNDNGPFLLTSSA--KVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSSSGL---LKTARPIDREQKPEFHLPVAIADA-GSPPLTSTVTLHLSVLDQNDN------PSEARDVRVHVNYFGSPFPGGFIGDVRPRDPDISDRFN 1315          

HSP 4 Score: 110.923 bits (276), Expect = 1.144e-24
Identity = 142/588 (24.15%), Postives = 245/588 (41.67%), Query Frame = 1
Query:  832 TGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVN--PTPPVTITLYTSTASVEISVLNVYDE-PLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDN-----APTLTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVE-DKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPII--IFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRI 2559
            TG+  + + + DENDN+P+F +   +  V E       +  ++ATD D G+N  I Y+   R   G     +FS+N  +G+I     LD E +  +   V A++  PTP +     +S+A++ ++V +V D  P  +N  Y+          + +    A+  VT+++ D   +   R       LS  +    S   +   I   + +   + P+    +  + S D   P  SA   + ++ ++       AP    F   S  E+  PGT +  + A+       G V++ +        +  ++    G + V   +D E          +VV A D G  P S  L++ + + D+NDN P+F+SS     + EN    + V    V+ D  ++  ++  +   N   + F +   +  I  ++T   LDRE    +   V ATD  G+PT   T  V + V D+NDN P    IF +       V        +  + VS  D D+      I + L   S  F I    G I   R + + D   + +K+   +P +T    S  V +V+D      N+PR 
Sbjct:    7 TGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRL--RGGDG-----HFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGL-----SSSATLVVAVTDVNDHTPRFLNAPYV------AYAPSSAPAGTAVFAVTARDADAGPNGDLRFS-----LSGSASAGFSVDPRRGVIHAARAL---QGPRDDLTLTVRVS-DGGAPPRSAVTTVTVRFRDAGEFPRFAPGPRSF---SFREDQPPGTTITVVAARSSRRA--GPVSYHLASGGNLG-DVFAVDPQSGEVSVHRALDHEYQ----HHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSIIDGNIGNV-FRVNPNSGEIRSVST---LDRENVASYELTVKATDR-GSPTQHCTVKVLISVTDENDNSPRFTQIFSAHVREDAAV-------GFPVLRVSTLDADEGPN-AAITFSLLDPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASDPAWT---VSTDVTIVVD--DVNDNAPRF 539          

HSP 5 Score: 94.3597 bits (233), Expect = 1.405e-19
Identity = 122/508 (24.02%), Postives = 217/508 (42.72%), Query Frame = 1
Query: 1015 FKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPT-PPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKG-DESYKVK--SFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIK--DQNDNAPTLTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKD--VHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDP----------KFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIII---FPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHL--ESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITV 2469
              +G  + D F+++  SGE+ + + LD+E Q  ++  V A +   PP +  L      +E+ VL++ D   E    + +++ ++ V EN     + ++T   K++ +         + Q   S+I       ++V   S EIR+   +DRE +      +   ++ D   P+    ++++I   D+NDN+P  T   +  + E+   G  V ++   D DEG N  +TFS+   + P     SI  + G I V   ++ E      +   + V A+D      STD  ++I + DVNDN P+F  +       E +   + V  +   D D   +  +   +RS+      F + + +  I   ++ R L R +DP          K++F V A D  G P  S   TV + ++  N N P  +   + +   ATV           + + +SA D D+      I Y +   + S  FD+D   G     R     D G  +  +TV
Sbjct:  269 LASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYL-----KLEVDVLDINDNAPE----FSSSRFWAKVPENTPPRTIVVLTAVDKDSGI---------NGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTV---KATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLP----FSIHPSTGEITVSRRLNREDR----SGYAVKVRASDPAWT-VSTD--VTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTEN---FRVGRDSGEI---HSVRPL-RYRDPAGGGSGANLNKYSFVVTAMDR-GRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRA-------GTRILDMSAVDPDRDVN-GQIAYSVVGGNASRRFDVD--AGGFLHLRASLAGDAGS-IFSVTV 725          

HSP 6 Score: 89.3521 bits (220), Expect = 3.887e-18
Identity = 139/612 (22.71%), Postives = 241/612 (39.38%), Query Frame = 1
Query:  778 NKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNS-VRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVN-PTPPVTITLYTSTASVEISVLNVY-----DEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDES----YKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLT---YFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVL------RSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTG------TVDVEVIDQNDNFPIIIFPSQNNATVHV-ISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLES--ESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVID 2526
            NKYSF + A+D G+    +    + I I+  N N P+F    Y   V   + +  RIL +SA DPD  +NG+I Y        G      F ++   G ++L+  L  +  + F   V A +   PP++     +TA + ++  N Y       PLE+          S+ E + +   +A VT T  +  +  +          I+  I+ GD S        S ++    E+D E   K+    +C         +  + + I + D NDN P L    Y+  P I EN   GT V  + A D D   N    +S++       +   + +  GV+  +  +D E+      T  + V A ++      +  Q+ + I  VN+  P+F      F + E+    + VG +   D+D   D  +        RSK      F + +    I     +  LDRE++     +VIA ++      S+ G       V+V + D ND       P  ++A  H  +S         + VSA+D D    + T  + ++S      F I+   G I     + +  +  + + +   + G      +  V V ++
Sbjct:  615 NKYSFVVTAMDRGRPPLSS-DATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSV-----VGGNASRRFDVDA-GGFLHLRASLAGDAGSIFSVTVEARDRGRPPLS---SRATAIISVTEENQYAPRFAHPPLEL----------SLPENHPAGSSLARVTATDTDAGVNGA----------IVYSIASGDGSGLFDISRASGDVLLVGELDYE-TEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYY--PVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDG---EADLFVLNQKTGVLTTQGFLDYETK----QTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKG-----FSVNEHTGEII---VSSQLDREREASATLRVIAKNA-----GSIRGFDVDEVLVNVAITDANDP------PVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALE 1167          

HSP 7 Score: 85.5001 bits (210), Expect = 6.101e-17
Identity = 135/563 (23.98%), Postives = 216/563 (38.37%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKF--DPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLY-TSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTN-------QEIDREKIPKISTNILCKESVDSHVPSSSAKIEIII--KDQNDNAPTLTYFGTPSILENTKPGTVVFKIIAQDKDEGEN-GRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTR--SLDREKDPKFNFQVIATDSLGNPTNSVT 2178
            P+ N  +    I E+   G T+ +  A D D  +N V  Y +   E   F           LN  T  L     LD ET   Y   + A +   T   + +  + ++I   N+  P+F    Y   V E       +  + ATD D GI+G + Y    + R K        FS+NE +GEI +   LD E++      VIA N     +I  +      V +++ +  D P+  +  Y     +  V E  S   V    V    +D       R   F     LI  G+     ++F I  +         +DRE +P  +  ++   +VD   P ++    +++  +D NDN P L    +  + EN   G  V  + A D D   N G  TF +  S      Y S+  + G++K    ID E    Q     + V   D G  P ++ + + +++ D NDN  +     +      +     F+G++   D D+ D  N  L S      PF +       F  NT R  S  R  + +F   V  +D   +P  +  
Sbjct:  858 PMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLF----------VLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYS-TAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKG-------FSVNEHTGEIIVSSQLDREREASATLRVIAKNAG---SIRGFDVDEVLVNVAITDANDPPVFSSALY-----HGRVSEAAS---VGTHVVGVSAHDFDSPPGWRTFSF-----LIQSGNAG---RAFSINAHTGLIVVASPLDRESVPLYNLTVV---AVDMGEPPATGTTVVVVALEDVNDNGPFL-LTSSAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSL-SSSGLLKTARPIDRE----QKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNPSEARDVRVHVNYFGSPFPGGFIGDVRPRDPDISDRFNCDLTSG-----PFNVFS-----FQPNTCRLISQPRSAEGRFELSVRGSDGKHSPATTTA 1364          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004043.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.494 bits (332), Expect = 2.512e-31
Identity = 165/696 (23.71%), Postives = 291/696 (41.81%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNS-VRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDE-SYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSA--KIEIIIKDQNDNAPTLT---YFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFT--IMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMT--VSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREM---------AKSDIGEHVIKITVFNPGYTSMKS--SVQVNVVIDASTAKSNSPRI 2559
            P F    +   + E   IG  + L  ATD D G N + +Y++     R  D HF      ++N  T ++     LDRE    Y  ++ A+DGG T   + S  + + + D ND+ P+F +  Y  +      +   +  ++A D D G NG + +        G      FS++   G I+  + L   +        ++    PP          S   +V   + +  E        +++S  E+      + +V   S       S          + S  + GD  +   +S E+  ++ +D E         L  E+ DS  P  SA  K+E+ + D NDNAP  +   ++    + ENT P T+V  + A DKD G NG+V +S+      ++    +    G I+  S +D E       +  + V ATD G   +   +++ I++ D NDN P+FT    IF+  + E+      V  +   D D   +  +     +P+ LPF I      I     +R L+RE    +  +V A+D    P  +V+  V + V D NDN P      +   T + I + EP   + +   VSA+D D  +    + + + S+++ F + R  G I + R +         + +++ ++   +T  + G   + S  +V +N+V+      +N+PR 
Sbjct:   24 PRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRL-----RGGDGHF------SVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAG------FSVDPRRGVIHAARALQGPRDDLTLTVRVSDGGAPP---------RSAVTTVTVRFRDAGEFPRFAPGPRSFSFREDQPPGTTITVVAARSSRRAGPVSYH--------LASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYE---LVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWA--KVPENTPPRTIVV-LTAVDKDSGINGQVDYSIIDGNIGNV--FRVNPNSGEIRSVSTLDRE----NVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFT---QIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPS-LPFSIHPSTGEI---TVSRRLNREDRSGYAVKVRASD----PAWTVSTDVTIVVDDVNDNAP------RFGQTAYYIEFPEPSEGEALVARVSASDADDGAN-GQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVV----PNANAPRF 651          

HSP 2 Score: 115.161 bits (287), Expect = 6.111e-26
Identity = 160/661 (24.21%), Postives = 276/661 (41.75%), Query Frame = 1
Query:  595 HTITLPVATDKDFG-NNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKE-GLNSVRILRLSATDPDEGINGKIIYK-FDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSI--VEENKSNFFVAIVTVTSKEND----LFRSIQCRLEHFQEILSLISKGDESYKVKSFE-IRTNQEIDREKIPKISTNILCKESVDSHVP--SSSAKIEIIIKDQNDNAPTL--TYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKD--VHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVH--VISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVI 2523
             TI +  A DKD G N QV+   I         N FR+N        + E++    LDRE    Y   + A D G   Q   ++ + I + DENDN P+F+  I+   V+E       +LR+S  D DEG N  I +   DP           FSI+  +GEI + + L+ E ++ +   V A +P        +T +  V I V +V D     N        Y I   E ++    VA V+ +  ++     +F  ++ + E+F+        G +S ++ S   +R            ++       ++D   P  SS A + I I   N NAP      + TP +    + GT +  + A D D   NG++ +S+          +  G   G + +++ +  ++     +  ++ V A D G  P S+     I++ + N   P+F    +  ++ EN+   S +  +   D D  V+  I   + S + + L F I + +  +  +     LD E +  +N  V A D         +G V + V D NDN P++      NA+ +  VI    P     + + A D D  S   T+    + E+D+F ++++ G + T+  +       + + +  FN   T   S+ QV+V I
Sbjct:  352 RTIVVLTAVDKDSGINGQVDYSIIDGN----IGNVFRVN------PNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHC-TVKVLISVTDENDNSPRFTQ-IFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLP--------FSIHPSTGEITVSRRLNREDRSGYAVKVRASDPA-------WTVSTDVTIVVDDVND-----NAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFR-------VGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTP-VAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVDAG---GFLHLRASLAGDAG----SIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGL-FDISRASGDVLLVG---ELDYETEKLYNLSVCAADGGWQAKTECSG-VSISVTDVNDNPPML------NASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQI 954          

HSP 3 Score: 114.775 bits (286), Expect = 7.057e-26
Identity = 159/601 (26.46%), Postives = 249/601 (41.43%), Query Frame = 1
Query:  592 GHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNS-VRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDE-PLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKES-------VDSHVPSSSAKIEIIIKDQNDNAPTLT---YFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDV---HDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQ-NNATVHVISYLEPRNYKFMT-VSANDQDQTSEFN 2343
            G ++    ATD D G N    Y I+  +          + L  ++  + ++ +   LD ET   Y+  + A DGG    KT    ++I + D NDN P  ++  Y   + E   S   +L + A D D   N   +Y  D          D F +N+ +G +  +  LDYE +  ++  V A N       T + STA V + +  V +  P  +  +Y    N+ + E       V  V  T ++  +  ++   L  F E  S   KG  S    + EI  + ++DRE+    +  ++ K +       VD  +      + + I D ND  P  +   Y G   + E    GT V  + A D D     R TFS    +  +    SI    G+I V S +D ES       LT+V  A D G  P +    + + ++DVNDN P   +S     + EN      V  +E  D D+          L   +PA   +  L  +     L T R +DRE+ P+F+  V   D+ G+P  + T T+ + V+DQNDN      PS+  +  VHV  +  P    F+  V   D D +  FN
Sbjct:  771 GSSLARVTATDTDAGVNGAIVYSIASGD---------GSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGW-QAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEA------DLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFN----YPDTFHYSTAQVHVQITGVNEYFPRFVQREY----NFVVSESAPVGAPVGSVFATDRDAGIDGTVFYML--FGESRS---KG-FSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVL------VNVAITDAND-PPVFSSALYHG--RVSEAASVGTHVVGVSAHDFDSPPGWR-TFSFLIQSGNAGRAFSINAHTGLIVVASPLDRES--VPLYNLTVV--AVDMGEPPATGTTVVVVALEDVNDNGPFLLTSSA--KVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSSSGL---LKTARPIDREQKPEFHLPVAIADA-GSPPLTSTVTLHLSVLDQNDN------PSEARDVRVHVNYFGSPFPGGFIGDVRPRDPDISDRFN 1315          

HSP 4 Score: 110.923 bits (276), Expect = 1.095e-24
Identity = 142/588 (24.15%), Postives = 245/588 (41.67%), Query Frame = 1
Query:  832 TGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVN--PTPPVTITLYTSTASVEISVLNVYDE-PLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDN-----APTLTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVE-DKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPII--IFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRI 2559
            TG+  + + + DENDN+P+F +   +  V E       +  ++ATD D G+N  I Y+   R   G     +FS+N  +G+I     LD E +  +   V A++  PTP +     +S+A++ ++V +V D  P  +N  Y+          + +    A+  VT+++ D   +   R       LS  +    S   +   I   + +   + P+    +  + S D   P  SA   + ++ ++       AP    F   S  E+  PGT +  + A+       G V++ +        +  ++    G + V   +D E          +VV A D G  P S  L++ + + D+NDN P+F+SS     + EN    + V    V+ D  ++  ++  +   N   + F +   +  I  ++T   LDRE    +   V ATD  G+PT   T  V + V D+NDN P    IF +       V        +  + VS  D D+      I + L   S  F I    G I   R + + D   + +K+   +P +T    S  V +V+D      N+PR 
Sbjct:    7 TGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRL--RGGDG-----HFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGL-----SSSATLVVAVTDVNDHTPRFLNAPYV------AYAPSSAPAGTAVFAVTARDADAGPNGDLRFS-----LSGSASAGFSVDPRRGVIHAARAL---QGPRDDLTLTVRVS-DGGAPPRSAVTTVTVRFRDAGEFPRFAPGPRSF---SFREDQPPGTTITVVAARSSRRA--GPVSYHLASGGNLG-DVFAVDPQSGEVSVHRALDHEYQ----HHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSIIDGNIGNV-FRVNPNSGEIRSVST---LDRENVASYELTVKATDR-GSPTQHCTVKVLISVTDENDNSPRFTQIFSAHVREDAAV-------GFPVLRVSTLDADEGPN-AAITFSLLDPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASDPAWT---VSTDVTIVVD--DVNDNAPRF 539          

HSP 5 Score: 94.3597 bits (233), Expect = 1.345e-19
Identity = 122/508 (24.02%), Postives = 217/508 (42.72%), Query Frame = 1
Query: 1015 FKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPT-PPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKG-DESYKVK--SFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIK--DQNDNAPTLTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKD--VHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDP----------KFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIII---FPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHL--ESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITV 2469
              +G  + D F+++  SGE+ + + LD+E Q  ++  V A +   PP +  L      +E+ VL++ D   E    + +++ ++ V EN     + ++T   K++ +         + Q   S+I       ++V   S EIR+   +DRE +      +   ++ D   P+    ++++I   D+NDN+P  T   +  + E+   G  V ++   D DEG N  +TFS+   + P     SI  + G I V   ++ E      +   + V A+D      STD  ++I + DVNDN P+F  +       E +   + V  +   D D   +  +   +RS+      F + + +  I   ++ R L R +DP          K++F V A D  G P  S   TV + ++  N N P  +   + +   ATV           + + +SA D D+      I Y +   + S  FD+D   G     R     D G  +  +TV
Sbjct:  269 LASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYL-----KLEVDVLDINDNAPE----FSSSRFWAKVPENTPPRTIVVLTAVDKDSGI---------NGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTV---KATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLP----FSIHPSTGEITVSRRLNREDR----SGYAVKVRASDPAWT-VSTD--VTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTEN---FRVGRDSGEI---HSVRPL-RYRDPAGGGSGANLNKYSFVVTAMDR-GRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRA-------GTRILDMSAVDPDRDVN-GQIAYSVVGGNASRRFDVD--AGGFLHLRASLAGDAGS-IFSVTV 725          

HSP 6 Score: 89.3521 bits (220), Expect = 3.722e-18
Identity = 139/612 (22.71%), Postives = 241/612 (39.38%), Query Frame = 1
Query:  778 NKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNS-VRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVN-PTPPVTITLYTSTASVEISVLNVY-----DEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDES----YKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLT---YFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVL------RSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTG------TVDVEVIDQNDNFPIIIFPSQNNATVHV-ISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLES--ESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVID 2526
            NKYSF + A+D G+    +    + I I+  N N P+F    Y   V   + +  RIL +SA DPD  +NG+I Y        G      F ++   G ++L+  L  +  + F   V A +   PP++     +TA + ++  N Y       PLE+          S+ E + +   +A VT T  +  +  +          I+  I+ GD S        S ++    E+D E   K+    +C         +  + + I + D NDN P L    Y+  P I EN   GT V  + A D D   N    +S++       +   + +  GV+  +  +D E+      T  + V A ++      +  Q+ + I  VN+  P+F      F + E+    + VG +   D+D   D  +        RSK      F + +    I     +  LDRE++     +VIA ++      S+ G       V+V + D ND       P  ++A  H  +S         + VSA+D D    + T  + ++S      F I+   G I     + +  +  + + +   + G      +  V V ++
Sbjct:  615 NKYSFVVTAMDRGRPPLSS-DATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSV-----VGGNASRRFDVDA-GGFLHLRASLAGDAGSIFSVTVEARDRGRPPLS---SRATAIISVTEENQYAPRFAHPPLEL----------SLPENHPAGSSLARVTATDTDAGVNGA----------IVYSIASGDGSGLFDISRASGDVLLVGELDYE-TEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYY--PVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDG---EADLFVLNQKTGVLTTQGFLDYETK----QTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKG-----FSVNEHTGEII---VSSQLDREREASATLRVIAKNA-----GSIRGFDVDEVLVNVAITDANDP------PVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALE 1167          

HSP 7 Score: 85.5001 bits (210), Expect = 6.198e-17
Identity = 135/563 (23.98%), Postives = 216/563 (38.37%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKF--DPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLY-TSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTN-------QEIDREKIPKISTNILCKESVDSHVPSSSAKIEIII--KDQNDNAPTLTYFGTPSILENTKPGTVVFKIIAQDKDEGEN-GRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTR--SLDREKDPKFNFQVIATDSLGNPTNSVT 2178
            P+ N  +    I E+   G T+ +  A D D  +N V  Y +   E   F           LN  T  L     LD ET   Y   + A +   T   + +  + ++I   N+  P+F    Y   V E       +  + ATD D GI+G + Y    + R K        FS+NE +GEI +   LD E++      VIA N     +I  +      V +++ +  D P+  +  Y     +  V E  S   V    V    +D       R   F     LI  G+     ++F I  +         +DRE +P  +  ++   +VD   P ++    +++  +D NDN P L    +  + EN   G  V  + A D D   N G  TF +  S      Y S+  + G++K    ID E    Q     + V   D G  P ++ + + +++ D NDN  +     +      +     F+G++   D D+ D  N  L S      PF +       F  NT R  S  R  + +F   V  +D   +P  +  
Sbjct:  858 PMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLF----------VLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYS-TAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKG-------FSVNEHTGEIIVSSQLDREREASATLRVIAKNAG---SIRGFDVDEVLVNVAITDANDPPVFSSALY-----HGRVSEAAS---VGTHVVGVSAHDFDSPPGWRTFSF-----LIQSGNAG---RAFSINAHTGLIVVASPLDRESVPLYNLTVV---AVDMGEPPATGTTVVVVALEDVNDNGPFL-LTSSAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSL-SSSGLLKTARPIDRE----QKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNPSEARDVRVHVNYFGSPFPGGFIGDVRPRDPDISDRFNCDLTSG-----PFNVFS-----FQPNTCRLISQPRSAEGRFELSVRGSDGKHSPATTTA 1364          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 179.104 bits (453), Expect = 2.021e-45
Identity = 192/627 (30.62%), Postives = 293/627 (46.73%), Query Frame = 1
Query:  616 ATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYL--NNKNYSIVEENKS-NFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDES--YKVKSFE---IRTNQEIDREKIPKISTNILCKESVDSHVPSSS--AKIEIIIKDQNDNAPTLTYFG-TPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDD--INLVLRSKNPAMLPFVILKKANRIFHLNT------TRS-LDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHL--ESESDVFDIDRQEGTIFTRREM 2427
            ATD D GNN    Y I+  +       F L         T+ +   KPLDRETT+ Y  ++ A D G T    G   I I I+DEND+ P F+   Y   + E     V ILR+SA D D G NG I Y  D        I D   ++  +G I  K+ LD+E +  + F VIA +   P    L    A+V I+VL+  D   ++ + YL  +N + +I  EN   N  +A + VT K+++     + +          I+ GD+   +KV+      I+  + +DRE +P  +   L     D  VPS S    + I + D NDN+P  T    T +I E  + G+ V ++ A D DEG+NG V++S+  +    L +  +    G++     +D E    Q +++TI +TA DHG  PK+    +++TI D NDN P+F  S    TI E     + V ++   D D  D+  I   + S +          + N +F LNT      T+S LDRE    ++F V+A D  G+P    +  V++ + D NDN P + +P +  A+   I   EP   K + V+A D D+ +    I Y +   + +  F ID   G I T   +
Sbjct:  119 ATDPDAGNNGTVDYTIASGDNTA---TFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRG-TPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFD---LDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDL----ATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELK----------ITNGDDEGCFKVEFLGFYFIQLQKPLDRELVPFYN---LTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSI--TGGNDLGWFQVDFQSGLVTTAKPLDRE----QVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSD---------AQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDH-GDPQLMSSVKVELTISDINDNAP-VFYPVEYFAS---IMENEPPG-KLLQVTATDADEGTN-AVISYDIIGGNNNGNFSIDSSTGVISTLASL 699          

HSP 2 Score: 147.902 bits (372), Expect = 8.868e-36
Identity = 156/605 (25.79%), Postives = 279/605 (46.12%), Query Frame = 1
Query:  742 LKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKE-GLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVN-PTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKV--KSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPT---LTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTV---SANDQDQTSEFNTIEYHLESESD-VFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVI 2523
            +++ KPLDRE    Y+  L   D G   + T    + I + D NDN P F+S  Y   + E   N   +L+L+ATDPDEG NG + Y       TG   L +F ++  SG +   KPLD E+ +     + A +  + P      T + +V +++++  D        ++ +     + E  S   +    +     D+      R+ +  EI S  ++ +  +++  ++  + T  ++DRE     S  +L K+  D  +  SS K+E+ I D NDNAP    + YF   SI+EN  PG +  ++ A D DEG N  +++ +      +    SI  + GVI   + +D E  + +F   +++++A D G K  +    +++T+ +  DN+P F      FT+ EN  K + VG +    KD +  I+  + S +P  L   ++     I  +N    +DRE+  ++   VIA      P  S   TV++EV+D+NDN P         +T  VI  ++        V   +A D D   +   + Y L S ++ +  I+   G I   R++   D  ++ +++   + G     S++ +++ +
Sbjct:  377 IQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGF-VLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSI-----TGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAP-----KTGSTTVTVTIIDGNDNKPR----FMKSSYKGTISEGAS---IGATVLQVSATDVDSGDNGRITY--EISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQL-MSSVKVELTISDINDNAPVFYPVEYFA--SIMENEPPGKL-LQVTATDADEGTNAVISYDIIGGN--NNGNFSIDSSTGVISTLASLDHE--VEEF--FSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKDKNGSISYAIVSGDPTNL--FLVDSTGGIIKIN--GDMDREEKAQYLLAVIARVGTVKPL-SAQATVNIEVLDRNDNAPQF-------STSSVIVDIDGTWLVGQVVYNAAAVDLD-AGKNGLVRYQLTSNAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITL 938          

HSP 3 Score: 122.865 bits (307), Expect = 3.871e-28
Identity = 181/648 (27.93%), Postives = 284/648 (43.83%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDE-PLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDES--YKVKSFE--IRTNQEIDREKIPKISTNILCKESVDSHVP-SSSAKIEIIIKDQNDNAPTLTYFGTPSILENTKP----GTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKV-KSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFT-SSHMIFTIMENNMKNSFVGEIEV-EDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDI 2442
            P F + + +  ISE   IG T+    ATD D G+N   TY+IS  +        ++N L  LN+ T  L     LDRET + YSF ++A D G   Q   S+ + + I D NDN P F    Y   + E     ++L+++ATD DEG N  I Y        G      FSI+  +G I     LD+E + FF   + A +            TA V ++VLN  D  P+ +   Y    N+++ E       V  V  T+K+ +              I   I  GD +  + V S    I+ N ++DRE+  +    ++ +  V +  P S+ A + I + D+NDNAP    F T S++ +       G VV+   A D D G+NG V + +  +A      L I  T GVIK+ + + D +      T  T+ V A+D G  P+ + + I IT+  +N + PKFT SS++   +    +   F   + V +D   +  +   +   N   L F I         L   +SL +     ++  V ATD  G P+ S +  V + + D ND+  + +    NN     ++          T+ A+  D  S    I Y L S    F +D + G I TR  + + ++
Sbjct:  528 PRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDA-------QVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDP-QLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLLQVTATDADEGTNAVISYDIIGGNNNGN-----FSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYA----AKTAVVNVTVLNKADNLPVFLYEMY----NFTVYENVPKGTLVGRVYATTKDKN------------GSISYAIVSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIAR--VGTVKPLSAQATVNIEVLDRNDNAP---QFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNA---EGLLWINSTSGVIKLARKLTDGDE-----TQYTVQVLASDSGSPPQHSTMTIHITLS-IN-HPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGL-FGIFPGG----KLYIRKSLLQALKGSYDLIVRATDG-GVPSFSASVPVTIYIQDSNDHRSLFV----NNTFRFAVAENSSPGTLVGTLVAHALDH-SRTKDIVYSLISSESHFAVDVRSGQITTRVRLDREEL 1116          

HSP 4 Score: 120.168 bits (300), Expect = 2.303e-27
Identity = 164/663 (24.74%), Postives = 277/663 (41.78%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQ----FSSPIYKEFVKEGLNSV---RILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYD-EPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTL---TYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCES-SLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLN-------TTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESE--SDVFDIDRQEGTIFTRREMAKSDIGEHVIKI 2463
            P+F + +    I+E+ K G +I    A D+D G+N    Y I         +  + N +  L+S T  ++  + LD E  N Y+F+++A DGG    K     + I ++D NDN PQ    +  P   +      NS+    I  +  TD D   N +   K       G   +++         I L+KPLD E   F+   +   +   P   TL      V I V +V D  P   +  Y  N    I E  ++  +V  +  T  +     ++   +    ++      G      +S  + T + +DRE++  ++  I  ++   S   + S  + + I D NDN P     +Y GT  I E    G  V ++ A D D G+NGR+T+ +  S         +    GV+  KS +D E+ SL  FT L     A DHG     + +++ +TI D+NDN P F       +IMEN         ++V   D  +  N V+          +I    N  F ++       T  SLD E +  F+  + A D  GN   + T  V+V V+++ DN P+ ++   N      +    P+      V A  +D+     +I Y + S   +++F +D   G I    +M + +  ++++ +
Sbjct:  204 PVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDW-------DAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGG-VPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLGFY----FIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTL----GFVLIDVTDVNDNSPAFTSNAYTAN----ISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDL------GWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDH-GSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGT--ISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVL-----AKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKL---LQVTATDADEGTNAVISYD-------IIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDG-GNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENV----PKGTLVGRVYATTKDKN---GSISYAIVSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAV 814          

HSP 5 Score: 111.309 bits (277), Expect = 1.219e-24
Identity = 165/626 (26.36%), Postives = 268/626 (42.81%), Query Frame = 1
Query:  721 LNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGL--NSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGE-IYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDE-PLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKE----NDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSS--AKIEIIIKDQNDNAPTL--TYF----GTPSIL-ENTKPGTVVFKIIAQDKDEGENG----RVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESE----SDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVI 2523
             NS T  +     +DRETT + S  L  ++   ++Q    I++ +++ D NDN P+F +  Y   ++E +  N+   +  +ATDPD G NG + Y       T    L   +    S   +  KKPLD E   F++  + A +   P  +        + I++L+  D  P+     YL     SI E  K    +  V+   ++     D+  +I         I  L    D S  V    IRT Q +D E     + N++     D  VPS +  A + I + D NDN+P L  TY     G  +I  EN+   T +  I+  DKD   N     ++T   ++  F  +E+L        I+++  +D E  L  F  LT+ V  TD G+  +ST   + I + DVNDN P FTS+     I E     S+V ++   D D  D+  +         L +  +   + +  + T + LDRE+       + A D    P    T TV V +ID NDN P  +  S        IS         + VSA D D + +   I Y + S     + +F+++ Q G ++T+ ++ +     +   +   + G   + SSV+V + I
Sbjct:   44 FNSNTGVISTTARIDRETTTQISLQLRTLN--PSNQP---ISVQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPIN-TATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALM----GYCLINITILDENDHAPVFTQNSYLG----SIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDL----DSSTGV----IRTKQNLDFEVKNSYTFNVIAS---DGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCF-KVEFLGF----YFIQLQKPLDRE--LVPFYNLTLNV--TDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGL--VTTAKPLDREQVSSVTITITAQDHGSAPKTGST-TVTVTIIDGNDNKPRFMKSSYKG----TISEGASIGATVLQVSATDVD-SGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTI 627          

HSP 6 Score: 98.5969 bits (244), Expect = 1.154e-20
Identity = 88/310 (28.39%), Postives = 144/310 (46.45%), Query Frame = 1
Query: 1423 EIRTNQEIDREKIPKISTNILCKESVDSHV-PSSSAKIEIIIKDQNDNAPTLTYFG-TPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPK----FNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTS 2334
            E+  ++ +DRE     S N++ K +  S+    S+AKIEI + D ND  P       T +I E+   G++V  + A DKD G+NG + +S+      ++    +    G + V   +D E++  Q   LTI  TA DHG+ P S+ + +++ + DVNDN P F +  +  T+ EN      VG     D+D   + ++       +  P       +    + T  ++D E  P     F   V+ATD  G+P  S   ++ V+V D+NDN P  + P    A           +   MT++A D D+ S
Sbjct: 1215 ELHLSKTLDRETTS--SYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAM--FDVESATGRLIVAKSLDFETT--QLYELTI--TAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMY--SQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQ-GSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAG---------SSLNVMTITAEDPDRNS 1504          

HSP 7 Score: 72.0182 bits (175), Expect = 1.170e-12
Identity = 114/462 (24.68%), Postives = 195/462 (42.21%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNS-VRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYE----KQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNI-LCKESVDSHVPSSSAKIEIIIKDQN--DNAPTLT---YFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATD-HGIKPKSTDLQISITIQDVN 1887
            P+F E +  + I+E   IG  +    A+DKD G N +  Y IS         +  L  +  + S T  L V K LD ETT  Y   + A D G     + ++N+ + ++D NDN P F +      V+E +N+   + R +A+D D G N  I +    +  +       FS+N  + EI     +D E     +  F+  V+A +   P      ++  S+ + V +  D          N+  +       +   + ++T+T+++ D       R  + +   S+IS G+  Y   +    T Q     +IP   T   L  ++ D   PS   +  + +  +      PT +   Y G  S+ EN   GT V  ++A       NG + + +   +  S     + ++ GV+K    ID E   A F    +VV A D  G   +++   ++IT+QDVN
Sbjct: 1262 PVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSIS---------NGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSS-TVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKT-----FSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSP----KLSTRKSITVQVTDEND----------NSPGFVSPPAAAAGSSLNVMTITAEDPD-------RNSNGKVTYSIIS-GNNGY--FNLHPSTGQLQMIHQIPDNPTIYQLTIQASDGGQPSRQTQTVVSVFKEGPIGGGPTFSSADYQG--SVTENKVAGTSVVTVLAAYPQSSLNGNIEYYLTSDS--SKGGFEVVKSTGVVKTTRGIDREGMGASF---NLVVYAVDKQGPSARTSSATVTITVQDVN 1677          

HSP 8 Score: 70.0922 bits (170), Expect = 5.544e-12
Identity = 135/556 (24.28%), Postives = 235/556 (42.27%), Query Frame = 1
Query:  616 ATDKDFGNNQVETYKI-SRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGG-QTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGL-NSVRILRLSATDPDEGINGKIIYKF---DPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIA-VNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAP--TLTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKV--KSIIDCESSLAQF--TTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTR-SLDRE---KDPKFNFQVIATDSLGNPTN--SVTGTVDVEVIDQNDNFPI 2226
            ATD D G N V +Y I        F       V++TL S          LD E    +S  + A DGG +   KT  +N+ +  +++ DN+P F   +Y   V E +     + R+ AT  D+  NG I Y     DP         + F ++   G I +   +D E++  +   VIA V    P++     + A+V I VL+  D   + +         S++ +    + V  V   +   DL  + +  L  +Q  L+  ++G       S  I+  +++      + +  +L     DS  P   + + I I    ++ P  TL+ + T  +L +       F ++A D+D G+NG++ +S+ +           G  +G+  +     +    SL Q    +  ++V ATD G+   S  + ++I IQD ND+   F ++   F + EN+   + VG +     D H     ++ S   +   F +  ++ +I    TTR  LDRE   K+   N  ++  +++ N T        V V V D NDN P+
Sbjct:  660 ATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLAS----------LDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTV--LNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKDK--NGSISYAIVSGDPT--------NLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLS-----AQATVNIEVLDRNDNAPQFSTS-------SVIVDIDGTWLVGQVVYNAAAVDL-DAGKNGLVRYQ--LTSNAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLAS---DSGSPPQHSTMTIHITLSINHPPKFTLSSYVT-HVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQ-----------GNEEGLFGIFPGGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALD-HSRTKDIVYSLISSESHFAVDVRSGQI----TTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPV 1158          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 173.326 bits (438), Expect = 1.278e-43
Identity = 177/615 (28.78%), Postives = 282/615 (45.85%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKE-GLNSVRILRLSATDPDEGINGKIIYKF-----DPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYD-EPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDE---SYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTL-TYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANR-IFHLNTTRS-------LDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQD 2325
            PIF        I E V IG  + +  ATD+D G+N    Y I R +   F        +N +N V   L V K ++RET   Y+  + A D G +   T    + + + D NDN P F+S  Y   V+E    S  +L ++A D D G N  + Y       + RFK          IN  SG I    PLD+E+++ +   V A       T + YT+  +V I V+N+ D  P          +NY+      S    ++V V++ + D F S+           S++   D    S   +S  I T   +DRE +   +  +   ++ +  + S+   + I I D+NDN+P   +   + SILEN+ P +  FK+ A D DEG N R+T+++ ++     +   IG + GVI +   +D E+     +T  + + A DHG  P+++ + I +T+ D+ND+ P   SS +  ++ EN  K + V  I   D D    +N        A L F +L   ++ +F L+ T         LDRE+   +  ++   D  GNP+ S    V ++VID++DN P    P++ N T   IS   PR    + V+A D D
Sbjct: 1306 PIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAF-------AINAMNGV---LTVKKEINRETVPTYTLTIRASDRG-SPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFK----------INSTSGVIMTTTPLDFEEKSQYGLEVTA-------TDSKYTAKTNVTIRVINLNDITPA------FTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLS---------YSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPL-SNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRN-----DAFMIGASSGVITLAQPLDRENK----STYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTG--LN--------AELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADK-GNPSLSSVADVIIDVIDEDDNCP-RFQPTEYNVT---ISESLPRGASIVQVTARDID 1852          

HSP 2 Score: 160.229 bits (404), Expect = 1.521e-39
Identity = 194/682 (28.45%), Postives = 307/682 (45.01%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFG-NNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDE--SYKVKSF--EIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSM----EKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTS-EFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSP 2553
            P+F+  N   +I ES  IG T+    ATD D G   ++E   IS      F+          +++ +  ++V   LDRETT  YS  + A DGG T + + S  + I + D NDN P F  P      +      +I +++ATD D+  NG + Y             D FSIN  +G I LK  LDYEK+T +   V A +   P   +L      V++ V +V D P +    +  +     V EN +   VA+  VT+ + D       ++ +   ILS    G+E  ++ +  F  EI T   +DRE I   S  I   +       +++  + I I D+NDN PT T     +I E++  GT V ++ A D+D G NG VT+++    + ++F       +    G++ V+S +D E+      + T+VV A+D G   +S    I +++ DVNDN P+F  S     I E+   +S V +++VEDKD   +  + L         F I       F L+ T  LD E    +   V A D  G+P+ S T  V + +I+ NDN P  + P+Q  +    ++     N   + ++A D D T   F+ +E +  S    F ID+  G I   + + +     + + +     G  S   SV  N  I       N+P
Sbjct:  476 PVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFN----------IDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSS-STRVTIALQDINDNSPIFQGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDN-------TDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTV----VKVMVDDVNDNPPQ----FAKSLYTCTVGENLA-AGVAVCYVTATDAD--SGANGKISY--SILS----GNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATT-VNISIADENDNQPTFTGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSF------QLDPRSGILSVRSTLDRET----IPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFTIDSTG---FVLSKT-PLDYETTAAYQLTVTARDG-GSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAI----NTHVVKLNATDSDGTPLTFDIVEGNAGSS---FKIDQSSGLISVAKRLDRETTANYTLVVRATETG--SQGESVYNNATIRVLDVNDNAP 1097          

HSP 3 Score: 158.688 bits (400), Expect = 3.954e-39
Identity = 173/603 (28.69%), Postives = 282/603 (46.77%), Query Frame = 1
Query:  742 LKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSI-VEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKG-DESYKVKSFEIRTN--QEIDREKIPKISTNILCKESVDSHVPS--SSAKIEIIIKDQNDNAPTL----TYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSM---EKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLN-------TTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHL--ESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPG 2481
            + V K LDRETT  Y+  + A + G   +   + N  IR++D NDN P F+   Y + + E L     + +++ATD DEG N K+ Y+      +       F +N  +G +  K+PLD E Q  +   V A++   P       S ++V    L + D  L  N    +   Y++ V EN +N    I+ V + + D       R+ +     S+IS     ++++ S   R      +DRE +   +  I  K   DS VP   S+A + I + D+NDN+P      T +G   I E    G+ V  + A D+DEG N +V +S+   + SAF      +I   +GV+ VK  I+ E+      T T+ + A+D G    ++D ++++ + DVNDN P F S   I ++ EN+ +++ V  +  +D DV    N VLR         +I     + F +N       TT  LD E+  ++  +V ATDS      +VT    + VI+ ND  P     +Q N T  V     P +   + VSA+D+D    F ++ Y +    +SD F ID++ G I T   + +  +  + I++ V + G
Sbjct: 1051 ISVAKRLDRETTANYTLVVRATETGSQGESVYN-NATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTS------KFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKP-------SQSAVAAITLTIND--LNDNSPQFSQSKYTLTVTENTANGS-NILRVLASDPDA--GANGRVTY-----SIISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAK---DSGVPPWVSTAFVAITVADENDNSPIFASNETSYG---IDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAF------AINAMNGVLTVKKEINRET----VPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVG--ANAVLRYS-------IISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSKYTAKTNVT----IRVINLNDITPAF---TQQNYTASVREN-SPTSTSVVKVSASDRDS---FGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAG 1593          

HSP 4 Score: 157.532 bits (397), Expect = 1.037e-38
Identity = 188/684 (27.49%), Postives = 306/684 (44.74%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYD-EPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFGTPSIL---ENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKD--VHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTR-SLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLES--ESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRIE 2562
            P+F+       + E V IG  +    A+DKD GNN    Y  +        NH       TL++VT  + V + LD E  + Y+  L   D G +   T + ++ I + D NDN P FS   Y+  VKE  N+    ++SATD D   NG +++        G      F+I+  +G I + K  DYE +T +   V A +   PV       TA V I + +V D  P+       +  NYS      +     +VTVT+   DL    + RLE+   ++S   KG  +    S  IR + E+DRE  P  S  +  ++   +   SSS ++ I ++D NDN+P    F  P +    E++ PG  + ++ A D D+  NG V +++  +     +  SI  + G+I +K+ +D E    + T   + VTA D G   +S+   + + + DVNDN P+F  S    T+ EN      V  +   D D   +  I+  + S N  M  F + +    I    TTR  LDRE    ++  + A D       + T TV++ + D+NDN P    PS+ N     IS   P   +   ++A D+D       + Y + S  + + F +D + G +  R  + +  I  + + +   + G  S + S+  ++ +       N+PR E
Sbjct:  269 PVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNT----NH-----AFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRG-SPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKE--NTPAGTQVSATDRDSSTNGALVFGIIKGNDDGV-----FTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKY----DTAQVTIFIEDVNDHSPV------FSPSNYSKQIPESTVIGSTVVTVTA--TDLDSGPRGRLEY--RLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSR-SSSTRVTIALQDINDNSP---IFQGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNT----DVFSINTSTGLITLKTQLDYE----KKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENM-AFAMDRFTGEI----TTRVPLDRETIASYSLTINADDGSLVRFMAAT-TVNISIADENDNQPTFTGPSRFN-----ISEDSPTGTRVGQLTATDRD-IGPNGAVTYAIISGNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAG--SPQQSITASIHVSVLDVNDNAPRFE 895          

HSP 5 Score: 155.221 bits (391), Expect = 5.331e-38
Identity = 176/671 (26.23%), Postives = 302/671 (45.01%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEG-LNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNP-TPPVTITLYTSTASVEISVLNVYD-EPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFE--IRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTL---TYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINL-VLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVI 2523
            P+FN  +    + E++ IG T+    ATD+D G N   TY++S  +   F+          +N  T  +   +PLDRE    YS  + A+D G+  Q +    I + I D NDN PQFS   Y   V E   N   ILR+ A+DPD G NG++ Y         A     F I+  +G I +   +D E    +   + A +   PP     + STA V I+V +  D  P+  +    N  +Y I E       VA+VT T ++            + Q   S++     ++ + +    +   +EI+RE +P  +  I   +   S + +S  ++ +++ D NDN P     +Y G  S+ EN+   T V  + A D D G N  + +S+        +   I  T GVI   + +D E    + +   + VTATD     K+    ++I + ++ND  P FT  +   ++ EN+  ++ V ++   D+D    ++  ++  K+     F I +++  I   +T   LDRE    +  QV  TD+ GNP  S    V ++++D+NDN P       ++ +  ++    P ++ F  ++A D D+ +    I Y+L S +D F I    G I   + + + +   + + I   + G     SS+ + V +
Sbjct: 1097 PVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFE----------VNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQ-SAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNA-----FRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPP-----WVSTAFVAITVADENDNSPIFAS----NETSYGIDEGVSIGSRVAVVTATDRDEG---------SNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDR-GSPMMTSDKELTVVVNDVNDNPPVFNSQSYIG--SVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGN--DEKRFKINSTSGVIMTTTPLDFE----EKSQYGLEVTATDSKYTAKT---NVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDSDK--FSIDQRSGII---STADVLDRELVSLYAIQVRVTDA-GNPPLSNLTWVTIKILDENDNSPKF---DSSSYSSSILENSAPSSFSFK-LAATDADEGTNAR-ITYNL-SRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTV 1709          

HSP 6 Score: 130.183 bits (326), Expect = 2.479e-30
Identity = 167/654 (25.54%), Postives = 276/654 (42.20%), Query Frame = 1
Query:  601 ITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVRILR-LSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDRE-KIPKISTNILCKESVDSHVP--SSSAKIEIIIKDQNDNAPTLTYFGTPS-ILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNT-------TRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVID 2526
            + +  ATD+D G N   TY +   E     N F       +NS T E++   PLD ET + Y+  + A DG  T     +    I + D NDN P F+  +YK  V E +    I+R L+A D D GIN ++ Y       +      YF+++   G I  K   D E +  ++  + A +   P      +  A+VEI +L+V D     N    ++  Y+   +       A+VTVT+ + D   +   R           + G+ ++      +     + R     + S+  L     D   P  + ++ + I + D NDN P  +     S + ENT  GT   ++ A D+D   NG + F + K     +   +I  + G+I +    D E+     T   + V A D G+  K    Q++I I+DVND+ P F+ S+    I E+ +  S V  +   D D      L  R         +I       F+++        +  LDRE  P ++ QV A D   + + S +  V + + D NDN PI   P      V  +S      ++   V+A D D +S  + + Y L   +DVF I+   G I  + ++      ++++ +T  + G  S  S   V V++D
Sbjct:   88 VAIVTATDRDSGTNAAITYSLFSGE-----NKF------MMNSKTGEIRTVTPLDHETKDSYTMRISAFDGKHT-----TFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTS------YFTVDS-QGVIRTKGAFDRETKASYQVALRAQDGGSPS----RSGQATVEIEILDVND-----NRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYS--------FTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT---QVSATDRDSSTNGALVFGIIKGNDDGV--FTIDGSTGIISIAKSPDYENK----TRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYR---------LISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGG-STSRSSSTRVTIALQDINDNSPIFQGP-----YVFRVSESSSPGHQIGQVAATDADDSSNGD-VRYALSDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVD 676          

HSP 7 Score: 110.538 bits (275), Expect = 2.122e-24
Identity = 149/580 (25.69%), Postives = 246/580 (42.41%), Query Frame = 1
Query:  754 KPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVRILRLSATDPDEGINGKIIYK-FDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLN-NKNYSIVEENKSNFF--VAIVTVTSKEN--DLFRSIQCRLEHFQEILSLISKGDESYKVKSFE--IRTNQEIDREKIPKISTNILCKESVDSHVPSSS--AKIEIIIKDQNDNAPTLTYFG-TPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTT-------RSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESES--DVFDIDRQEGTIFTRREMAK 2433
            +  DRE+ ++Y   ++A D      K G   + I + DENDN P+F    Y   ++E   + ++  ++ATD D G N  I Y  F    K        F +N  +GEI    PLD+E +  +   + A +      + L                    I VD +N N  +  +   K+  +  VA+ ++  +    DL   I  RL +     SL+S GD SY     +  IRT    DRE   K S  +  +   D   PS S  A +EI I D NDN P  +    T S+ E+   G  +  + A DKD G N  + +S   ++  +    ++    GV+ V   +D E    Q ++  + ++ TD G  P +    + I + D+NDN P F+ S     + EN    +   ++   D+D          S N A++  +I    + +F ++ +       +S D E   +++  V A D  G P    T  V + + D ND+ P +  PS  +  +   + +       +TV+A D D +     +EY L S +    F+ID   G+I    E+ +
Sbjct:   26 RKFDRESESRYRLTVLAQDAANRCHK-GRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAAQVAIVTATDRDSGTNAAITYSLFSGENK--------FMMNSKTGEIRTVTPLDHETKDSYTMRISAFDGKHTTFVPL--------------------ITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSY-----SLVS-GDTSYFTVDSQGVIRTKGAFDRET--KASYQVALRAQ-DGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSF--TSGNTNHAFTLDAVTGVVTVSRSLDFE----QRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT---QVSATDRD---------SSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDR-GVPVKYDTAQVTIFIEDVNDHSP-VFSPSNYSKQIPESTVI---GSTVVTVTATDLD-SGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDR 543          

HSP 8 Score: 71.633 bits (174), Expect = 1.660e-12
Identity = 91/361 (25.21%), Postives = 157/361 (43.49%), Query Frame = 1
Query: 1432 TNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTL---TYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLN------TTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLES--ESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPG 2481
            T ++ DRE   +    +L +++ +         + I +KD+NDNAP     +Y    +I ENT P   V  + A D+D G N  +T+S+    F       +    G I+  + +D E+      + T+ ++A D     K T     IT+ DVNDN P F  S     + E+    S V ++   D DV   IN        A L + ++      F ++      T  + DRE    +   + A D  G+P+ S   TV++E++D NDN P +   +Q  A+V     +       +TV+A+D+D  +  + + Y   S   +  F +D   G +   R +       + + ++V + G
Sbjct:   24 TGRKFDRESESRYRLTVLAQDAAN-RCHKGRTVVVIDVKDENDNAPEFPLNSYVF--NIRENT-PAAQVAIVTATDRDSGTNAAITYSL----FSGENKFMMNSKTGEIRTVTPLDHETK----DSYTMRISAFDG----KHTTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVG--IN--------ARLSYSLVSGDTSYFTVDSQGVIRTKGAFDRETKASYQVALRAQDG-GSPSRSGQATVEIEILDVNDNRP-VFSSAQYTASVDEDVAI---GAAMVTVTASDKDNGNNAD-LRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRG 352          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 142.124 bits (357), Expect = 5.699e-34
Identity = 183/692 (26.45%), Postives = 297/692 (42.92%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQT---DQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDY-FSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSH--VPSSSAKIEIIIKDQNDNAPTLTYFG-TPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLV--LRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESES-DVFDIDRQEGTIFTRREMAKSDIGEHVIKI-TVFNPGYTSMKSSVQVNVVIDASTAKSNSPRIENFNIN 2577
            P F+++     I E V +   +T   ATD D G+N    ++I       F   F +N +N       E++V + LD E    ++  + A D GQ    +Q T    + I +ID NDN PQF S  ++  + E         R+ A D D G NG+I + F        +  D  FSINE++G I +K+ LD EK   F F + A +   P        TA + I++L++ D P + +      + ++ + EN S +  +++ V + + D   +          + S++S        + F I     I        +T  +   SV +   + SS+A + + + D N +AP       +  + E+   GT V  ++A D+D G N ++++S+  +  P     S+ ET GVIK    +D E    +  T    VTATDHGI        + I I DVNDN P F        + E+      V E+   D D+  +  ++    S       F I      I    T + LDRE  P++   V+ATD  G P    +  V V + D  D+ P+   P      V V     PR+   +TV A  QD + E   +   +   S  VFDI+   G I T  ++      E+ + +    +P +T      +  V++       N+P +E F++N
Sbjct:  232 PQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNF---FSINRING------EVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTT----VDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSF--------MQNDLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVP----FKEGTAQITITLLDINDNPPKFS----QEEYHTSIAEN-SRWGTSVLQVKAIDPDSGPT--------NVVYSIVSSSGHD---RCFRINPQGLITLSCTLNYNTKHVYVFSVSASDGMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSI-ATLVPEF---SVDETTGVIKTAGSLDRE----KVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQGII---RTLKPLDRETIPEYELTVVATDQ-GTPPGQASVKVKVILEDVKDSPPLFEKPLYE---VTVPEDTPPRS-PVITVKAKSQDLSPETGMMYSIVRGNSPQVFDINPNTGAIQTLMKLDYETQSEYRLTVRATLSPFFT------ETTVMVYLKDINDNTPVLEAFHMN 860          

HSP 2 Score: 140.584 bits (353), Expect = 1.839e-33
Identity = 178/679 (26.22%), Postives = 298/679 (43.89%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVR--ILRLSATDPDEGINGKIIYKFDPRFKTGALILD------YFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPT-PPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYS--IVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDE----SYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTL--TYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKA--NRIFHLN------TTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKS 2499
            P F+    +  +SE  ++G  +    A+D D G+N +  Y +S  +      +F      +++ +T  +   + LDRE  +++ F + A DGG+   + G +++ I ++D NDN P F   IY   + E   S+   +L + A+D D G NG++ Y           IL+       FSI E SG + + K LD EK   +   V A +   PP      ++T +V+I++L+V D          + K YS  I E+   N  V  V          R+  C      E+   I  G++    S    + E+R  Q++D E I   +  +  ++     + + +  ++I + D NDNAP    ++F T  I EN   G   +++ A DKD G NG +TFS  ++  P     SI E  G I +K  +D E    +    T  + A D G+  K    QI+IT+ D+NDN PKF+      +I EN+   + V +++  D D             P  + + I+  +  +R F +N       + +L+      + F V A+D +     S T  V V V D N + P     S  +A V   + L       +TV A D+D  S    I Y + +    F +D   G I T   + +  +  +  ++T  + G   +K+
Sbjct:   18 PQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATYF------SIDQITGVITTKRGLDREFLDRHFFRVKAEDGGEPSLE-GYMDLTINVLDVNDNGPIFERNIYAADIPED-KSIGDFVLAVRASDADSGSNGEVKY----------CILNSDGDNSAFSIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQGNPP-----RSATVTVKITLLDVND-----CTPQFSKKVYSATIREDVPVNQLVTTV----------RATDCDQGSNGEVFFEIVSGNDMNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTT-VDIALIDVNDNAPQFVSSHFQT-MIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQNDLP----FSINENTGGISIKEELDRE----KVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPD-----------SGPTNVVYSIVSSSGHDRCFRINPQGLITLSCTLNYNTKHVYVFSVSASDGM----LSSTALVYVNVTDSNTHAPEFKRRSY-SAEVKEDASL---GTSVLTVLATDRDTGSNAK-ISYSIATLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKA 628          

HSP 3 Score: 93.9745 bits (232), Expect = 3.102e-19
Identity = 141/577 (24.44%), Postives = 244/577 (42.29%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLN--VLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYD-EPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDE--SYKVKSFE--IRTNQEIDREKIPKISTNILCKESVDSHVP--SSSAKIEIIIKDQNDNAPTLTYFGTP----SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTG-----TVDVEVIDQN 2211
            P F++      I+E+ + G ++    A D D G   V  Y I        D  FR+N   L TL+           L+  T + Y F + A DG      + +  + + + D N + P+F    Y   VKE  +    +L + ATD D G N KI Y         A ++  FS++E +G I     LD EK   ++F V A +   P       + + V I + +V D +P+ +   Y       I    +      ++ V++ + D+ ++ Q        I S  S GD   ++ + S +  IRT + +DRE IP+    ++   + D   P   +S K+++I++D  D+ P    F  P    ++ E+T P + V  + A+ +D      + +S+ +   P  +   I    G I+    +D E+     +   + V AT   + P  T+  + + ++D+NDN P   + HM   + E  +      +I   D DV D +   +   N     +V L   +    L+  + L +   P  N ++  TD L   T S TG     +V  E+I Q+
Sbjct:  440 PKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNV-VYSIVSSSGH--DRCFRINPQGLITLSCT---------LNYNTKHVYVFSVSASDG----MLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSI-------ATLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIP----QLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGR------VIEVSASDADIGKNAQI-------IYSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVV---ATDQGTPPGQASVKVKVILEDVKDSPP---LFEKPLYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIVRGNSP--QVFDINPNTGAIQTLMKLDYETQ----SEYRLTVRAT---LSPFFTETTVMVYLKDINDNTPVLEAFHMNINVQEGKVPPEARYKIPAYDPDVSDKLTFKVMEGNAK--EWVTLNATSG--ELSVNKKLIQASKPA-NIKIAVTDGL--RTASATGSIMMTSVTTEMIQQS 954          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO41767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3G3])

HSP 1 Score: 139.428 bits (350), Expect = 4.245e-33
Identity = 184/656 (28.05%), Postives = 296/656 (45.12%), Query Frame = 1
Query:  589 IGHTITLPVATDKDFGNNQVETYKISRQEPRTF--DNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAID-GGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEG--LNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDY---FSINEDSGEIYLKKPLDYEKQTFFKFPV-IAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKE--NDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVP--SSSAKIEIIIKDQNDNAPTLT---YFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDR-----EKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMT-VSANDQDQTSEFNTIEYHL-ESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYT 2487
            +G T+    ATD D G N   TY +  Q   TF  D + ++  L       VEL      DRET   Y+F + A D GGQ        NI+I + D NDN P FS   Y   V E   L  V +L++ A D D G+N K+ Y         +L+ D    F+I   +G I L+KPL+ E +  +   V +    TPP++     S A+V+I VLN+ D P E +    +    ++ E+      V  V   S+E  ND+             IL     G  S   K+  I  N+++D E   K+ T  L  E+ D+  P   S++ + I + D NDN P  +   Y  +  + EN+  GT V ++ A D+D G N ++ +S+ +      +   I E  GVIKV   ID E    +  +  + V A D G+ P+  D  + I + DVNDN P+F+S+++   + E+++ N+ V  +   D+D            N A   F ++      F L++   + +       D ++  +V+  D+ G+P  S   ++ V+ I ++   P    P+ +  TV+V  Y    N   +  V A D+D     + + Y L  SE     +   EGT+  R  ++    G + + ++V +  YT
Sbjct: 2978 LGSTVLTVGATDADVGVNAELTYSVFGQGFGTFAVDKNGKMTNL-------VEL------DRETRPFYNFMVSAADIGGQACYS----NISIHLDDVNDNRPLFSQSSYFTAVYEDAPLKKV-LLQVKADDADVGVNRKLTY---------SLVTDAGGTFTIETGTGIISLEKPLNRELKENYTLNVEVMDGGTPPLS-----SIATVQIKVLNINDVPPEFSHSIYHG---NVSEDAPIGNEVVRVRAVSRESSNDVIT---------YAILRGADSGLFSIDRKNGTIHVNRKLDYETT-KLYT--LTVEASDAGPPVLRSTSYVRISVTDSNDNGPEFSEKRY--SAKVDENSALGTFVLQVFATDRDSGTNAQIKYSIAEGN--DAKKFKIVEETGVIKVSGDIDRE----EVASYRLKVRAQDQGLPPQVADTVVDIEVTDVNDNSPEFSSTNLTTVLSESSLPNAAVIHLRPHDRDAL---------GNGAPYQFTLISGDASRFKLHSNGLITKIGDVSHSDGQYRLRVLVADN-GHPPQSTEVSITVK-IAESKTHP----PNVHPLTVYVNLYGSNLNGGVIGRVKATDKDG----DLLHYSLVSSEQSSLLMISDEGTVRARANISP---GTYNLNVSVTDKRYT 3556          

HSP 2 Score: 124.79 bits (312), Expect = 1.177e-28
Identity = 152/601 (25.29%), Postives = 272/601 (45.26%), Query Frame = 1
Query:  733 TVELKVFKPLDRETTNKYSFDLMAIDGGQTD-QKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTY-FGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHV-ISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVI 2523
            T  ++V   LD E  N+Y   +M ++   +   +     + ++++D ND  P+F S  Y   + E ++   ++LR+ A D D G NG + Y    + K   L+ + F I++ +G I  +  LD EKQ  F+F V A +       T  TS  +V   VL+V D P +    +  ++  + V+E+ +    ++ T+T+ + DL       L +F  ILS   +     + K+  I  +  +DRE +     NI    S    + +S A+++I I+D NDN P  T       I ENT  G+ V  + A D D G N  +T+S+    F +      G      K+ ++++ +     F     +V+A D G +   ++  ISI + DVNDN P F+ S     + E+      + +++ +D DV  +  L       A   F I +    I  L   + L+RE    +   V   D  G P  S   TV ++V++ ND     + P  +++  H  +S   P   + + V A  ++ +++  T      ++S +F IDR+ GTI   R++       + + +   + G   ++S+  V + +
Sbjct: 2706 TGRVRVIGRLDYEIRNRY---VMIVEANVSAINQIARTVVVVQVLDINDVTPKFVSDPYLASIPENIDIGSKVLRVFAEDLDSGSNGMVTYALVSKDK---LVKEKFDIDQHTGWITTRGALDREKQPSFEFQVRATDNG----TTRLTSLTTVRAIVLDVNDTPPK----FSQSEFMASVKED-ALIGQSVTTITATDEDL----NTELYYF--ILSGDPQARFGIERKTGVIFVHGSLDRESVGSYDLNI----SASDGLFTSFAQMKIDIEDANDNPPICTQSIYVEHIKENTPLGSTVLTVGATDADVGVNAELTYSVFGQGFGTFAVDKNG------KMTNLVELDRETRPF--YNFMVSAADIGGQACYSN--ISIHLDDVNDNRPLFSQSSYFTAVYEDAPLKKVLLQVKADDADVGVNRKLTYSLVTDAGGTFTI-ETGTGIISLE--KPLNRELKENYTLNVEVMDG-GTPPLSSIATVQIKVLNIND-----VPPEFSHSIYHGNVSEDAPIGNEVVRVRAVSRESSNDVITYAILRGADSGLFSIDRKNGTIHVNRKLDYETTKLYTLTVEASDAGPPVLRSTSYVRISV 3262          

HSP 3 Score: 107.457 bits (267), Expect = 2.503e-23
Identity = 166/680 (24.41%), Postives = 294/680 (43.24%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGL--NSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVK--SFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTL---TYFGTPSILENTKPGTVVFKIIAQDKDEGEN---GRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVG--EIEVEDKDVHDDINLVLR-SKNPAMLPFVILKKANRIFHLNTTRSL-DREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQN---DNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLES--ESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVV 2520
            P+F++   E+ + E++ +G T+T   A+DKD G N   TY+I       F   FR+N ++ + SV         LD E    Y  ++ A+D    +QK GS ++ + ++D NDN P      +   V+E L  N+V +  + A+DPD G  G+I +      +        F+I+  SG I L++ LD+E+++ +   V   +   P   T      +V     N    P+      L       + EN     V  V ++ K  D       +   + +   +   G + + +   +  IRT  E+D E        +  K+  +S+   ++  + I I D ND AP     TY+  P + EN   G+ V ++ A+D D G +     +T   E++ F       I    G+I     +D E      +   + V+A+D G  P STD+  ++ I D NDN P+F     +  +      +   G  ++   D+D+  + +L    +K      F+I  ++  IF   T  SL D E    ++  ++A D+ G P  S +  V ++VI  N    N P + +  Q +A +     +   N   + + A D D    F+ I Y++ S    + F IDR  G I     + + +   + +++   + GY +    V +N++
Sbjct:  789 PVFDKTVYEVTLPENITVGQTVTHVHASDKDQGTNGFITYQIVND----FGGKFRVNRISGVVSVG------DYLDYEEQEMYKIEIQAMDSSVDNQKVGSTHVIVTLLDINDNSPIVKPKKFNVTVQEDLLVNAV-VTSIHASDPDSGPGGEIEFSLPESTRK-------FNIDSKSGVIRLRQRLDFEQKSTYNLTVRVTDKGSPALFTDVEVVVNVLDVNENSL-APVFSGGRILETS----INENSP---VGTVVISPKATD-------QDSWYLKYAIIDGTGVDKFIIDPDTGAIRTAGELDHEVADHYWLTVQAKDG-ESYPLYTNIPVLINIVDLNDEAPYFAPSTYY--PVLAENLPSGSSVVQVTAKDPDSGGSLLRYTITKGNEQNNF------VIDPQSGLITTLRPLDREFK----SEYKLTVSASDGGTPPVSTDVTFTVKITDENDNQPEFKEKQYVVGVFARQATSKSFGLYQVVATDEDIGSNADLRYSITKGNRDNKFIIDSRSGEIF---TNVSLVDGE---SYDLTIVAEDN-GLPKLSTSTNVLIDVIQGNKPSKNAP-VFWNKQYSADIQEDKRI---NSFVLIIGAEDPD----FDQITYNIASGNHGNKFTIDRYGGFITVAHSLDREEKSFYSLRVEATD-GYNTASVPVTINIL 1406          

HSP 4 Score: 105.145 bits (261), Expect = 1.205e-22
Identity = 179/700 (25.57%), Postives = 298/700 (42.57%), Query Frame = 1
Query:  535 YPIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVR-ILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEH-------FQEILSLISKGDESYKV--KSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLT-YFGTPSIL-----ENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFP--------IIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLE--SESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNV-VIDASTAKSNSP 2553
            +P+F   +  I ISES  I   ++  +ATD+D G N +  Y I   +    D+ F +N+       T EL V  PLDRET + Y+ ++ A+D G+  +K+    + ++I D ND  P F   +Y+  + E +   + +  + A+D D+G NG I Y+    F         F +N  SG + +   LDYE+Q  +K  + A++          +S  + ++   +V    L+I      N N  IV+  K N       VT +E+ L  ++   +           EI   + +    + +  KS  IR  Q +D E   + ST  L     D   P+    +E+++   + N  +L   F    IL     EN+  GTVV    A D+D   +  + +++       ++   I    G I+    +D E  +A    LT  V A D    P  T++ + I I D+ND  P F  S     + EN    S V ++  +D D    +     +K      FVI  ++  I    T R LDRE   ++   V A+D  G P  S   T  V++ D+NDN P        + +F  Q  +          +++    V A D+D  S  + + Y +   +  + F ID + G IFT   +   +   + + I   + G   + +S  V + VI  +    N+P
Sbjct:  683 HPVFRSHDQNIHISESTPIATVVSQFMATDEDKGYNGLVLYSIVEGD---VDSVFNINMF------TGELTVAMPLDRETISSYTLNISAVDCGK-HRKSAYTILNVKITDVNDCSPVFDKTVYEVTLPENITVGQTVTHVHASDKDQGTNGFITYQIVNDFG------GKFRVNRISGVVSVGDYLDYEEQEMYKIEIQAMD----------SSVDNQKVGSTHVIVTLLDI------NDNSPIVKPKKFN-------VTVQEDLLVNAVVTSIHASDPDSGPGGEIEFSLPESTRKFNIDSKSGVIRLRQRLDFE---QKSTYNLTVRVTDKGSPALFTDVEVVVNVLDVNENSLAPVFSGGRILETSINENSPVGTVVISPKATDQD---SWYLKYAIIDGT--GVDKFIIDPDTGAIRTAGELDHE--VADHYWLT--VQAKDGESYPLYTNIPVLINIVDLNDEAPYFAPSTYYPVLAENLPSGSSVVQVTAKDPDSGGSLLRYTITKGNEQNNFVIDPQSGLI---TTLRPLDREFKSEYKLTVSASDG-GTPPVSTDVTFTVKITDENDNQPEFKEKQYVVGVFARQATS----------KSFGLYQVVATDEDIGSNAD-LRYSITKGNRDNKFIIDSRSGEIFTNVSLVDGE--SYDLTIVAEDNGLPKLSTSTNVLIDVIQGNKPSKNAP 1314          

HSP 5 Score: 104.375 bits (259), Expect = 2.017e-22
Identity = 154/608 (25.33%), Postives = 247/608 (40.62%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNK--YSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSI-VEENK--SNFFVAIVTVTSKENDL---FRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLT---YFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQD 2325
            PIF+E   ++  +E+   G  +T+  ATD D GN    TY I   +       FR++  + +      L      DRE +++   S  + A DGG    + G   + + +IDENDN P F    Y   +   +     +L  SA+DPD   N  + Y        G      F+IN  +G I + +  + +   FF       NP       L  S ASV+I+VL       +  + +     Y + V EN         +  V    N +   +R I+   ++      + S G    +V+    R + EI    +  +  N+     +   V      + + + D ND  P      Y    SI EN   G+ V ++ A+D D G NG VT+++        E   I +  G I  +  +D E       +    V ATD+G    ++   +   + DVND  PKF+ S  + ++ E+ +    V  I   D+D++ ++   + S +P    F I +K   IF      SLDRE    ++  + A+D L   T+     +D+E  D NDN PI       +  V  I    P     +TV A D D
Sbjct: 2442 PIFSEDVYKVSFNENYPEGTFVTMVSATDLDSGNYAHLTYSIDSVDAM---RKFRIDADSGM------LYSRLMFDRENSSQAIMSVPIRATDGGG---RFGFCVVEVHLIDENDNQPIFELKNYDTTISRSVTMGTPVLMTSASDPDASSNAALTYVI-----VGHQTPPVFTINAATGVIQVSREPEVKSYNFFVLVKDGGNP-------LLRSIASVKITVLE-----RDARILHFGKSKYDVTVGENAEMGQIVTGLNLVVPGGNPVDVDYRIIKGNNDNNDRKFGVDSTG----RVRVIG-RLDYEIRNRYVMIVEANVSAINQIARTV------VVVQVLDINDVTPKFVSDPYLA--SIPENIDIGSKVLRVFAEDLDSGSNGMVTYALVSKDKLVKEKFDIDQHTGWITTRGALDREKQ----PSFEFQVRATDNGTTRLTSLTTVRAIVLDVNDTPPKFSQSEFMASVKEDALIGQSVTTITATDEDLNTELYYFILSGDPQAR-FGIERKTGVIF---VHGSLDRESVGSYDLNISASDGLF--TSFAQMKIDIE--DANDNPPI----CTQSIYVEHIKENTPLGSTVLTVGATDAD 2991          

HSP 6 Score: 86.6557 bits (213), Expect = 4.655e-17
Identity = 140/582 (24.05%), Postives = 238/582 (40.89%), Query Frame = 1
Query:  736 VELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGL-NSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTAS--VEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKG--DESYKVKS----FEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFGTPSILENTKP-GTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKS---TDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKD-PKF-NFQVIATDSLGNPTNSVTGT-VDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYH--LESESDVFDIDRQEGTIFTRREM 2427
            +++K  K L+RE+   Y  +++  D  +T +      + I + D NDN P F    Y + + E +     I R+ A D D G NG I Y F  +  +       F+IN  SG + + + L    +   +  V+A +   P +    +      V +  +N +     +     N      V E  S    A + +  K+      I  R+E        I+ G  D ++ +KS    + ++  + +DRE  P      L      + V + S  + + + D+NDN P        + L    P  T V +++A DKD G NG + + + +     L    I    G I  K  +D ES         + V A D G+  +S   + + + + I D ND+ P+F +      + E+    + V  +  ED D   +  +     N   +PF I      I    TT +LDR+   P+F N QV A+D  G P    T T V + V + NDN P++    Q    + ++    P      TV+A D D + +  ++ Y     +    F +D + G + T R +
Sbjct:   55 MDIKTSKRLNRESVASYELNVVVQDK-RTKRTLDRTKVNITVDDSNDNRPIFLKKKYLKTIPEDIPMHTSIARIEAVDADVGPNGLIYYSFKEKTTS-------FAINPISGVVSVAQKLSNSAR-IHRLTVVARDRALPPSKPKSSRNCQLIVNVQAVNQFSPEFSVKTQLQN------VSEGTSGIVYATLGIIDKDKGSNGDID-RVE--------ITSGNLDGAFSIKSSPNDYAVQVIKPLDRELAPFGYNVTLTAYDKGTPVRNGSYVLRVNVLDENDNNPEFNQSRYITNLSELAPIHTPVLRVLATDKDAGSNGNIMYVITRGN--ELGKFEINSKTGQIYTKGDLDYESR----QRFDLTVAALD-GVPLQSRKISTVPVVVNILDANDHDPEFKAPEYRKDLYEDLTPGTSVFTVSAEDLDSGGNGKVRYSLANLRPVPFEIEPDTGII---RTTTNLDRDTGLPEFINLQVRASD-FGTPLRRETETLVKMRVKEMNDNAPVL---KQFKCNI-LVDRNAPVGVLITTVTAIDIDISDKDQSLMYKSTFGNTGKAFSLDPKTGELRTARSL 597          

HSP 7 Score: 77.411 bits (189), Expect = 3.293e-14
Identity = 137/588 (23.30%), Postives = 240/588 (40.82%), Query Frame = 1
Query:  760 LDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVRIL-RLSATDPDEGINGKIIYKF---DPRFKTGALILDYFSINEDSGEIYLKKPLDYEK-QTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDE----SYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPS-SSAKIEIIIKDQNDNAPTLT---YFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLR-SKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLE--PRNYKFMTVSANDQDQTSEFNTIEYHLESESDV--FDIDRQEGTIFTRREMAKSDIGEHVIKITV 2469
            LDRE+ + Y   + A D            + +++ID NDN P F +  Y   ++ G+    I+ +  ATD D G N  + Y     DP          YFSI+  +GE+ +++ LD  K    F   V A       T  L+ + A V+I V++  + P+       +  ++S V    +     + +VT+           R  +   IL  I+ GD     S   K+  +     +D E   K     L   + D+   S S   +++ + D ND AP      Y  T  I E+T   T V  + A D D G N  + + ++  +     +  I +  GV+ V   +D ES +       +++ A D G    + + ++ + + D NDN P+F  S    +I+ +     FV  I   D D  D   L    +       F I  ++  I     +R +  ++   +   V  +DS+    +  T  V V + D ND+ PI       +  V+ +S+ E  P       VSA D D +  +  + Y ++S   +  F ID   G +++R    + +  + ++ + +
Sbjct: 1993 LDRESIDAYQVIVQARDD-SVPPNVAQAAVHVQVIDRNDNQPVFINSPYFIVLQLGVAQGTIIGQAQATDADIGSNANLRYDLIGGDP---------GYFSISRKTGEVVVRRTLDDVKVPRLFTLMVEA-------TDGLFRTEAVVKIKVVD-KETPV------FDQLSFSKVLAEDTPIGSEVTSVTA-----------RSPNGAGILYSITGGDPVNQFSIDFKTGVVTLVSSLDYETRTKYK---LVVRATDARTSSHSDVAVDVTVTDVNDVAPAFNRSLYLAT--ISESTPVDTAVVTVKAIDGDSGINKEINYFIQNVSRVG-AFFKIDKKSGVVFVAKSLDYESRVVH----EMIIVAADEGKPSLTGETRVRVVLMDANDNAPRFDKSMYAASILGSASPGQFVTRILATDPDEGDAKKLRYSITGGQGRQHFQIDSQSGVI---TLSRVVGIKQGKVYGLDVEVSDSV----HVSTSKVRVIIGDTNDHSPIF------SEDVYKVSFNENYPEGTFVTMVSATDLD-SGNYAHLTYSIDSVDAMRKFRIDADSGMLYSRLMFDRENSSQAIMSVPI 2521          

HSP 8 Score: 70.8626 bits (172), Expect = 3.071e-12
Identity = 123/452 (27.21%), Postives = 198/452 (43.81%), Query Frame = 1
Query:  592 GHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIY--KEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPL-DYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYS--IVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVK----SFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFGTPS-ILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSA-FPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTS 1911
            G ++    A D D G + +  Y I++   +   N+F ++  + L      +   +PLDRE  ++Y   + A DGG     T  +   ++I DENDN P+F    Y    F ++  + S  + ++ ATD D G N  + Y      +    I+D       SGEI+    L D E    +   ++A +   P    L TST +V I V+   ++P + N     NK YS  I E+ + N FV I+     +             F +I   I+ G+   K         I     +DRE+    S  +   E+ D +  ++S  + I I D NDN+P        + + EN+  GT+V  +  +D D G NG V + + ++A   S     I    G I     +D E+   Q   LTI   A+D GI  + T   + +++ DVND+ P+F S
Sbjct: 1120 GSSVVQVTAKDPDSGGSLLR-YTITKGNEQ---NNFVIDPQSGL------ITTLRPLDREFKSEYKLTVSASDGGTPPVST-DVTFTVKITDENDNQPEFKEKQYVVGVFARQATSKSFGLYQVVATDEDIGSNADLRYSITKGNRDNKFIID-----SRSGEIFTNVSLVDGES---YDLTIVAEDNGLP---KLSTST-NVLIDVIQ-GNKPSK-NAPVFWNKQYSADIQEDKRINSFVLIIGAEDPD-------------FDQITYNIASGNHGNKFTIDRYGGFITVAHSLDREEKSFYSLRV---EATDGY-NTASVPVTINILDVNDNSPQPARREYRAHVAENSDVGTLVTTV--KDPDAGVNGEVEYCIVQTAKAESASLFKIESHSGRILTVKPLDYET--MQEHVLTI--KASDRGIPKRETLFSVVVSVDDVNDHKPEFLS 1523          

HSP 9 Score: 70.4774 bits (171), Expect = 4.603e-12
Identity = 151/661 (22.84%), Postives = 270/661 (40.85%), Query Frame = 1
Query:  613 VATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDEND---NMPQFSSPIYKEFVKEG--LNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYD-EPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDL-------FRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSA--KIEIIIKDQNDNAPT-LTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLV---LRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVI-------SYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNV 2517
            VATD+D G+N    Y I++      DN F ++  +         ++F  +       Y   ++A D G     T S N+ I +I  N    N P F +  Y   ++E   +NS  +L + A DPD     +I Y             + F+I+   G I +   LD E+++F+   V A       T    T++  V I++L+V D  P     +Y  +     V EN     V  +  T K+ D        +  +Q        +  + S       VK  +  T QE           ++L  ++ D  +P       + + + D ND+ P  L+      +  + K GT + ++IA DKD+G N ++ +S+      + + LS+ +  GV+KV   +   S+L     L   V +TD G  P  T + + + ++ +  N   F       ++ EN+  +  +  +      V++ I  V   +  ++P    F + +++  I    + +S D E+      ++ A  + G  ++++   V V + D+NDN PI         T HV        + L+ +  + + V A DQD + +  T E    S  DVF I    G I T + +      ++  KI V + G   + +   V +
Sbjct: 1233 VATDEDIGSNADLRYSITKGNR---DNKFIIDSRSG--------EIFTNVSLVDGESYDLTIVAEDNGLPKLST-STNVLIDVIQGNKPSKNAPVFWNKQYSADIQEDKRINSF-VLIIGAEDPD---FDQITYNI-----ASGNHGNKFTIDRYGGFITVAHSLDREEKSFYSLRVEA-------TDGYNTASVPVTINILDVNDNSPQPARREYRAH-----VAENSD---VGTLVTTVKDPDAGVNGEVEYCIVQTAKAESASLFKIESHSGRILTVKPLDYETMQE-----------HVLTIKASDRGIPKRETLFSVVVSVDDVNDHKPEFLSPLFESEVDVSAKAGTAILRVIATDKDDGTNSKLKYSIVSGN--TNKSLSVDQNSGVVKVAGRL---STLVHQYALK--VQSTDGGEPPLKTQVDVKVKVRGIVKNF-AFEKPKYEVSLPENSPPDQAIATV------VYNGILPVYEIVPGRSPCWRDFTVQRQSGVII---SKKSFDAEEVTHCKLEIRANSTDGQHSSTL---VIVTIQDKNDNQPIF---EHARITGHVTEGSPQGTAVLDHKGSQLVAV-ATDQDISGDKLTYEIVETSARDVFSIHPATGAITTAKVLDYEVTPQYAFKIKVTDSGNPRLSAFADVKI 1822          

HSP 10 Score: 70.4774 bits (171), Expect = 4.801e-12
Identity = 146/634 (23.03%), Postives = 253/634 (39.91%), Query Frame = 1
Query:  583 VKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLM--AIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKV--KSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSA--KIEIIIKDQNDNAPTL-TYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILK-KANRIFHLNTTRSL-------DREKDPK--FNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESD--VFDIDRQEGTIFTRRE 2424
            V  G  I    ATD D G+N    Y +   +P  F          +++  T E+ V + LD     +  F LM  A DG    +      + I+++D+    P F    + + + E       +  ++A  P+      I+Y       TG   ++ FSI+  +G + L   LDYE +T +K  V A +            T+S     ++V    +       N   Y       +    A+VTV + + D    I   + +F   +  +S+    +K+  KS  +   + +D E   ++   ++   + D   PS +   ++ +++ D NDNAP         SIL +  PG  V +I+A D DEG+  ++ +S+  +     ++  I    GVI +  ++  +    +   L + V+ + H    K     + + I D ND+ P F+      +  EN  + +FV  +   D D          S N A L + I    A R F ++    +       DRE   +   +  + ATD  G     V   V+V +ID+NDN PI    + +      ++   P     +  SA+D D +S    + Y +       VF I+   G I   RE
Sbjct: 2048 VAQGTIIGQAQATDADIGSNANLRYDLIGGDPGYF----------SISRKTGEVVVRRTLDDVKVPRL-FTLMVEATDGLFRTEAV----VKIKVVDKE--TPVFDQLSFSKVLAEDTPIGSEVTSVTARSPN---GAGILYSI-----TGGDPVNQFSIDFKTGVVTLVSSLDYETRTKYKLVVRATD----------ARTSSHSDVAVDVTVTDVNDVAPAFNRSLYLATISESTPVDTAVVTVKAIDGD--SGINKEINYF---IQNVSRVGAFFKIDKKSGVVFVAKSLDYES--RVVHEMIIV-AADEGKPSLTGETRVRVVLMDANDNAPRFDKSMYAASILGSASPGQFVTRILATDPDEGDAKKLRYSI--TGGQGRQHFQIDSQSGVITLSRVVGIKQ--GKVYGLDVEVSDSVHVSTSK-----VRVIIGDTNDHSPIFSEDVYKVSFNENYPEGTFVTMVSATDLD----------SGNYAHLTYSIDSVDAMRKFRIDADSGMLYSRLMFDRENSSQAIMSVPIRATDGGGRFGFCV---VEVHLIDENDNQPIFELKNYDTTISRSVTMGTP----VLMTSASDPDASSN-AALTYVIVGHQTPPVFTINAATGVIQVSRE 2611          

HSP 11 Score: 67.781 bits (164), Expect = 3.015e-11
Identity = 109/446 (24.44%), Postives = 181/446 (40.58%), Query Frame = 1
Query:  883 PQFSSPIYKEFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILD-YFSINEDSGEIYLK--KPLDYEKQTF-FKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQ--EILSLISKGDESYKV----KSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEII-----IKDQNDNAPTLTYFGTPS----ILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIK-PKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHD-DINLVLRSK-NPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSL 2154
            P+FS     + V EG + +    L   D D+G NG I      R +  +  LD  FSI     +  ++  KPLD E   F +   + A +   PV    Y       +  +NV DE         N+ N    E N+S +   +  +      + R +    +      I+ +I++G+E  K     K+ +I T  ++D E   +    +   +     VP  S KI  +     I D ND+ P    F  P     + E+  PGT VF + A+D D G NG+V +S+        E   I    G+I+  + +D ++ L +F  L   V A+D G    + T+  + + ++++NDN P          +  N      +  +   D D+ D D +L+ +S        F +  K   +    + R L RE    F   + ATD +
Sbjct:  209 PEFSVKTQLQNVSEGTSGIVYATLGIIDKDKGSNGDI-----DRVEITSGNLDGAFSIKSSPNDYAVQVIKPLDRELAPFGYNVTLTAYDKGTPVRNGSY-------VLRVNVLDE---------NDNN---PEFNQSRYITNLSELAPIHTPVLRVLATDKDAGSNGNIMYVITRGNELGKFEINSKTGQIYTKGDLDYESRQRFDLTVAALDG----VPLQSRKISTVPVVVNILDANDHDPE---FKAPEYRKDLYEDLTPGTSVFTVSAEDLDSGGNGKVRYSLANLRPVPFE---IEPDTGIIRTTTNLDRDTGLPEFINLQ--VRASDFGTPLRRETETLVKMRVKEMNDNAPVLKQFKCNILVDRNAPVGVLITTVTAIDIDISDKDQSLMYKSTFGNTGKAFSLDPKTGELRTARSLRGLQRE----FTLIIKATDGI 614          

HSP 12 Score: 58.9214 bits (141), Expect = 1.311e-8
Identity = 142/629 (22.58%), Postives = 248/629 (39.43%), Query Frame = 1
Query:  583 VKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVEL--KVFKPLDRETT--NKYSFDLMAIDGGQTDQKTG-SINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVRILRLSATDPDEGI-----NGKI-IYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTL---TYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREM 2427
             K G  I   +ATDKD G N    Y I                 NT  S++V+    V K   R +T  ++Y+  + + DGG+   KT   + + +R I +N     F  P Y+  + E            + PD+ I     NG + +Y+  P     +     F++   SG I  KK  D E+ T  K  + A +     + TL   T   +     +++           +   + V ++K +  VA+ T      D       +L +  EI+   ++   S    +  I T + +D E  P+ +  I   +S +  + S+ A ++I + D ND AP     TY  T  +   +  GT V  + A D D   N  +TFS+ +      E  ++    GV+ V +     ++L +  T TI +T +D      +   ++ I  +++  +  +F+  +   ++ E    +S +  +      +   I   +   NP+ L  ++   +  +  +     LDRE    +   V A D    P N     V V+VID+NDN P+ I    N+    V+     +        A D D  S  N     +  +   F I R+ G +  RR +
Sbjct: 1534 AKAGTAILRVIATDKDDGTNSKLKYSIVSG--------------NTNKSLSVDQNSGVVKVAGRLSTLVHQYALKVQSTDGGEPPLKTQVDVKVKVRGIVKNF---AFEKPKYEVSLPEN-----------SPPDQAIATVVYNGILPVYEIVP---GRSPCWRDFTVQRQSGVIISKKSFDAEEVTHCKLEIRANSTDGQHSSTLVIVTIQDKNDNQPIFEHARITGHVTEGSPQGTAVLDHKGSQLVAVATDQDISGD-------KLTY--EIVETSARDVFSIHPATGAITTAKVLDYEVTPQYAFKIKVTDSGNPRL-SAFADVKIHVTDINDIAPVFSASTYHAT--VYLPSYAGTRVTMVTATDGDSAAN--LTFSLARQ---DTELFAVNPLTGVVTVSN-----AALLRRDTYTIKLTVSDGN---HTAHARVRIRCENLPSSDLQFSRKNYSASVREGVSVDSELVTVRALGYPIGSTITYTI--INPSELFHIV--PSTGVMSIRAGFDLDRESIDAYQVIVQARDD-SVPPNVAQAAVHVQVIDRNDNQPVFI----NSPYFIVLQLGVAQGTIIGQAQATDADIGSNANLRYDLIGGDPGYFSISRKTGEVVVRRTL 2097          

HSP 13 Score: 52.7582 bits (125), Expect = 9.620e-7
Identity = 96/375 (25.60%), Postives = 152/375 (40.53%), Query Frame = 1
Query: 1513 PSSSAKIEIIIKDQ--NDNAPTLTYFGTPSILENTKPGT--VVFKIIAQ-DKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKS---------IIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLV-LRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNS---VTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDV-FDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGY-TSMKSSVQVNVVIDASTAKSNSPRIENFNIN 2577
            P SS   ++I+  Q  N  +P    F   + L+N   GT  +V+  +   DKD+G NG +           +E  S G  DG   +KS         I   +  LA F    + +TA D G   ++    + + + D NDN P+F  S  I  + E    ++ V  +   DKD   + N++ + ++   +  F I  K  +I+   T   LD E   +F+  V A D  G P  S    T  V V ++D ND+ P    P        +   L P    F TVSA D D       + Y L +   V F+I+   G I T   + +       I + V    + T ++   +  V +       N+P ++ F  N
Sbjct:  189 PKSSRNCQLIVNVQAVNQFSPE---FSVKTQLQNVSEGTSGIVYATLGIIDKDKGSNGDID---------RVEITS-GNLDGAFSIKSSPNDYAVQVIKPLDRELAPFG-YNVTLTAYDKGTPVRNGSYVLRVNVLDENDNNPEFNQSRYITNLSELAPIHTPVLRVLATDKDAGSNGNIMYVITRGNELGKFEINSKTGQIY---TKGDLDYESRQRFDLTVAALD--GVPLQSRKISTVPVVVNILDANDHDPEFKAPEYRK---DLYEDLTPGTSVF-TVSAEDLDSGGN-GKVRYSLANLRPVPFEIEPDTGIIRTTTNLDRDTGLPEFINLQVRASDFGTPLRRETETLVKMRVKEMNDNAPVLKQFKCN 539          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 138.272 bits (347), Expect = 7.960e-33
Identity = 172/645 (26.67%), Postives = 287/645 (44.50%), Query Frame = 1
Query:  535 YPIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQF-SSPIYKEFVKEGLNSVRILRLSATDPDEGINGKIIYKFD---PRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKS-NFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLT---YFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLV--LRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESES-DVFDIDRQEGTIFTRREMAKS 2436
            YP+F        + E + IG  +   +A D D G+N    YKI        D  F+      +N  T  +   + LD E TN+Y   + A D G+  QKT    + I + D NDN P F  +PI     +    +  +  + A D D G+N +I Y  D   PR         +F IN ++G I    P+D E+ + +   V A +        LY +TA+++I + ++ D     N     ++N + V E++  NF V  +T    +     +++ R+            G  S  +K+  ++    +D E +P+ + +I   + + S   +S     +++ D NDN P  T   + GT S  EN   GT V K+ A D+D G N  +T+S+       ++  SI +  G+I   SI+D E     F  LT+  T   +  +  ST ++I+  + D NDN PKF S  +   + EN+     +  + V+D D  ++  ++  + S N     F I +       L+TT  LDRE    +   V A D +  P  +    + + + DQNDN P+     Q +     IS L P     + ++A+D+D  S  N I Y L +++  V+ ID + G +++      S
Sbjct: 1221 YPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNT---DGTFK------INETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRA--------HFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLY-NTATLKIIIQDLND-----NAPKFVSRNLTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVS-------PDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATD-LGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVS--ENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGV--EMDKFSIDKHSGLIVTNSILDREKKDTYF--LTVHATGVSYPFRVSSTSVRIN--VMDRNDNPPKFISPVVTLKVPENSPAR-LIYTLTVQDLDYGNNTKVLYSIMSGNTDGA-FTIGRSTG---ELSTTTKLDRETKASYQLSVQAKD-ITPPYYTAFANITIFIEDQNDNPPVF----QQSLYSSTISELTPPGTSILNLTASDKDSGSNGN-IVYTLSNDTYGVYSIDSRTGIVYSAARFETS 1815          

HSP 2 Score: 138.272 bits (347), Expect = 8.813e-33
Identity = 152/556 (27.34%), Postives = 247/556 (44.42%), Query Frame = 1
Query:  613 VATDKDFGNNQVETYKISRQEPRTFDNHFRL-NVLNTLNSVTVELKVFKP---LDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFE-------IRTNQEIDREKIPKISTNILCKESVDSHVPSSSAK-IEIIIKDQNDNAPTL---TYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKS--AFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPI 2226
            +A D DFG+N  ++Y I         N F+L +  +T   +  +L V      +DRE  + Y  ++ A DGG      G + ++I + D NDN P+FS+  Y   + E ++    IL++SA+D D G N +I Y  +      A+    F I+  +G I     LDYE +  +   +I V      +    +S+A V I VL+V D    I+V Y    +Y + E       VA V+V+  ++     +   LE           G + Y    F+       I   Q +DRE         +C +  D   P ++ K   I + D ND AP     TY     + EN    T+V  + A D+D G N  + +++  +  +   L + +I  + G+I   + +D E    Q   + + V   D G  P S +  + + + D NDN P F  S    ++ EN+   S V ++  +D D+ ++ +L+L S      PF +  +   +     +R+LD E    + FQV ATD  G   N+   TV V + D NDN P+
Sbjct:   80 IAVDSDFGSNSTQSYTIVSGN---VGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANH-GFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAI----FGIHPTTGVIVNNVRLDYEAKRSY---LIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLE-----------GGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDP--PRTTEKSFRINVGDVNDCAPKFDRHTY--ETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDRE----QIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGEN-SLILYSILTPNTPFFLDPRKGLV---TNSRTLDHEVQSSYTFQVAATDGGGRSCNA---TVHVSLTDLNDNQPV 598          

HSP 3 Score: 134.42 bits (337), Expect = 1.182e-31
Identity = 147/585 (25.13%), Postives = 263/585 (44.96%), Query Frame = 1
Query:  742 LKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVRIL-RLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNP-TPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKS--FEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFG-TPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPG 2481
            + + K LDRET + Y   + A+DGG  D    +I + I ++D ND  P FS   Y   ++E   ++ ++  + A   D+G N +++Y    +  T  ++L    IN  +G +YL+  +D+EK       V A +  TPP+        A+V I+V+++ D   + N   +  +   + E+         V+V   ++ +   +           SL+S     + + S    +   + ID     +  T  +  +   S   SS+A +E+ + D ND +P    +  T  +LE T P + + +++A D D GENGR++++ +     S   L  G   G I +KS +D E          + V A DHG   +S+   + + + DVNDN P F  +   F + EN    +++G +   D D   + ++  R  +  +  F++ K+  +I    T++ LDRE    + F ++ATD   +P    T  V V V D ND  P     S+N  +V V   L P     +T+ A D DQ    + I Y + +    F +++  G +     + +     H++ +   + G
Sbjct:  655 ITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAI-VNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSIS-KGNTDNIVL----INS-TGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLF-----GYANVTIAVIDINDNSPQFNSSSILVR---LPEDTPIGHTFYTVSVFDADSGVLGRVS---------FSLLSNPGTLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLRNG---GKIFIKSKLDRE----DIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRF-DTQVAQFIVDKQTGKI---TTSQVLDREAKASYVFSIVATDGGSSPRVDKT-QVTVIVRDVNDCSPKF---SKNKYSVTVNEDL-PVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKG 1199          

HSP 4 Score: 132.88 bits (333), Expect = 3.809e-31
Identity = 173/678 (25.52%), Postives = 285/678 (42.04%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYK-EFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINE-----DSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEP-LEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKV---KSFEIRTNQEIDREKIPKISTNILCKESVDSHVPS--SSAKIEIIIKDQNDNAPTLTYFGTPSIL----ENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVI 2523
            P FN+ +    + E+   G  +   +A D D G N +  Y I       F +  +  V N+           + LD E  + Y+F + A DGG    ++ +  + + + D NDN P F    Y  E+ +       I +L A D D            P+F     I++  + +E      SG I L K LD E Q  +   V AV+     ++    + A V I+VL+V DEP +    +Y    N++I E +++   +  V   S++               E++  ISKG+    V    +  +    E+D EKIP +   +  K   D   P     A + I + D NDN+P    F + SIL    E+T  G   + +   D D G  GRV+FS+  +  P   + ++    G + +  +ID  +S   +T   + V A D G  P+S+   + + + DVND  P F +      ++E    +S + E+   D D  ++  +     +        L+   +IF       LDRE   ++N +VIA D  G P  S +  V V V D NDN P      Q  +    +   EP       VSA+D D+ S  + + Y  +++   F +D+Q G I T + + +     +V  I   + G +      QV V++
Sbjct:  496 PYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTPFFLDPRKGLVTNS-----------RTLDHEVQSSYTFQVAATDGGG---RSCNATVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDS-----------PKFAITRFIIEQGNADEVFSVDGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSV----NKAIVNITVLDVNDEPPIFSKAEY----NFTIQEHSQALSVIGHVHAISRDKGTN----------AEVVYSISKGNTDNIVLINSTGTLYLQSEVDHEKIPSLYLTVQAK---DKGTPPLFGYANVTIAVIDINDNSPQ---FNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSN--PGTLF-NLDSNTGALSLTKLIDYGNSARSYT---LPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLRNGGKIF---IKSKLDREDIEEYNLKVIAIDH-GTPRRSSSADVKVIVDDVNDNNPHF----QQASYAFFVKENEPVATYLGAVSASDSDEGSNGH-VTYRFDTQVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIV 1109          

HSP 5 Score: 107.457 bits (267), Expect = 2.157e-23
Identity = 146/552 (26.45%), Postives = 234/552 (42.39%), Query Frame = 1
Query:  760 LDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVR---ILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPT-PPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFV--AIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDES---YKVK-SFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQN--------------DNAPTL---TYFGTPSILENTKPGTVVFKIIAQDKDEG-ENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKD--VHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQD 2325
            LD E+T  +   L+A   G      G + + I +ID NDN P F        + E   + +   +++++ATD D G NGK+ Y      + G      F+I+  +GEI   K LD E    F   +   +   PP      ++   V++ V ++ D P     D L+  N  I E+ ++   V   + T T KE+ L  +++        IL + +   +S    ++K SF I  + +ID  KI   +  I  + ++D  +  S  +I +   DQ                  P     +YFG   + EN   GT V  +   D   G   GR+++++E S      Y  IG+  GVI V   +D E+         +VV+A D     K   + + I + DVND  P F  S  +    E     + V  +   DKD   +  +   ++S +     F I +K   I    T R+LD E     +  V ATD  G+P      +V + V+D NDN P+   P  N+  V V+  L P N +   ++A D+D
Sbjct: 2025 LDYESTKNFRLHLVATPQGWVSLN-GYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGV-----FTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPP-----KSTNCQVKVVVTDLNDNPPLF--DPLSEVN--IREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDY-KIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITREPKFELPSYFG--KVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENS-----NYFRIGQRSGVISVNKPLDYETK----RRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKG-SFAIDRKTGVI---RTQRALDHETIKTHHVSVRATDE-GSPPMHTDVSVTIRVLDLNDNPPVFRVPGPND--VQVLENL-PLNSRLYEINATDRD 2541          

HSP 6 Score: 105.145 bits (261), Expect = 1.049e-22
Identity = 159/573 (27.75%), Postives = 249/573 (43.46%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDF-GNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGL--NSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESV--DSHVPSSSAKIEIIIKDQNDNAPTLTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLR-SKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFP 2238
            P F++    + ++E + +G ++   +ATD D  G N   TY I    P+ F          +LN VT  L +  PLDRE T+++   ++A D G          I I ++D NDN P F +    + V E L   SV +  + A D D+G NGK+ YK       G      F INE +G I   + LD+E    +   V A +       T Y         ++ +Y E    N    + KN  I+     N  +     T K +D    +  R+  +  I S   +       ++  I+T   IDRE+I + S  +   +    +     ++A ++III+D NDNAP         ++E+      V  I A D D G+ G V + +     P     S+    GV+K+   +D E  + Q+T   + ++ATD G  P ++    ++ + DVNDN P+FT    I T+ EN    + V ++   D+D   +  L         M  F I K +  I    T   LDREK   +   V AT  +  P    + +V + V+D+NDN P  I P
Sbjct: 1117 PKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIV-AGPKAF----------SLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSV-VAAVLAVDSDQGDNGKVRYKIVNGNTDGT-----FKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSY--------QLVTIYVEDANDNRPTFD-KN-PIITWIYENVPINTNVTTIKAHDDDSGLNSRI--WYTIDSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVS---PDTGKFSLDLKTGVLKLIGSLDYED-VPQYT---LHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSIDKHSGLIV---TNSILDREKKDTYFLTVHAT-GVSYPFRVSSTSVRINVMDRNDNPPKFISP 1649          

HSP 7 Score: 92.4337 bits (228), Expect = 8.235e-19
Identity = 141/576 (24.48%), Postives = 239/576 (41.49%), Query Frame = 1
Query:  583 VKIGHTITLPVATDKDFGNNQVETYKI-SRQEPRT-FDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMP----QFSSPIYKEFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKV--------KSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIII--KDQNDNAPTLTYFG----TPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKK-ANRIFHLNTT------RSLDREKDPKFNFQVIATDSLGNPTNSVT-GTVDVEVIDQNDNFPI 2226
            + +G +I    A+DKD G N    Y I +  +P+  F  H    V+  +N+V         LD E    Y   + A D G + Q + S  + I ++D NDN P     ++     +  +      ++ R+S +D D G NG++    +     G   + +  +N++S  I + + LD E    F    + ++   P      T+  S  I+V +V D   + +      +   + E    N  VAIV    ++               E++  I+   ES            S  I T  ++DRE+IP++   +L     D   P  S    +I+   D NDN P   YF       S+ EN+  G+ V +++AQD D GEN  + +S+     P      +    G++     +D E      ++ T  V ATD G   +S +  + +++ D+NDN P F  S       EN      + +++  D+D          S   A+  F+I +  A+ +F ++ +      + LDRE    +   V A D  G   +SV    V++ V+D ND  PI
Sbjct:  185 IDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVI--VNNVR--------LDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEG--GDGYFSMKFDVLNDES-IIAVGQSLDRETHDHFFLKAVCIDKGDPPR----TTEKSFRINVGDVNDCAPKFDRHTYETR---VWENATVNTLVAIVNAVDQD----------FGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVH---DRGSPPLSDNCSVIVNLTDSNDNDP---YFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTP----FFLDPRKGLVTNSRTLDHEVQ----SSYTFQVAATDGG--GRSCNATVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRD----------SPKFAITRFIIEQGNADEVFSVDGSGLITLAKLLDRETQDNYLLTVKAVDGGGQ--DSVNKAIVNITVLDVNDEPPI 702          

HSP 8 Score: 92.0485 bits (227), Expect = 1.052e-18
Identity = 118/476 (24.79%), Postives = 196/476 (41.18%), Query Frame = 1
Query:  601 ITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGL-NSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTY-FGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTT-----LTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDIN 2007
            +T   A D D G      Y+I   +   F    +  VL          K+   LD E   +Y+  + A D G     +  +   + ++D NDN P+F+  ++   V E       +++++A D D G N ++ Y          + +D FSI++ SG I     LD EK+  +   V A   + P  +    S+ SV I+V++  D P +     +  K    V EN     +  +TV     DL      ++ +   I+S  + G  +    + E+ T  ++DRE       ++  K+    +  ++ A I I I+DQNDN P       + +I E T PGT +  + A DKD G NG + +++    +            GV  + S      S A+F T           A D G  PK   + + I I+D N++ P+FT +     I  N   ++ V  +   D D     N
Sbjct: 1456 VTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGVL----------KLIGSLDYEDVPQYTLHISATDLGSPPLTSYQL-FNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSI-----PSGVEMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRV----SSTSVRINVMDRNDNPPKFISPVVTLK----VPENSPARLIYTLTV----QDLDYGNNTKVLY--SIMSGNTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYY-TAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTY------------GVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTN 1888          

HSP 9 Score: 91.6633 bits (226), Expect = 1.619e-18
Identity = 156/675 (23.11%), Postives = 275/675 (40.74%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPD--EGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVN-PTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNN--KNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLIS--KGDESYKVKSF----EIRTNQEIDREKIPKISTNILCKE----SVDSHVPSSSAKIEIIIKDQNDNAPTLTYFGTPS-----ILENT---KPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTG------TVDVEVIDQNDNFPIIIF-----PSQNNATVHVISYLEPR----------------NYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTI 2409
            P+F +      ISE    G +I    A+DKD G+N    Y +S      +    R  ++ +       +K           +Y+F  +A D GQ D K   + + I+I D+N++ PQF+   Y+  +    + S  +  ++ATD D  +  NGK+ Y+ D    + +L    F +  ++G +          Q      +IA +  +PP+          V+I + N+ D+P      +LN      SI E +K   ++  V   +  +             Q   S+IS  KG  ++ V  F     + +   +D E       +++       S++ ++      ++I + D+NDN+P       PS     + E+T   KP  VV K+ A D D G NG+VT+S+       +   +I  T G I    ++D E++     +  +V+  TD GI PKST+ Q+ + + D+NDN P F     +  I E+    + V  +   D D    +   L+S   A  P + + + +      T +        K++F +  +D +    ++ TG      T+DV + D     P+        P +    V +I   EP+                    +TV   D         I Y++E+ S+ F I ++ G I
Sbjct: 1748 PVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVYSIDSRTGIVYSAARFETSIK----------QEYNFFCIAKDQGQ-DPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSL----FVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLR-----GYGIVQIVIGNIQDDPPR----FLNQTPARVSIPENSKVGSYITTVRARASSD------------AQVTYSIISGNKG-RAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYM-----ILDINVIDRNDNSPAFH----PSNMLAQLAEDTGAFKPRFVV-KVTATDVDSGTNGKVTYSIWTGNEAGV--FTIDSTTGEITTAKLLDRETT----ASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEV-NIREDTRTGAVVTSVVATDTDKESRLTYNLKS---ASTPGIAILRVSA-----TDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITREPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIEN-SNYFRIGQRSGVI 2359          

HSP 10 Score: 88.9669 bits (219), Expect = 9.303e-18
Identity = 111/422 (26.30%), Postives = 178/422 (42.18%), Query Frame = 1
Query:  796 LMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKE-GLNSVRILRLSATDPDEGIN-GKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVN---PTPPVTITLYTSTASVEISVLNVYDE-PLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIK--DQNDNAPTLTYFGT--PSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNP 2031
            + A+D G   Q+     + +RII   +  P+F  P Y   V E  +    +L +  TD   G+  G+I Y  +          +YF I + SG I + KPLDYE +  F   V A++   P+ PV + +Y       I+V +V DE P+     Y+   +  I         V  + V     D       R+  +  I S   KG  +   K+  IRT + +D E I    T+ +   + D   P     + + I+  D NDN P     G     +LEN    + +++I A D+D G N R++F++       L    I +  G +      D E++     +LTI   ATD G  P S+++ I + + D ++  P F      F +  N     FVG++   D+D  D   +     NP
Sbjct: 2278 VQAMDQGVPPQRA---LVYVRIIITRE--PKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENS--------NYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVY-------INVSDVNDEKPVFGQSGYMAQWSEGIP--------VGTIVVNVSAADKDSGANGRV--WFAIQSGDDKGSFAIDRKTGVIRTQRALDHETI---KTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGL--FLIDKFSGWLTTNITFDYENTAVYQYSLTI--KATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFVFYNP 2662          

HSP 11 Score: 79.337 bits (194), Expect = 9.541e-15
Identity = 142/597 (23.79%), Postives = 255/597 (42.71%), Query Frame = 1
Query:  688 DNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGG---QTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVN-PTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNY--SIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAP-------TLTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSL------DREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLE--PRNYKFMTVSANDQDQTSEFNTIEYHLESE-SDVFDIDRQEGTI 2409
            D +F +   + LN  ++ + V + LDRET + +    + ID G   +T +K+  IN+     D ND  P+F    Y+  V E    +  +  ++A D D G N +++Y      ++ +  L +F+I+  SG I     LD E+       V+  +  +PP++        SV +++ +  D     N  Y N  +Y  S+ E + S     +V + +++ D+        E+   + S+++     +      + TN      ++   S+      + D    S +A + + + D NDN P       ++ YF      ENT+ G  + ++ A D+D  +     F +E+    + E  S+ +  G+I +  ++D E+      T    V A D G +       ++IT+ DVND  P F+ +   FTI E++   S +G +    +D         +  N  ++  +     + I  +N+T +L      D EK P     V A D  G P       V + VID NDN P      Q N++  ++   E  P  + F TVS  D D +     + + L S    +F++D   G +
Sbjct:  325 DGYFSMK-FDVLNDESI-IAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVG----DVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSY-LHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLS-----DNCSVIVNLTDSND-----NDPYFNQSSYNASLFENSPSG--SPVVQLLAQDPDIG-------ENSLILYSILTPNTPFFLDPRKGLVTNSRTLDHEVQ--SSYTFQVAATDGGGRSCNATVHVSLTDLNDNQPVFDPSSYSVEYF------ENTRIGQSICQLKAIDRDSPKFAITRFIIEQGN--ADEVFSV-DGSGLITLAKLLDRETQDNYLLT----VKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRD---------KGTNAEVVYSISKGNTDNIVLINSTGTLYLQSEVDHEKIPSLYLTVQAKDK-GTPPLFGYANVTIAVIDINDNSP------QFNSSSILVRLPEDTPIGHTFYTVSVFDAD-SGVLGRVSFSLLSNPGTLFNLDSNTGAL 863          

HSP 12 Score: 67.0106 bits (162), Expect = 4.721e-11
Identity = 74/282 (26.24%), Postives = 128/282 (45.39%), Query Frame = 1
Query: 1426 IRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFGTPSILENTKPGTVVF--------KIIAQDKDEGENGRVTFSMEKSAFPSL-EYLSIGETDGVIKVKSIIDCES---SLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDV--HDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPII 2229
            I T   +DREK+   +  I     V+   P  S  + + ++D NDN+P        S +  T    VVF        K+IA D D G N   ++++      ++ + +S  +TDG +    +++  S      +  +  + ++A+D G       L++SIT++D NDN P+F++     TI EN    + + ++   DKD+  + +I   + + +     F I      I  +N  R LD E    +   V A D   +   S +  V +EV+D NDN P+I
Sbjct:   14 ITTKTVLDREKVSAYNLTI-----VEFSTPPKSYTVLVYVQDLNDNSP--------SFVRGTSAKLVVFENDKDFRQKLIAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVI--VNNVR-LDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVI 279          

HSP 13 Score: 52.7582 bits (125), Expect = 1.192e-6
Identity = 71/276 (25.72%), Postives = 113/276 (40.94%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKI-SRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEF-VKEG--LNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVI-----AVNPTPPVTITLYTSTASVEISVLNVYDE----PLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKEN 1326
            P+F +     + SE + +G  +    A DKD G N    + I S  +  +F    +  V+ T           + LD ET   +   + A D G     T  +++ IR++D NDN P F  P   +  V E   LNS R+  ++ATD D G N ++ +        G  ++D F     SG +      DYE    +++ +      A NP     IT+          ++NV DE    P    +DY     + +    K   FV  VT T +++
Sbjct: 2405 PVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQ----------RALDHETIKTHHVSVRATDEGSPPMHT-DVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNS-RLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKF-----SGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITI----------IVNVADEDEYDPSFNRMDY----KFDVPGNAKIGDFVGQVTATDRDS 2649          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 180.644 bits (457), Expect = 8.302e-46
Identity = 181/654 (27.68%), Postives = 299/654 (45.72%), Query Frame = 1
Query:  589 IGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTV-ELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLN---NKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKS-----FEIRTNQEIDREKIPKISTNILCKESVDSHVPS--SSAKIEIIIKDQNDNAPTLTYFGTP----SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLR----SKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESD--VFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGY 2484
            I     +P ATD D G N V  Y++   +     + F L+++ T       +L V + LDRE  + Y   +   DGG + QK+ +  + + + D NDN P F     +  + E       +++L ATD D G N +I Y F  +       L  F++N  SG I +++PLD E+    K  V+A + +         + A+V I+V +V D P  I++ Y+    N    + E++  N  +A++TV+ K+ D+   + C +E            D  + +K+     + + T+  +D E   + +  I+     DS  PS   +A + + ++D+NDN P    F  P    +++EN K    +  + A D+D G+N  + + +     P+  +  +    GV+    + D E            VTA D+G  P      + +T+ D NDN PKFT +H  F + EN  K S VG I V D D  ++  + L     ++N  + PF  + K+N         S DRE+   + F V A DS G P  S    V + VID NDN PI+I+P  +N +  ++            V A D D T     ++Y + S ++  +F ID   G I    + A +DIG H + + + + GY
Sbjct:  156 INSRFAIPSATDPDTGPNSVHKYELINGQ-----SAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGG-SPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRL--FALNSTSGLITVQRPLDREETAIHKLSVLASDGSS------SPARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEK-----------DVPFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVAS---DSGKPSLNQTALVRVRLEDENDNPP---IFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLG----PNASFFDLDRKTGVLTASRVFDREDQ----DRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILNDNENFILDPFSGVIKSN--------VSFDREQQSSYTFDVRAIDS-GRPPCSSAAKVTINVIDVNDNTPIVIYPP-SNTSFKLVPLSSIPGSVVAEVFAVDSD-TGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDIGLHRLVVNISDLGY 759          

HSP 2 Score: 88.1965 bits (217), Expect = 3.634e-17
Identity = 137/574 (23.87%), Postives = 243/574 (42.33%), Query Frame = 1
Query:  841 INIAIRIIDENDNMPQFSSPIYKEFVKEG-LNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSI--NEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYD-EPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPT--LTYF-----GTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNV-VID 2526
            I I I + D NDN P F SP+    + E  L + R    SATDPD G N   ++K++      A  LD       E   ++ +++ LD E++  +   +   +   P      +STA ++++V +V D +P+     +  N+    + EN S    ++V + + + D+  + +     F   +S  +K   +    S  I   + +DRE+      ++L  +   S    + A + I + D NDN P   L Y      GT  + E     T +  I   DKD   NG+V   +EK         ++ +   +++  +++D E +          + A+D G    +    + + ++D NDN P FT   +   +MENN ++ F+  +   D+D   +  +V +    A   F  L +   +  L  +R  DRE   +F F V A D+ G P       V V V+D+NDN P     + N+    V   L P+      ++  D D   E   I   + ++++ F +D   G I +     +     +   +   + G     S+ +V + VID
Sbjct:  125 IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNS--VHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQK----SSTAILQVTVTDVNDNKPV-----FRENQIEVHIPEN-SPIGTSVVQLQATDADIGPNAEIHYV-FGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSS---PARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDV--PFHLKAVYDNQYLLETSALLDYEGT----KEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNAS--FFDLDRKTGV--LTASRVFDREDQDRFLFTVTARDN-GTPPLQAQAAVIVTVLDENDNNPKF---THNHFQFFVSENL-PKYSTVGVITVTDSD-AGENAAISLSILNDNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVID 666          

HSP 3 Score: 82.4185 bits (202), Expect = 1.930e-15
Identity = 129/505 (25.54%), Postives = 211/505 (41.78%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQ-EPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFS-----SPIYKEFV---KEGLNSVRILRLSATDPDEGINGKII--YKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIK--DQNDNAPTLT-----YFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVP--KFTSSHMIFTIME-NNMKNSFVGEIEVEDKD 1989
            P+F E  IE+ I E+  IG ++    ATD D G N    Y    Q  P T         L  LNS +  + V +PLDRE T  +   ++A DG  +  +     + I + D NDN P        SPI        K+ +N+ +I  ++ +D D  INGK+I   + D  F   A+  + + +   +        LDYE    + F ++A +   P        TA V + + +  D P       +     +++E NK + F+  ++ T +++     I  +L        L          K+  +  ++  DRE   +    +  +   D+  P   A+  +I+   D+NDN P  T     +F    + EN    + V  I   D D GEN  ++ S+        E   +    GVIK     D E    Q ++ T  V A D G  P S+  +++I + DVNDN P   +  S+  F ++  +++  S V E+   D D
Sbjct:  249 PVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPAT-------KRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPARA---TVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINT-KIALITVSDKDTDINGKVICFIEKDVPFHLKAVYDNQYLLETSAL-------LDYEGTKEYNFKIVASDSGKPS----LNQTALVRVRLEDENDNPPIFTQPVI---ELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNASFFDL--------DRKTGVLTASRVFDREDQDRFLFTVTAR---DNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFF----VSENLPKYSTVGVITVTDSDAGENAAISLSILNDN----ENFILDPFSGVIKSNVSFDRE----QQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSVVAEVFAVDSD 705          

HSP 4 Score: 75.0998 bits (183), Expect = 3.753e-13
Identity = 104/350 (29.71%), Postives = 159/350 (45.43%), Query Frame = 1
Query: 1372 ILSLISKGDESYKVKSF----EI-RTNQEIDREKIPKIST--NILCKESVDSHVPSSS----AKIEIIIKDQNDNAPTLTYFGTP----SILENTKPGTVVFKIIAQDKDEGENGRVTFSM--EKSAFPSLEYLSIGET-DGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDV--HDDINLVLRSKNPAMLPFVILKKANRIFHLNTT-------RSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFP-----IIIFPSQNNATVHVISYLEPRNYKFMTVSANDQD 2325
            +  L+SK  +S  V+      EI  T+  IDREK+   S+  +  C   ++  V  +      KI+II+KD NDNAP    F +P    SI ENT   +      A D D G N    + +   +SAF     L I ET +G    + I+       Q  T  + +   D G   KS+   + +T+ DVNDN P F  + +   I EN+   + V +++  D D+  + +I+ V  ++        +     R+F LN+T       R LDRE+       V+A+D   +P  +   TV + V D NDN P      II P   N TV  +S  +P N K   ++ +D+D
Sbjct:   63 VYRLVSKAGDSPLVRVLGNTGEIFTTSNRIDREKLCPGSSFEDAECSFEIEVVVLPNDYFRLIKIKIIVKDTNDNAP---MFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAF----GLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQ--------VSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPARA---TVIINVTDVNDNPPNIDLRYIISPI--NGTV-FLSEKDPINTKIALITVSDKD 391          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 180.644 bits (457), Expect = 1.255e-45
Identity = 181/654 (27.68%), Postives = 299/654 (45.72%), Query Frame = 1
Query:  589 IGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTV-ELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLN---NKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKS-----FEIRTNQEIDREKIPKISTNILCKESVDSHVPS--SSAKIEIIIKDQNDNAPTLTYFGTP----SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLR----SKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESD--VFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGY 2484
            I     +P ATD D G N V  Y++   +     + F L+++ T       +L V + LDRE  + Y   +   DGG + QK+ +  + + + D NDN P F     +  + E       +++L ATD D G N +I Y F  +       L  F++N  SG I +++PLD E+    K  V+A + +         + A+V I+V +V D P  I++ Y+    N    + E++  N  +A++TV+ K+ D+   + C +E            D  + +K+     + + T+  +D E   + +  I+     DS  PS   +A + + ++D+NDN P  T    P    +++EN K    +  + A D+D G+N  + + +     P+  +  +    GV+    + D E            VTA D+G  P      + +T+ D NDN PKFT +H  F + EN  K S VG I V D D  ++  + L     ++N  + PF  + K+N  F        DRE+   + F V A DS G P  S    V + VID NDN PI+I+P  +N +  ++            V A D D T     ++Y + S ++  +F ID   G I    + A +DIG H + + + + GY
Sbjct:  156 INSRFAIPSATDPDTGPNSVHKYELINGQ-----SAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGG-SPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRL--FALNSTSGLITVQRPLDREETAIHKLSVLASDGSS------SPARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEK-----------DVPFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVAS---DSGKPSLNQTALVRVRLEDENDNPPIFTQ---PVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLG----PNASFFDLDRKTGVLTASRVFDREDQ----DRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILNDNENFILDPFSGVIKSNVSF--------DREQQSSYTFDVRAIDS-GRPPCSSAAKVTINVIDVNDNTPIVIYPP-SNTSFKLVPLSSIPGSVVAEVFAVDSD-TGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDIGLHRLVVNISDLGY 759          

HSP 2 Score: 88.5817 bits (218), Expect = 3.168e-17
Identity = 136/574 (23.69%), Postives = 242/574 (42.16%), Query Frame = 1
Query:  841 INIAIRIIDENDNMPQFSSPIYKEFVKEG-LNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSI--NEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYD-EPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPT--LTYF-----GTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNV-VID 2526
            I I I + D NDN P F SP+    + E  L + R    SATDPD G N   ++K++      A  LD       E   ++ +++ LD E++  +   +   +   P      +STA ++++V +V D +P+     +  N+    + EN S    ++V + + + D+  + +     F   +S  +K   +    S  I   + +DRE+      ++L  +   S    + A + I + D NDN P   L Y      GT  + E     T +  I   DKD   NG+V   +EK         ++ +   +++  +++D E +          + A+D G    +    + + ++D NDN P FT   +   +MENN ++ F+  +   D+D   +  +V +    A   F  L +   +  L  +R  DRE   +F F V A D+ G P       V V V+D+NDN P       +N     +S   P+      ++  D D   E   I   + ++++ F +D   G I +     +     +   +   + G     S+ +V + VID
Sbjct:  125 IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNS--VHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQK----SSTAILQVTVTDVNDNKPV-----FRENQIEVHIPEN-SPIGTSVVQLQATDADIGPNAEIHYV-FGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSS---PARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDV--PFHLKAVYDNQYLLETSALLDYEGT----KEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNAS--FFDLDRKTGV--LTASRVFDREDQDRFLFTVTARDN-GTPPLQAQAAVIVTVLDENDNNPKFT----HNHFQFFVSENLPKYSTVGVITVTDSD-AGENAAISLSILNDNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVID 666          

HSP 3 Score: 82.8037 bits (203), Expect = 1.817e-15
Identity = 129/505 (25.54%), Postives = 211/505 (41.78%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQ-EPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFS-----SPIYKEFV---KEGLNSVRILRLSATDPDEGINGKII--YKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIK--DQNDNAPTLT-----YFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVP--KFTSSHMIFTIME-NNMKNSFVGEIEVEDKD 1989
            P+F E  IE+ I E+  IG ++    ATD D G N    Y    Q  P T         L  LNS +  + V +PLDRE T  +   ++A DG  +  +     + I + D NDN P        SPI        K+ +N+ +I  ++ +D D  INGK+I   + D  F   A+  + + +   +        LDYE    + F ++A +   P        TA V + + +  D P       +     +++E NK + F+  ++ T +++     I  +L        L          K+  +  ++  DRE   +    +  +   D+  P   A+  +I+   D+NDN P  T     +F    + EN    + V  I   D D GEN  ++ S+        E   +    GVIK     D E    Q ++ T  V A D G  P S+  +++I + DVNDN P   +  S+  F ++  +++  S V E+   D D
Sbjct:  249 PVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPAT-------KRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPARA---TVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINT-KIALITVSDKDTDINGKVICFIEKDVPFHLKAVYDNQYLLETSAL-------LDYEGTKEYNFKIVASDSGKPS----LNQTALVRVRLEDENDNPPIFTQPVI---ELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNASFFDL--------DRKTGVLTASRVFDREDQDRFLFTVTAR---DNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFF----VSENLPKYSTVGVITVTDSDAGENAAISLSILNDN----ENFILDPFSGVIKSNVSFDRE----QQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSVVAEVFAVDSD 705          

HSP 4 Score: 75.0998 bits (183), Expect = 3.465e-13
Identity = 104/350 (29.71%), Postives = 160/350 (45.71%), Query Frame = 1
Query: 1372 ILSLISKGDESYKVK----SFEI-RTNQEIDREKIPKIST--NILCKESVDSHVPSSS----AKIEIIIKDQNDNAPTLTYFGTP----SILENTKPGTVVFKIIAQDKDEGENGRVTFSM--EKSAFPSLEYLSIGET-DGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDV--HDDINLVLRSKNPAMLPFVILKKANRIFHLNTT-------RSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFP-----IIIFPSQNNATVHVISYLEPRNYKFMTVSANDQD 2325
            +  L+SK  +S  V+    + EI  T+  IDREK+   S+  +  C   ++  V  +      KI+II+KD NDNAP    F +P    SI ENT   +      A D D G N    + +   +SAF     L I ET +G    + I+       Q  T  + +   D G   KS+   + +T+ DVNDN P F  + +   I EN+   + V +++  D D+  + +I+ V  ++        +     R+F LN+T       R LDRE+       V+A+D   +P  +   TV + V D NDN P      II P   N TV  +S  +P N K   ++ +D+D
Sbjct:   63 VYRLVSKAGDSPLVRVLGNTGEIFTTSNRIDREKLCPGSSFEDAECSFEIEVVVLPNDYFRLIKIKIIVKDTNDNAP---MFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAF----GLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQ--------VSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPARA---TVIINVTDVNDNPPNIDLRYIISPI--NGTV-FLSEKDPINTKIALITVSDKD 391          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 180.644 bits (457), Expect = 1.275e-45
Identity = 181/654 (27.68%), Postives = 299/654 (45.72%), Query Frame = 1
Query:  589 IGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTV-ELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLN---NKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKS-----FEIRTNQEIDREKIPKISTNILCKESVDSHVPS--SSAKIEIIIKDQNDNAPTLTYFGTP----SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLR----SKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESD--VFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGY 2484
            I     +P ATD D G N V  Y++   +     + F L+++ T       +L V + LDRE  + Y   +   DGG + QK+ +  + + + D NDN P F     +  + E       +++L ATD D G N +I Y F  +       L  F++N  SG I +++PLD E+    K  V+A + +         + A+V I+V +V D P  I++ Y+    N    + E++  N  +A++TV+ K+ D+   + C +E            D  + +K+     + + T+  +D E   + +  I+     DS  PS   +A + + ++D+NDN P  T    P    +++EN K    +  + A D+D G+N  + + +     P+  +  +    GV+    + D E            VTA D+G  P      + +T+ D NDN PKFT +H  F + EN  K S VG I V D D  ++  + L     ++N  + PF  + K+N  F        DRE+   + F V A DS G P  S    V + VID NDN PI+I+P  +N +  ++            V A D D T     ++Y + S ++  +F ID   G I    + A +DIG H + + + + GY
Sbjct:  156 INSRFAIPSATDPDTGPNSVHKYELINGQ-----SAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGG-SPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRL--FALNSTSGLITVQRPLDREETAIHKLSVLASDGSS------SPARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEK-----------DVPFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVAS---DSGKPSLNQTALVRVRLEDENDNPPIFTQ---PVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLG----PNASFFDLDRKTGVLTASRVFDREDQ----DRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILNDNENFILDPFSGVIKSNVSF--------DREQQSSYTFDVRAIDS-GRPPCSSAAKVTINVIDVNDNTPIVIYPP-SNTSFKLVPLSSIPGSVVAEVFAVDSD-TGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDIGLHRLVVNISDLGY 759          

HSP 2 Score: 88.5817 bits (218), Expect = 2.972e-17
Identity = 136/574 (23.69%), Postives = 242/574 (42.16%), Query Frame = 1
Query:  841 INIAIRIIDENDNMPQFSSPIYKEFVKEG-LNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSI--NEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYD-EPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPT--LTYF-----GTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNV-VID 2526
            I I I + D NDN P F SP+    + E  L + R    SATDPD G N   ++K++      A  LD       E   ++ +++ LD E++  +   +   +   P      +STA ++++V +V D +P+     +  N+    + EN S    ++V + + + D+  + +     F   +S  +K   +    S  I   + +DRE+      ++L  +   S    + A + I + D NDN P   L Y      GT  + E     T +  I   DKD   NG+V   +EK         ++ +   +++  +++D E +          + A+D G    +    + + ++D NDN P FT   +   +MENN ++ F+  +   D+D   +  +V +    A   F  L +   +  L  +R  DRE   +F F V A D+ G P       V V V+D+NDN P       +N     +S   P+      ++  D D   E   I   + ++++ F +D   G I +     +     +   +   + G     S+ +V + VID
Sbjct:  125 IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNS--VHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQK----SSTAILQVTVTDVNDNKPV-----FRENQIEVHIPEN-SPIGTSVVQLQATDADIGPNAEIHYV-FGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSS---PARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDV--PFHLKAVYDNQYLLETSALLDYEGT----KEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNAS--FFDLDRKTGV--LTASRVFDREDQDRFLFTVTARDN-GTPPLQAQAAVIVTVLDENDNNPKFT----HNHFQFFVSENLPKYSTVGVITVTDSD-AGENAAISLSILNDNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVID 666          

HSP 3 Score: 82.8037 bits (203), Expect = 1.791e-15
Identity = 129/505 (25.54%), Postives = 211/505 (41.78%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQ-EPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFS-----SPIYKEFV---KEGLNSVRILRLSATDPDEGINGKII--YKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIK--DQNDNAPTLT-----YFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVP--KFTSSHMIFTIME-NNMKNSFVGEIEVEDKD 1989
            P+F E  IE+ I E+  IG ++    ATD D G N    Y    Q  P T         L  LNS +  + V +PLDRE T  +   ++A DG  +  +     + I + D NDN P        SPI        K+ +N+ +I  ++ +D D  INGK+I   + D  F   A+  + + +   +        LDYE    + F ++A +   P        TA V + + +  D P       +     +++E NK + F+  ++ T +++     I  +L        L          K+  +  ++  DRE   +    +  +   D+  P   A+  +I+   D+NDN P  T     +F    + EN    + V  I   D D GEN  ++ S+        E   +    GVIK     D E    Q ++ T  V A D G  P S+  +++I + DVNDN P   +  S+  F ++  +++  S V E+   D D
Sbjct:  249 PVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPAT-------KRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPARA---TVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINT-KIALITVSDKDTDINGKVICFIEKDVPFHLKAVYDNQYLLETSAL-------LDYEGTKEYNFKIVASDSGKPS----LNQTALVRVRLEDENDNPPIFTQPVI---ELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNASFFDL--------DRKTGVLTASRVFDREDQDRFLFTVTAR---DNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFF----VSENLPKYSTVGVITVTDSDAGENAAISLSILNDN----ENFILDPFSGVIKSNVSFDRE----QQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSVVAEVFAVDSD 705          

HSP 4 Score: 75.485 bits (184), Expect = 2.760e-13
Identity = 104/350 (29.71%), Postives = 160/350 (45.71%), Query Frame = 1
Query: 1372 ILSLISKGDESYKVK----SFEI-RTNQEIDREKIPKIST--NILCKESVDSHVPSSS----AKIEIIIKDQNDNAPTLTYFGTP----SILENTKPGTVVFKIIAQDKDEGENGRVTFSM--EKSAFPSLEYLSIGET-DGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDV--HDDINLVLRSKNPAMLPFVILKKANRIFHLNTT-------RSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFP-----IIIFPSQNNATVHVISYLEPRNYKFMTVSANDQD 2325
            +  L+SK  +S  V+    + EI  T+  IDREK+   S+  +  C   ++  V  +      KI+II+KD NDNAP    F +P    SI ENT   +      A D D G N    + +   +SAF     L I ET +G    + I+       Q  T  + +   D G   KS+   + +T+ DVNDN P F  + +   I EN+   + V +++  D D+  + +I+ V  ++        +     R+F LN+T       R LDRE+       V+A+D   +P  +   TV + V D NDN P      II P   N TV  +S  +P N K   ++ +D+D
Sbjct:   63 VYRLVSKAGDSPLVRVLGNTGEIFTTSNRIDREKLCPGSSFEDAECSFEIEVVVLPNDYFRLIKIKIIVKDTNDNAP---MFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAF----GLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQ--------VSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPARA---TVIINVTDVNDNPPNIDLRYIISPI--NGTV-FLSEKDPINTKIALITVSDKD 391          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: PCDH8 (protocadherin 8 [Source:NCBI gene;Acc:101158635])

HSP 1 Score: 177.178 bits (448), Expect = 9.370e-45
Identity = 160/582 (27.49%), Postives = 281/582 (48.28%), Query Frame = 1
Query:  538 PIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVT-VELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLN-SVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAV----NPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIV---EENKSNFFVAIVTVTSKENDLFRSIQCRL---EHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFGTP----SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKS---AFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHM----IFTIMENNMKNSFV-GEIEVEDKD--VHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVID 2205
            P F  +   +EISE+  +G  I L  A D+D G N +++Y+IS       ++HF ++VL+  + V   EL + K LDRET   Y+ +L+A+DGG    ++G+  I I++ D NDN P F    +   ++E       +L L+A DPDEG+NG+++Y F    +    I   F ++  +G + L+ P+D+E +T ++F V A     NP+P +          + + V +V D   EI++  + +    I    E      FVA+V+ + +++     + C L   +HF        +  ++Y+  SF I +   +DREKIP+ +  ++  E + S    +  +  I + D+NDNAP    F  P    +++EN  PG  +  ++A+D D G NG+VT+ +  +     P   ++S+    G +      + E        L + VTA+D G  P S    + + I D NDN P  T   +       ++  +    +V   +E  D D  V+ +++  L +  P++  F + K    I+ LN  + L  + D   +  V  +D+ G P  + T T+   +I+
Sbjct:  128 PEFPRKESSLEISENTAVGTRIPLDFAVDEDVGVNYIQSYQIS------VNSHFSIDVLSRADGVKYAELVLMKELDRETQASYALELVAMDGGNP-SRSGTTRINIKVKDYNDNSPVFDRKSFSVDLREDAPVGSLLLDLNAEDPDEGLNGEVVYGFG--HQVPPEIRQLFRVDRKTGRLTLESPVDFESKTTYEFDVQATDLGPNPSPAI--------CKIVVQVQDVNDNAPEISITPMTSITAGIAYITEAAARESFVALVSTSDRDSGANGQVHCTLYGHDHF--------RLQQAYE-DSFMIVSTSPLDREKIPEYNLTVVA-EDLGSPPFRTITQYTIRLTDENDNAPV---FSKPVYEVAVVENNPPGAYITTVVARDMDMGSNGKVTYKLADTYVMGSPISAFVSLDPASGSLYALRSFNYE----LMKHLELRVTASDGGSPPLSGSASVHVRIVDQNDNSPVITQPPLNNGSAEVLLPRDSPTGYVITRVEARDADEGVNSELSYGLATGEPSV--FSVNKVTGEIY-LN--QVLSHDVDETLSVTVTVSDN-GRPALTSTATLHFLIIE 669          

HSP 2 Score: 115.931 bits (289), Expect = 9.914e-26
Identity = 117/430 (27.21%), Postives = 189/430 (43.95%), Query Frame = 1
Query: 1360 HFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSA--KIEIIIKDQNDNAPTLTYFGTPSILENTKP-GTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYL-SIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHM------IFTIMENNMKNSFVGEIEVEDKD--VHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLE--PRNYKFMTVSANDQDQTSEFNTIEYHLESE-------SDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNV-VIDASTAKSNSPRIENFNINNG 2583
            HF   + ++S+ D    VK  E+   +E+DRE     +  ++   ++D   PS S   +I I +KD NDN+P          L    P G+++  + A+D DEG NG V +       P +  L  +    G + ++S +D ES     TT    V ATD G  P     +I + +QDVNDN P+ + + M      I  I E   + SFV  +   D+D   +  ++  L   +     F + +     F + +T  LDREK P++N  V+A D LG+P         + + D+NDN P+   P      V+ ++ +E  P      TV A D D  S    + Y L          S    +D   G+++  R      +    +++T  + G   +  S  V+V ++D +    NSP I    +NNG
Sbjct:  174 HFS--IDVLSRAD---GVKYAELVLMKELDRETQASYALELV---AMDGGNPSRSGTTRINIKVKDYNDNSPVFDRKSFSVDLREDAPVGSLLLDLNAEDPDEGLNGEVVYGFGHQVPPEIRQLFRVDRKTGRLTLESPVDFESK----TTYEFDVQATDLGPNPSPAICKIVVQVQDVNDNAPEISITPMTSITAGIAYITEAAARESFVALVSTSDRDSGANGQVHCTLYGHD----HFRLQQAYEDSFMIVSTSPLDREKIPEYNLTVVAED-LGSPPFRTITQYTIRLTDENDNAPVFSKP------VYEVAVVENNPPGAYITTVVARDMDMGSN-GKVTYKLADTYVMGSPISAFVSLDPASGSLYALRSFNYELMKHLELRVTASDGGSPPLSGSASVHVRIVDQN---DNSPVITQPPLNNG 576          

HSP 3 Score: 92.8189 bits (229), Expect = 1.206e-18
Identity = 155/660 (23.48%), Postives = 280/660 (42.42%), Query Frame = 1
Query:  676 PRTFDNHFRLNVLNTLNSVTVELK-------VFKPLDRETTNKYSFD-LMAIDGGQ-TDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVRILRLS---ATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDS-------GEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKEND--LFRSIQCRLEHF--QEILSLISKGDESYKVK-----SFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSS-AKIEIIIKDQNDNAPTLTY-------FGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAML-----PFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLE-PRNYKFMTVSANDQDQTSEFNTIEYHLES-ESDVFDIDRQEGTIFTRREMAKSDIGEHV-IKITVFNPGYTSMKSSVQVNVVI 2523
            P +  N+FR  ++   NS  + L+       + + +DRE   K++   L+A D    + ++   I+I + + D NDN P+F  P  +  ++   N+    R+    A D D G+N    Y+          +  +FSI+  S        E+ L K LD E Q  +   ++A++   P      + T  + I V +  D     N    + K++S+     +     ++ + +++ D  L   +     H    EI  L     ++ ++       FE +T  E D +    +  N           PS +  KI + ++D NDNAP ++         G   I E     + V  +   D+D G NG+V  ++       L+     E   +I   S +D E    +     + V A D G  P  T  Q +I + D NDN P F+       ++ENN   +++  +   D D+  +  +  +  +  ++      FV L  A+    L   RS + E       +V A+D  G+P  S + +V V ++DQNDN P+I  P  NN +  V+   + P  Y    V A D D+    + + Y L + E  VF +++  G I+  + ++  D+ E + + +TV + G  ++ S+  ++ +I
Sbjct:   52 PSSSRNNFR--IMKQFNSSFIRLRESDGQLSIGERIDRERICKHTLQCLIAFDVVSFSKEQFKLIHIEVEVKDINDNSPEF--PRKESSLEISENTAVGTRIPLDFAVDEDVGVNYIQSYQIS--------VNSHFSIDVLSRADGVKYAELVLMKELDRETQASYALELVAMDGGNPSR----SGTTRINIKVKDYND-----NSPVFDRKSFSVDLREDAPVGSLLLDLNAEDPDEGLNGEVVYGFGHQVPPEIRQLFRVDRKTGRLTLESPVDFESKTTYEFDVQAT-DLGPN-----------PSPAICKIVVQVQDVNDNAPEISITPMTSITAGIAYITEAAARESFVALVSTSDRDSGANGQVHCTLYGHDHFRLQQAY--EDSFMIVSTSPLDRE----KIPEYNLTVVAEDLGSPPFRTITQYTIRLTDENDNAPVFSKPVYEVAVVENNPPGAYITTVVARDMDMGSNGKVTYKLADTYVMGSPISAFVSLDPASG--SLYALRSFNYELMKHLELRVTASDG-GSPPLSGSASVHVRIVDQNDNSPVITQPPLNNGSAEVLLPRDSPTGYVITRVEARDADEGVN-SELSYGLATGEPSVFSVNKVTGEIYLNQVLSH-DVDETLSVTVTVSDNGRPALTSTATLHFLI 667          

HSP 4 Score: 52.7582 bits (125), Expect = 2.705e-6
Identity = 53/227 (23.35%), Postives = 94/227 (41.41%), Query Frame = 1
Query: 1600 LENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIID----CESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDV--------------HDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPI 2226
             E   PGTV+  +         + R  F + K    S  ++ + E+DG + +   ID    C+ +L       +V  +     K +   + I + ++D+NDN P+F        I EN    + +      D+DV              H  I+++ R+        V++K+            LDRE    +  +++A D  GNP+ S T  ++++V D NDN P+
Sbjct:   32 FEEDAPGTVIGNLAKDISLSPSSSRNNFRIMKQFNSS--FIRLRESDGQLSIGERIDRERICKHTLQCLIAFDVVSFS-----KEQFKLIHIEVEVKDINDNSPEFPRKESSLEISENTAVGTRIPLDFAVDEDVGVNYIQSYQISVNSHFSIDVLSRADGVKYAELVLMKE------------LDRETQASYALELVAMDG-GNPSRSGTTRINIKVKDYNDNSPV 238          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: pcdh2ab9 (protocadherin alpha-C2 [Source:NCBI gene;Acc:101161365])

HSP 1 Score: 176.022 bits (445), Expect = 2.058e-44
Identity = 183/669 (27.35%), Postives = 311/669 (46.49%), Query Frame = 1
Query:  268 DLKKLIPQTKMTYHLLKSSKAHSYFTIKNDN--LFTNTLVDMDSMCQNVGECCNKAKEICDFSIAIACRENQESEVXXXXXXXXXXXXXXXYPIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTL-NSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYK-EFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTP-PVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFE----IRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKI--EIIIKDQNDNAPTLTYFG-TPSILENTKPGTVVFKIIAQDKDEGENGRVTFSM---EKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFT-----SSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINL--VLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQ 2208
            DL+K  P  ++T   L+S     YFTI ++   L  +  +D +++C+  G C    + + +    +    N   E++  +            P F     ++E+ ES   G    +  A D D  +N ++ Y++S       ++HF L+ +  L N+  +E  + +P DRE T  Y   L A+DGG T Q+TG+  I +RI+D NDN+P F S +YK +  +       +++L+A+DPDEG NG++ Y F     T   +   FS++ ++GEI +K  +DYE+   ++  + A++  P PV      +   V + VL+V D   EI +  L++    + E+ +++  VA+++V  +  D  ++ Q  L+    +          +++KSF     I T   +DRE I   +  ++   +VD+  P+ S+++  ++ + D NDN P       T  I EN  PG  +  + A D D GEN R+T+++        P   Y+SI    G        D E  L +F      + A D+G+ P S  L + + I D ND+VP+        S    TIM+N    + V ++   D D   +  L   L   N  +  F + +    I    TTR +  +    F   V   D  G P  S T T+ V V++Q
Sbjct:   58 DLRKP-PNRRIT---LRSDSGSKYFTINHETGKLVVSDRIDRETLCEFSGTCSRNLEVVLENPHEV---HNVVVEILDVNDNA---------PQFPRDEYQLEVLESALTGSRFQIEKAQDTDDDSNSIKQYRLSP------NDHFTLDSIKPLSNNNHLEFILKRPFDREQTPSYQLILTAVDGG-TPQRTGTARINVRILDANDNVPAFDSSVYKVKLYENSPKGALVIKLNASDPDEGSNGEVFYSFSS--YTPERVRQVFSMDTNTGEIRVKNNIDYEETNSYEMYIQAMDKGPAPV-----AAHCKVVVEVLDVNDNIPEIVLTSLSSP---VREDARADTVVALISVNDR--DSGQNKQVTLDIMPHL---------PFRIKSFRNHYTIVTAAFLDRETISSYNVTVI---AVDAGTPALSSQMTFKVEVADVNDNPPRFEQTSYTVYITENNAPGASLCIVKATDADAGENARITYTVLNDNNHGIPVASYVSIKPNTGEAYALRSFDFE-KLQEF---HFQIKAQDNGVPPLSRVLTVYVYIMDHNDHVPRIVYPPANGSRTTETIMKNAEAGALVSKVMAWDGDAGQNAWLFFALEQTNTDLDLFKVHEYTGEI---RTTRRVKEDNATTFALTVKVHDH-GLPRLSSTATIHVNVMEQ 671          

HSP 2 Score: 116.701 bits (291), Expect = 6.289e-26
Identity = 153/628 (24.36%), Postives = 260/628 (41.40%), Query Frame = 1
Query:  718 TLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYK-EFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSI-------NEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKEND------LFRSIQCRL-EHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAP--TLTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEY-LSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINL---VLRSKN---PAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNA-TVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLE---SESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNV 2517
            T+N  T +L V   +DRET  ++S           +      N+ + I+D NDN PQF    Y+ E ++  L   R     A D D+  N    Y+  P         D+F++       N +  E  LK+P D E+   ++  + AV+   P      T TA + + +L+  D     NV   ++  Y +     S     ++ + + + D      +F S      E  +++ S+           + EIR    ID E+       I   +   + V ++  K+ + + D NDN P   LT   +P + E+ +  TVV  I   D+D G+N +VT  +     P L + +        I   + +D E+     ++  + V A D G    S+ +   + + DVNDN P+F  +     I ENN   + +  ++  D D  ++  +   VL   N   P      I       + L   RS D EK  +F+FQ+ A D+ G P  S   TV V ++D ND+ P I++P  N + T   I            V A D D   +   + + LE   ++ D+F +    G I T R + + +     + + V + G   + S+  ++V
Sbjct:   79 TINHETGKLVVSDRIDRETLCEFSGTCSRNLEVVLENPHEVHNVVVEILDVNDNAPQFPRDEYQLEVLESALTGSRFQIEKAQDTDDDSNSIKQYRLSPN--------DHFTLDSIKPLSNNNHLEFILKRPFDREQTPSYQLILTAVDGGTP----QRTGTARINVRILDAND-----NVPAFDSSVYKVKLYENSPKGALVIKLNASDPDEGSNGEVFYSFSSYTPERVRQVFSM--------DTNTGEIRVKNNIDYEETNSYEMYIQAMDKGPAPV-AAHCKVVVEVLDVNDNIPEIVLTSLSSP-VREDARADTVVALISVNDRDSGQNKQVTLDI----MPHLPFRIKSFRNHYTIVTAAFLDRET----ISSYNVTVIAVDAGTPALSSQMTFKVEVADVNDNPPRFEQTSYTVYITENNAPGASLCIVKATDADAGENARITYTVLNDNNHGIPVASYVSIKPNTGEAYAL---RSFDFEKLQEFHFQIKAQDN-GVPPLSRVLTVYVYIMDHNDHVPRIVYPPANGSRTTETIMKNAEAGALVSKVMAWDGD-AGQNAWLFFALEQTNTDLDLFKVHEYTGEIRTTRRVKEDNATTFALTVKVHDHGLPRLSSTATIHV 666          

HSP 3 Score: 57.3806 bits (137), Expect = 1.050e-7
Identity = 91/397 (22.92%), Postives = 154/397 (38.79%), Query Frame = 1
Query: 1441 EIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFGTP------SILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKD--VHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRS-------LDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIF-----PSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNT---IEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRIE 2562
             IDRE + + S        V    P     + + I D NDNAP       P       +LE+   G+      AQD D+  N    + +  +   +L+  SI        ++ I+       Q  +  +++TA D G   ++   +I++ I D NDNVP F SS     + EN+ K + V ++   D D   + ++     S  P        ++  ++F ++T          +D E+   +   + A D    P  +    V VEV+D NDN P I+      P + +A    +  L         +S ND+D          I  HL      F   R   TI T   + +  I  + + +   + G  ++ S  Q+   ++ +    N PR E
Sbjct:   92 RIDRETLCEFSGTCSRNLEVVLENPHEVHNVVVEILDVNDNAPQF-----PRDEYQLEVLESALTGSRFQIEKAQDTDDDSNSIKQYRLSPNDHFTLD--SIKPLSNNNHLEFILKRPFDREQTPSYQLILTAVDGGTPQRTGTARINVRILDANDNVPAFDSSVYKVKLYENSPKGALVIKLNASDPDEGSNGEVFYSFSSYTP--------ERVRQVFSMDTNTGEIRVKNNIDYEETNSYEMYIQAMDKGPAPVAAHCKVV-VEVLDVNDNIPEIVLTSLSSPVREDARADTVVAL---------ISVNDRDSGQNKQVTLDIMPHLPFRIKSF---RNHYTIVTAAFLDRETISSYNVTVIAVDAGTPALSS--QMTFKVEVADVNDNPPRFE 458          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000041975.1 (SMESG000041975.1)

HSP 1 Score: 2030.37 bits (5259), Expect = 0.000e+0
Identity = 1044/1048 (99.62%), Postives = 1046/1048 (99.81%), Query Frame = 1
Query:  157 MHVSYVWYLWLILFIKKNTCMEVINISDDTALNIKLYDLKKLIPQTKMTYHLLKSSKAHSYFTIKNDNLFTNTLVDMDSMCQNVGECCNKAKEICDFSIAIACRENQESEVXXXXXXXXXXXXXXXYPIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRIENFNINNGGLMAHNSFSTSEXXXXXXXXXXXXXXXXXXXXXXXXLRHCHREPVCLRGLIDKCSHNNLSQNENQVYSPTIKLNAKTDGDYYKDPMQNPSIAREQSNNWNVVNQSGIYNVTVSPNQYFKGGQYMKLVNPSHYYAQPMAYQTIDDNLLNKFPDNNFSKSVFNINNRLNCKSEMNLNTENLFNDPNQESIQINGPSKSQWITSLTPMQTRSKSVVNRIISIEQPIENNFAVVYPPEQSTFV 3300
            MHVSYVWYLWLILFIKKNTCME+INISDDTALNIKLYDLKKLIPQTKMTYHLLKSSKAHSYFTIKNDNLFTNTLVDMDSMCQNVGECCNKAKEICDFSIAIACRENQESEVIRKDIKISIRDKNDNYPIFNERNIEIEISESVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDID+QEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRIENFN NN GLMAHNSFSTSEIIIAILIVIVFFVVFVIIIIVCVVLRHCHREPVCLRGLIDKCSHNNLSQNENQVYSPTIKLNAKTDGDYYKDPMQNPSIAREQSNNWNVVNQSGIYNVTVSPNQYFKGGQYMKLVNPSHYYAQPMAYQTIDDNLLNKFPDNNFSKSVFNINNRLNCKSEMNLNTENLFNDPNQESIQINGPSKSQWITSLTPMQTRSKSVVNRIISIEQPIENNFAVVYPPEQSTFV
Sbjct:    1 MHVSYVWYLWLILFIKKNTCMEIINISDDTALNIKLYDLKKLIPQTKMTYHLLKSSKAHSYFTIKNDNLFTNTLVDMDSMCQNVGECCNKAKEICDFSIAIACRENQESEVIRKDIKISIRDKNDNYPIFNERNIEIEISESVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDQQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRIENFNTNNSGLMAHNSFSTSEIIIAILIVIVFFVVFVIIIIVCVVLRHCHREPVCLRGLIDKCSHNNLSQNENQVYSPTIKLNAKTDGDYYKDPMQNPSIAREQSNNWNVVNQSGIYNVTVSPNQYFKGGQYMKLVNPSHYYAQPMAYQTIDDNLLNKFPDNNFSKSVFNINNRLNCKSEMNLNTENLFNDPNQESIQINGPSKSQWITSLTPMQTRSKSVVNRIISIEQPIENNFAVVYPPEQSTFV 1048          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000041975.1 (SMESG000041975.1)

HSP 1 Score: 1981.84 bits (5133), Expect = 0.000e+0
Identity = 1024/1028 (99.61%), Postives = 1026/1028 (99.81%), Query Frame = 1
Query:  217 MEVINISDDTALNIKLYDLKKLIPQTKMTYHLLKSSKAHSYFTIKNDNLFTNTLVDMDSMCQNVGECCNKAKEICDFSIAIACRENQESEVXXXXXXXXXXXXXXXYPIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRIENFNINNGGLMAHNSFSTSEXXXXXXXXXXXXXXXXXXXXXXXXLRHCHREPVCLRGLIDKCSHNNLSQNENQVYSPTIKLNAKTDGDYYKDPMQNPSIAREQSNNWNVVNQSGIYNVTVSPNQYFKGGQYMKLVNPSHYYAQPMAYQTIDDNLLNKFPDNNFSKSVFNINNRLNCKSEMNLNTENLFNDPNQESIQINGPSKSQWITSLTPMQTRSKSVVNRIISIEQPIENNFAVVYPPEQSTFV 3300
            ME+INISDDTALNIKLYDLKKLIPQTKMTYHLLKSSKAHSYFTIKNDNLFTNTLVDMDSMCQNVGECCNKAKEICDFSIAIACRENQESEVIRKDIKISIRDKNDNYPIFNERNIEIEISESVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDID+QEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRIENFN NN GLMAHNSFSTSEIIIAILIVIVFFVVFVIIIIVCVVLRHCHREPVCLRGLIDKCSHNNLSQNENQVYSPTIKLNAKTDGDYYKDPMQNPSIAREQSNNWNVVNQSGIYNVTVSPNQYFKGGQYMKLVNPSHYYAQPMAYQTIDDNLLNKFPDNNFSKSVFNINNRLNCKSEMNLNTENLFNDPNQESIQINGPSKSQWITSLTPMQTRSKSVVNRIISIEQPIENNFAVVYPPEQSTFV
Sbjct:    1 MEIINISDDTALNIKLYDLKKLIPQTKMTYHLLKSSKAHSYFTIKNDNLFTNTLVDMDSMCQNVGECCNKAKEICDFSIAIACRENQESEVIRKDIKISIRDKNDNYPIFNERNIEIEISESVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDQQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPRIENFNTNNSGLMAHNSFSTSEIIIAILIVIVFFVVFVIIIIVCVVLRHCHREPVCLRGLIDKCSHNNLSQNENQVYSPTIKLNAKTDGDYYKDPMQNPSIAREQSNNWNVVNQSGIYNVTVSPNQYFKGGQYMKLVNPSHYYAQPMAYQTIDDNLLNKFPDNNFSKSVFNINNRLNCKSEMNLNTENLFNDPNQESIQINGPSKSQWITSLTPMQTRSKSVVNRIISIEQPIENNFAVVYPPEQSTFV 1028          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000051236.1 (SMESG000051236.1)

HSP 1 Score: 358.607 bits (919), Expect = 8.900e-106
Identity = 261/751 (34.75%), Postives = 406/751 (54.06%), Query Frame = 1
Query:  304 YHLLKSSKAHSYFTI-KNDNLFTNTLVDMDSMCQNVGECCNKAKEICDFSIAIACRENQESEVXXXXXXXXXXXXXXXYPIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVR-ILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLN--NKNYSIVE-ENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVL-RSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFN-TIEYHL-ESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDAS 2532
            ++LL ++KA+  F +  N  L++   +D + +C NV  CC+K K+ CD S++IA + +   E    + +I I D NDN P F      I I ES  +G   +LP+ATD D     +  YK+  +E   F   F L       S+ ++L   + LDRE   KY F L+AID G    KTG + I I ++D NDN P  S   Y    +E   S++ +L++ A D DE  N K+++K             YF I E+SG IYLK+ LDYE+    +F V   N    V     T+TA+V I V+N+ DE  EI +DY+N  NKN  I E E++   FVA+ TVT K+  L   + CRL + + +  + ++ D S     + IRT   +DRE        + C++  D  +  + A I++++KD+NDNAP +      S+ EN   GT+V  I A+D DEG+NG +T+S+ +S+  + +YL I    G +K +  ID E       +  +++T +D G  P+ +     ++++D NDN P+F +  + F + EN      +GEI V DKD +  + + L    N    PFV+ ++ N+ ++LNTTRSLD EK+  ++F+++A+D  G  +++ T TV V + D+ND+ P  IFP+ +N T + ISY E      +TVS  D D     N    +HL      +F ID+ +G I T R M++SD+G+HVI +   + G    +SS+ + +VID S
Sbjct:   50 FNLLSNTKANRLFHLHSNGKLYSAQTIDREELCINVESCCHK-KDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKL--EENSIFPPIFSLEQNRPTGSLNLQL--IQKLDREKRAKYEFVLLAIDRGNP-PKTGRLVININVLDVNDNPPHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVD----TATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNR-DSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPL-RAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNK-YYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKY-ISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNS 786          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000051236.1 (SMESG000051236.1)

HSP 1 Score: 358.221 bits (918), Expect = 1.384e-105
Identity = 261/751 (34.75%), Postives = 406/751 (54.06%), Query Frame = 1
Query:  304 YHLLKSSKAHSYFTI-KNDNLFTNTLVDMDSMCQNVGECCNKAKEICDFSIAIACRENQESEVXXXXXXXXXXXXXXXYPIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEGLNSVR-ILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLN--NKNYSIVE-ENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAKIEIIIKDQNDNAPTLTYFGTPSILENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVL-RSKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFN-TIEYHL-ESESDVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDAS 2532
            ++LL ++KA+  F +  N  L++   +D + +C NV  CC+K K+ CD S++IA + +   E    + +I I D NDN P F      I I ES  +G   +LP+ATD D     +  YK+  +E   F   F L       S+ ++L   + LDRE   KY F L+AID G    KTG + I I ++D NDN P  S   Y    +E   S++ +L++ A D DE  N K+++K             YF I E+SG IYLK+ LDYE+    +F V   N    V     T+TA+V I V+N+ DE  EI +DY+N  NKN  I E E++   FVA+ TVT K+  L   + CRL + + +  + ++ D S     + IRT   +DRE        + C++  D  +  + A I++++KD+NDNAP +      S+ EN   GT+V  I A+D DEG+NG +T+S+ +S+  + +YL I    G +K +  ID E       +  +++T +D G  P+ +     ++++D NDN P+F +  + F + EN      +GEI V DKD +  + + L    N    PFV+ ++ N+ ++LNTTRSLD EK+  ++F+++A+D  G  +++ T TV V + D+ND+ P  IFP+ +N T + ISY E      +TVS  D D     N    +HL      +F ID+ +G I T R M++SD+G+HVI +   + G    +SS+ + +VID S
Sbjct:   56 FNLLSNTKANRLFHLHSNGKLYSAQTIDREELCINVESCCHK-KDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKFTINIKESEPVGSLFSLPIATDDDSEQYSIRDYKL--EENSIFPPIFSLEQNRPTGSLNLQL--IQKLDREKRAKYEFVLLAIDRGNP-PKTGRLVININVLDVNDNPPHLSQTNYNIQYEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVD----TATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNR-DSSIPSNKYSIRTRVTLDRETKGYYELQMECEDKGDPPL-RAKALIKVVVKDENDNAPVIKLENNVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQSFPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYSIQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNK-YYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKY-ISYHESAEIAILTVSVGDLDSKDSMNGKCSFHLVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNS 792          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000059376.1 (SMESG000059376.1)

HSP 1 Score: 355.14 bits (910), Expect = 5.088e-105
Identity = 271/768 (35.29%), Postives = 392/768 (51.04%), Query Frame = 1
Query:  286 PQTKMTYHLLKSSKAHSYFTIKNDN--LFTNTLVDMDSMCQNVGECCNKAKEICDFSIAIACRENQES---------EVXXXXXXXXXXXXXXXYPIFNERNXXXXXXXXVKIGHTITLPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFKPLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIYKEFVKEG-LNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSINEDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLNVYDEPLEINVDYLNN-KNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRLEHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDSHVPSSSAK--IEIIIKDQNDNAPTLTYFGTPSIL---ENTKPGTVVFKIIAQDKDEGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLTIVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNSFVGEIEVEDKDVHDDINLVLR--SKNPAMLPFVILKKANRIFHLNTTRSLDREKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNATVHVISYLEPRNYKFMTVSANDQDQTSEFN-TIEYHLESES-DVFDIDRQEGTIFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVI 2523
            P+ K+ Y LL       Y  + ++N  LF    +D DS+C  +  CC K+  IC  S+++A    Q S         + +      +    N  YPIFN     + ISES  +  T  LP+A DKD     V++YK   +   +    F L        ++V L++   LDRE T++YS  + A+DGG     TG + + I ++D NDN P F +  Y   VKE  + S  I ++ ATD D G N +I YK D            F ++E SG +Y+  PLDYEK   +K  + A N  P V     T+TA++ ++V+N+ DE   I VDY NN ++ SI E   +  FV IVTV  K+  +   +QC+L++  E+  L       YK     I T Q++DRE   K S +I+CK   D   PS SA   I ++I D+NDN P +    +PSI    EN  PGT+V KI A DKD+G NG++T+S+  +      YL+I    G+I+    ID E++    T L + VT +D G   +S+   I I I D NDN P+F  S   F++ EN      +G+IEV D D    + L +     N    PF I  + NR F L TT SLDRE+   +   +IATD  G  +++ + TV+V V+D NDN PI IFP   N T+  + Y +   Y  +T SAND+D     N  + + + S S ++F+ID   G I   R+M  SDIG+H I I V + G   + S  Q+ + I
Sbjct:   49 PEGKVLYRLLSGGSFIEYLHLDSNNGKLFAKRKIDRDSLCSEIELCC-KSDIICSVSVSVAMTAAQPSSKLSDPIIGKFLIVIEDRNDHKPNFEYPIFN-----LSISESCPVSTTFQLPLAIDKDSDKYSVKSYKFISKSDLSI---FSLETQFIDRKMSVYLRLKNRLDREDTDQYSLTIAAVDGGDP-ALTGVLVVHILVLDVNDNPPVFENTRYNVRVKESQMISDSIAQVRATDRDIGENAEIFYKLDSGM---------FRVDELSGSVYMISPLDYEKDQEYKLIITARNRIPGVN----TATATLTVNVININDEKPVIFVDYFNNWQHASISEYETAPAFVCIVTVKDKDIGIAGKVQCQLDNHHELFDLRQNSPGQYK-----IHTRQQLDRETNSKYSLSIVCK---DQGTPSLSADTIIPVVILDKNDNKPEI---NSPSIFHVSENKPPGTIVTKIDATDKDDGLNGKLTYSITDAQNLVSSYLTIDSQTGIIRTLQKIDREATNPPLTKLDLSVTVSDSGTPKQSSIKSIQILIDDENDNAPQFGQSTFRFSVTENEAPIYRLGQIEVSDPDETGSVRLGISFIKSNNRKSPFSITSEKNR-FWLMTTESLDREELDFYELVIIATDGAGYKSHTASATVNVTVLDINDNPPIFIFPRSGNETIPKVPYRQQPGYLVLTASANDKDNLPRGNGKLYFSINSNSNNLFNIDPHNGEIRIHRQMGISDIGDHFIIIKVEDDGTPVLSSERQIQIKI 781          
The following BLAST results are available for this feature:
BLAST of Protocadherin-9 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH93.611e-4528.53protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH93.766e-4528.53protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH94.597e-4528.53protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH94.941e-4528.53protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDHA125.445e-4526.27protocadherin alpha 12 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-16.531e-2925.50FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-15.927e-2725.43FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-18.879e-2526.09CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
cdh-42.473e-2326.97Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI... [more]
hmr-11.303e-2125.17Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ds1.384e-4026.52gene:FBgn0284247 transcript:FBtr0078045[more]
ds1.384e-4026.52gene:FBgn0284247 transcript:FBtr0343249[more]
stan1.785e-3427.27gene:FBgn0024836 transcript:FBtr0304900[more]
stan1.926e-3427.81gene:FBgn0024836 transcript:FBtr0303223[more]
stan1.926e-3427.81gene:FBgn0024836 transcript:FBtr0088214[more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh2g281.842e-4828.20protocadherin 2 gamma 28 [Source:ZFIN;Acc:ZDB-GENE... [more]
pcdh2g288.997e-4829.22protocadherin 2 gamma 28 [Source:ZFIN;Acc:ZDB-GENE... [more]
CT030123.12.162e-4626.46protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CT030123.12.794e-4626.46protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CT030123.13.045e-4626.46protocadherin 1b [Source:NCBI gene;Acc:572016][more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000027070.12.819e-4728.15pep primary_assembly:Xenopus_tropicalis_v9.1:3:190... [more]
vapa5.732e-4627.91VAMP associated protein A [Source:Xenbase;Acc:XB-G... [more]
ENSXETT00000039600.18.468e-4427.36protocadherin alpha 5 [Source:NCBI gene;Acc:100125... [more]
atp5pd1.658e-4326.82ATP synthase peripheral stalk subunit d [Source:Xe... [more]
ENSXETT00000029153.14.797e-4329.07protocadherin 8 [Source:NCBI gene;Acc:100485587][more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh12.401e-4627.85protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh12.401e-4627.85protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh13.438e-4627.85protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh96.923e-4528.37protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh97.227e-4528.37protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
back to top
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5DRF2|PCDAC_PANTR5.454e-4526.42Protocadherin alpha-12 OS=Pan troglodytes OX=9598 ... [more]
sp|Q9HC56|PCDH9_HUMAN2.208e-4428.53Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 P... [more]
sp|Q5DRF1|PCDAD_PANTR2.453e-4426.83Protocadherin alpha-13 OS=Pan troglodytes OX=9598 ... [more]
sp|Q71M42|PC11X_PANTR2.958e-4428.48Protocadherin-11 X-linked OS=Pan troglodytes OX=95... [more]
sp|Q6WYY1|PC11X_PANPA3.252e-4428.48Protocadherin-11 X-linked OS=Pan paniscus OX=9597 ... [more]
back to top
BLAST of Protocadherin-9 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3UIX69.114e-6829.54Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3TSV21.052e-6629.66Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
U6IWT99.017e-6529.02Protocadherin 11 OS=Echinococcus granulosus OX=621... [more]
A0A0R3X1407.224e-6428.82Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A0R3SLI47.269e-6428.98Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000036470.15.847e-6128.40pep primary_assembly:Astyanax_mexicanus-2.0:20:107... [more]
ENSAMXT00000049785.12.509e-4629.84pep primary_assembly:Astyanax_mexicanus-2.0:20:107... [more]
pcdh1a4.814e-4626.40protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a6.034e-4626.40protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
ENSAMXT00000034478.11.092e-4528.28pep primary_assembly:Astyanax_mexicanus-2.0:20:107... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008517.12.649e-4025.56pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
ENSPMAT00000010725.11.612e-3924.90pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
si:ch211-199f5.16.289e-3627.52protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
ENSPMAT00000004042.12.433e-3123.71pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
ENSPMAT00000004043.12.512e-3123.71pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO354122.021e-4530.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461891.278e-4328.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482375.699e-3426.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417674.245e-3328.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404707.960e-3326.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh98.302e-4627.68protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh91.255e-4527.68protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh91.275e-4527.68protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
PCDH89.370e-4527.49protocadherin 8 [Source:NCBI gene;Acc:101158635][more]
pcdh2ab92.058e-4427.35protocadherin alpha-C2 [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of Protocadherin-9 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041975.10.000e+099.62SMESG000041975.1[more]
SMESG000041975.10.000e+099.61SMESG000041975.1[more]
SMESG000051236.18.900e-10634.75SMESG000051236.1[more]
SMESG000051236.11.384e-10534.75SMESG000051236.1[more]
SMESG000059376.15.088e-10535.29SMESG000059376.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014036 ID=SMED30014036|Name=Protocadherin-9|organism=Schmidtea mediterranea sexual|type=transcript|length=3433bp
AAATTTCATAATTTTTACTATGAATATGAAGCGAATTTTGATTGGTCGGA
ACTTTTAGGATTGCACACTAATTGGCTAGTTGCAGAACTCAATTTGAGTT
GGTTGTAAGCCATTTTACAATTTAATGTTTTTAACCGTAATATTCTGTTT
GAAAAAATGCATGTTAGTTATGTGTGGTATTTATGGTTGATACTGTTCAT
AAAGAAGAATACGTGTATGGAGGTTATCAATATCTCTGATGATACTGCAC
TCAACATTAAATTGTATGATCTCAAAAAACTCATTCCCCAAACTAAAATG
ACATATCATTTATTGAAAAGTAGCAAAGCTCATTCGTATTTCACAATTAA
AAATGATAACCTATTTACTAATACGTTGGTGGACATGGATTCAATGTGCC
AAAATGTCGGCGAATGTTGCAATAAGGCAAAAGAAATCTGTGATTTCTCG
ATCGCCATTGCTTGTCGAGAAAATCAAGAATCAGAGGTCATTCGGAAGGA
TATCAAAATCAGTATTCGTGATAAAAATGATAATTATCCAATTTTTAATG
AAAGAAATATCGAAATAGAAATTTCAGAAAGTGTAAAGATTGGTCATACA
ATTACCTTACCAGTTGCTACTGACAAAGATTTCGGAAACAATCAAGTTGA
AACATACAAAATTTCCCGCCAGGAACCTCGAACATTTGATAATCATTTTC
GTTTAAATGTGTTAAACACATTAAATTCCGTTACAGTGGAACTTAAGGTT
TTTAAGCCATTAGATAGAGAAACCACGAACAAATACTCATTCGACTTAAT
GGCAATTGATGGTGGACAAACGGATCAGAAGACTGGCTCTATAAATATTG
CCATCAGAATTATTGATGAAAACGATAATATGCCTCAATTTAGCAGTCCG
ATTTATAAGGAATTTGTGAAGGAAGGACTAAATTCAGTGAGGATTCTTCG
GTTAAGTGCCACAGATCCCGATGAAGGTATAAATGGGAAAATTATTTATA
AATTTGATCCTCGTTTTAAAACTGGCGCACTTATACTCGATTATTTTTCA
ATTAACGAAGATTCAGGAGAAATTTATCTTAAAAAACCTTTGGATTATGA
AAAACAGACATTTTTTAAGTTTCCAGTAATAGCTGTCAATCCAACGCCGC
CTGTGACTATTACGTTATACACATCGACAGCATCAGTGGAGATTTCTGTT
TTAAACGTCTACGATGAACCCTTGGAGATAAATGTTGATTATTTAAATAA
TAAAAATTATTCCATTGTTGAAGAAAATAAAAGCAACTTTTTCGTTGCAA
TTGTAACAGTCACATCAAAGGAAAATGATTTATTTCGATCAATTCAGTGT
CGCCTGGAACACTTTCAAGAGATTTTGAGTTTGATTAGTAAAGGGGATGA
GAGTTACAAAGTGAAGTCCTTTGAAATAAGAACAAATCAAGAAATTGATC
GAGAAAAAATCCCAAAAATCAGCACCAATATACTGTGCAAAGAATCAGTC
GATTCCCATGTACCGTCATCGTCAGCGAAAATTGAAATAATCATAAAAGA
TCAGAATGATAATGCTCCAACATTGACATATTTTGGTACTCCATCAATAT
TGGAAAATACCAAACCGGGAACTGTTGTGTTTAAAATAATAGCTCAAGAT
AAAGATGAAGGAGAAAATGGAAGAGTGACATTCTCAATGGAGAAATCGGC
ATTTCCGAGTTTGGAATATCTCTCAATTGGTGAAACAGACGGGGTGATTA
AAGTAAAATCCATCATTGATTGTGAATCAAGTTTAGCTCAATTTACCACT
TTGACTATTGTTGTAACCGCAACCGACCATGGAATTAAGCCGAAATCTAC
GGATCTGCAAATCTCAATCACTATACAGGATGTCAACGACAATGTTCCAA
AGTTTACATCAAGTCATATGATCTTTACCATCATGGAGAATAATATGAAA
AATTCCTTTGTGGGTGAGATTGAAGTTGAAGATAAAGATGTTCACGATGA
TATCAACCTAGTATTAAGGAGCAAGAATCCAGCGATGCTACCTTTTGTTA
TTTTGAAGAAAGCTAATCGCATTTTCCATTTGAATACTACTCGTTCTTTA
GACAGAGAAAAAGATCCGAAATTTAATTTTCAAGTAATTGCTACAGATAG
CCTCGGTAATCCCACGAATTCTGTAACGGGAACTGTTGATGTTGAAGTGA
TAGATCAAAATGACAATTTCCCGATTATTATTTTCCCCTCTCAAAACAAT
GCCACTGTTCATGTAATTTCATATCTGGAGCCAAGAAATTACAAATTCAT
GACAGTCTCGGCAAATGACCAAGATCAAACTAGCGAATTTAACACCATAG
AATACCATTTAGAAAGTGAAAGTGACGTTTTTGACATTGATCGACAAGAA
GGAACGATTTTTACTCGCCGAGAAATGGCAAAGTCTGATATTGGAGAACA
CGTCATAAAAATTACAGTTTTTAACCCTGGTTACACTTCCATGAAATCTA
GTGTTCAAGTGAACGTTGTTATTGATGCATCTACCGCTAAAAGCAATTCA
CCCAGAATAGAAAATTTCAATATCAACAATGGTGGATTGATGGCTCATAA
TTCGTTTAGTACTTCAGAAATCATTATTGCCATTTTAATAGTGATTGTAT
TTTTCGTGGTGTTTGTCATTATAATTATCGTCTGTGTTGTTCTTCGCCAT
TGTCATAGAGAGCCAGTTTGTTTACGAGGCTTAATAGATAAATGCTCTCA
CAATAATCTCTCTCAGAATGAAAATCAAGTTTACTCTCCAACCATAAAAT
TGAATGCAAAAACTGATGGGGACTACTATAAAGACCCAATGCAAAATCCT
TCAATTGCAAGAGAACAATCAAATAATTGGAATGTTGTAAATCAATCAGG
CATTTACAATGTCACAGTTAGTCCAAATCAGTATTTCAAGGGGGGTCAGT
ATATGAAATTAGTGAATCCGTCTCATTATTATGCTCAACCGATGGCATAT
CAAACAATCGACGACAATTTGCTGAACAAATTCCCGGATAATAATTTCAG
TAAATCAGTTTTTAATATAAATAATCGACTCAATTGTAAATCGGAAATGA
ATCTGAACACTGAGAATTTGTTCAATGATCCGAATCAGGAATCGATACAG
ATCAACGGGCCCTCAAAGTCCCAATGGATAACGTCATTGACCCCCATGCA
GACCAGATCAAAAAGTGTTGTAAATAGGATTATTTCCATTGAACAACCAA
TTGAAAACAATTTCGCCGTTGTTTATCCACCAGAGCAGTCGACTTTCGTT
TGAAAATATATTTTTCAATGGCTATTTATTTTATAAATTTACTATTGTGC
ATAAATGTAATAAAATGGAGCTTTTTAATTTAAACAAACTTTGTTTCATC
TATAAATCTTGTGTGAAAATGCATTAATTTATT
back to top

protein sequence of SMED30014036-orf-1

>SMED30014036-orf-1 ID=SMED30014036-orf-1|Name=SMED30014036-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1049bp
MHVSYVWYLWLILFIKKNTCMEVINISDDTALNIKLYDLKKLIPQTKMTY
HLLKSSKAHSYFTIKNDNLFTNTLVDMDSMCQNVGECCNKAKEICDFSIA
IACRENQESEVIRKDIKISIRDKNDNYPIFNERNIEIEISESVKIGHTIT
LPVATDKDFGNNQVETYKISRQEPRTFDNHFRLNVLNTLNSVTVELKVFK
PLDRETTNKYSFDLMAIDGGQTDQKTGSINIAIRIIDENDNMPQFSSPIY
KEFVKEGLNSVRILRLSATDPDEGINGKIIYKFDPRFKTGALILDYFSIN
EDSGEIYLKKPLDYEKQTFFKFPVIAVNPTPPVTITLYTSTASVEISVLN
VYDEPLEINVDYLNNKNYSIVEENKSNFFVAIVTVTSKENDLFRSIQCRL
EHFQEILSLISKGDESYKVKSFEIRTNQEIDREKIPKISTNILCKESVDS
HVPSSSAKIEIIIKDQNDNAPTLTYFGTPSILENTKPGTVVFKIIAQDKD
EGENGRVTFSMEKSAFPSLEYLSIGETDGVIKVKSIIDCESSLAQFTTLT
IVVTATDHGIKPKSTDLQISITIQDVNDNVPKFTSSHMIFTIMENNMKNS
FVGEIEVEDKDVHDDINLVLRSKNPAMLPFVILKKANRIFHLNTTRSLDR
EKDPKFNFQVIATDSLGNPTNSVTGTVDVEVIDQNDNFPIIIFPSQNNAT
VHVISYLEPRNYKFMTVSANDQDQTSEFNTIEYHLESESDVFDIDRQEGT
IFTRREMAKSDIGEHVIKITVFNPGYTSMKSSVQVNVVIDASTAKSNSPR
IENFNINNGGLMAHNSFSTSEIIIAILIVIVFFVVFVIIIIVCVVLRHCH
REPVCLRGLIDKCSHNNLSQNENQVYSPTIKLNAKTDGDYYKDPMQNPSI
AREQSNNWNVVNQSGIYNVTVSPNQYFKGGQYMKLVNPSHYYAQPMAYQT
IDDNLLNKFPDNNFSKSVFNINNRLNCKSEMNLNTENLFNDPNQESIQIN
GPSKSQWITSLTPMQTRSKSVVNRIISIEQPIENNFAVVYPPEQSTFV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 130..159
score: 25.58
coord: 302..328
score: 32.18
coord: 455..472
score: 39.49
coord: 243..256
score: 38.05
coord: 209..221
score: 33.62
coord: 224..243
score: 32.39
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 717..799
e-value: 0.018
score: 21.7
coord: 266..356
e-value: 2.6E-17
score: 73.5
coord: 494..581
e-value: 1.7E-17
score: 74.1
coord: 605..689
e-value: 3.8E-8
score: 43.0
coord: 383..471
e-value: 0.03
score: 19.4
coord: 152..243
e-value: 9.9E-12
score: 55.0
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 590..681
e-value: 4.6E-9
score: 36.6
coord: 136..233
e-value: 1.6E-12
score: 47.7
coord: 254..348
e-value: 4.7E-12
score: 46.2
coord: 709..789
e-value: 7.7E-7
score: 29.5
coord: 480..574
e-value: 3.7E-11
score: 43.3
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 366..469
e-value: 1.7E-8
score: 37.0
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 241..356
e-value: 4.1E-22
score: 80.8
coord: 579..687
e-value: 4.4E-18
score: 67.8
coord: 124..240
e-value: 3.8E-23
score: 84.1
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 688..790
e-value: 1.4E-11
score: 46.8
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 470..578
e-value: 2.2E-21
score: 78.4
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 25..540
coord: 423..908
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 584..691
score: 18.223
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 480..583
score: 22.695
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 362..473
score: 10.725
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 263..357
score: 17.434
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 714..801
score: 11.449
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 131..245
score: 22.278
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 24..130
score: 9.454
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 709..789
e-value: 2.11697E-9
score: 53.4714
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 135..241
e-value: 3.82781E-20
score: 84.2873
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 249..351
e-value: 6.47207E-20
score: 83.5169
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 590..687
e-value: 6.36346E-14
score: 66.5681
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 480..579
e-value: 5.88665E-24
score: 95.0729
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.691
NoneNo IPR availableTMHMMTMhelixcoord: 822..844
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 571..581
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 233..243
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 679..689
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 571..695
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 239..350
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 467..576
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 679..789
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 124..237