RRM domain-containing protein

Overview
NameRRM domain-containing protein
Smed IDSMED30014012
Length (bp)1219
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RRM domain-containing protein (SMED30014012) t-SNE clustered cells

Violin plots show distribution of expression levels for RRM domain-containing protein (SMED30014012) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RRM domain-containing protein (SMED30014012) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RRM domain-containing protein (SMED30014012) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014012

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30014012SMESG000064851.1 SmedASXL_005458SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30014012SMESG000064851.1 SmedASXL_005458SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
muscle cellSMED30014012SMESG000064851.1 dd_Smed_v4_2462_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014012SMESG000064851.1 dd_Smed_v4_2462_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: Y57G11C.9 (pep chromosome:WBcel235:IV:14787168:14790843:1 gene:WBGene00013307.1 transcript:Y57G11C.9a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y57G11C.9)

HSP 1 Score: 67.781 bits (164), Expect = 5.173e-12
Identity = 28/87 (32.18%), Postives = 52/87 (59.77%), Query Frame = 3
Query:  156 NIPTSRHSIFIRGFPASMNSKSVKAFFVDETRSNVLIDFVSYTDEHKKLCIAIRFESHQIAKEMYNKFNNREILGHVVEFSWFKDMK 416
             +P S+H+IFIRG    ++++ +K + + E    +  DFV    +  K+ +A+RFE+   AKE    +++RE +G   + SWF+D++
Sbjct:   44 QVPQSKHTIFIRGLHGDISTEEIKEY-IGEKVGKISFDFVKVAQDKSKIFVAVRFENRDEAKEFMETYSDREFMGCRCDLSWFRDIR 129          
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: Y57G11C.9 (pep chromosome:WBcel235:IV:14787168:14790843:1 gene:WBGene00013307.1 transcript:Y57G11C.9b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y57G11C.9)

HSP 1 Score: 67.0106 bits (162), Expect = 8.158e-12
Identity = 28/87 (32.18%), Postives = 52/87 (59.77%), Query Frame = 3
Query:  156 NIPTSRHSIFIRGFPASMNSKSVKAFFVDETRSNVLIDFVSYTDEHKKLCIAIRFESHQIAKEMYNKFNNREILGHVVEFSWFKDMK 416
             +P S+H+IFIRG    ++++ +K + + E    +  DFV    +  K+ +A+RFE+   AKE    +++RE +G   + SWF+D++
Sbjct:   44 QVPQSKHTIFIRGLHGDISTEEIKEY-IGEKVGKISFDFVKVAQDKSKIFVAVRFENRDEAKEFMETYSDREFMGCRCDLSWFRDIR 129          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A564ZDM5 (RRM domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS15109 PE=4 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 3.423e-21
Identity = 44/94 (46.81%), Postives = 64/94 (68.09%), Query Frame = 3
Query:  159 IPTSRHSIFIRGFPASMNSKSVKAFFVDETRSNVLIDFVSYTDEHKKLCIAIRFESHQIAKEMYNKFNNREILGHVVEFSWFKDMKAVKGRYNE 440
            +P SRH+IFIRG P S N  SVK  F  ET +   ++F S +D+  K  +AIRF+SH++A+EM  ++N +E+LGH VE +WFK++K  + R  E
Sbjct:   16 VPPSRHTIFIRGLPGSTNVDSVKNHFCQETDTKCTVEFFSTSDDKVKFSVAIRFKSHELAREMLERYNGKELLGHPVEVTWFKNLKKARARAYE 109          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A158QG00 (RRM domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS9788 PE=4 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 3.462e-21
Identity = 44/94 (46.81%), Postives = 64/94 (68.09%), Query Frame = 3
Query:  159 IPTSRHSIFIRGFPASMNSKSVKAFFVDETRSNVLIDFVSYTDEHKKLCIAIRFESHQIAKEMYNKFNNREILGHVVEFSWFKDMKAVKGRYNE 440
            +P SRH+IFIRG P S N  SVK  F  ET +   ++F S +D+  K  +AIRF+SH++A+EM  ++N +E+LGH VE +WFK++K  + R  E
Sbjct:   16 VPPSRHTIFIRGLPGSTNVDSVKNHFCQETDTKCTVEFFSTSDDKVKFSVAIRFKSHELAREMLERYNGKELLGHPVEVTWFKNLKKARARAYE 109          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A564ZDI9 (RRM domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS15109 PE=4 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 5.118e-21
Identity = 44/94 (46.81%), Postives = 64/94 (68.09%), Query Frame = 3
Query:  159 IPTSRHSIFIRGFPASMNSKSVKAFFVDETRSNVLIDFVSYTDEHKKLCIAIRFESHQIAKEMYNKFNNREILGHVVEFSWFKDMKAVKGRYNE 440
            +P SRH+IFIRG P S N  SVK  F  ET +   ++F S +D+  K  +AIRF+SH++A+EM  ++N +E+LGH VE +WFK++K  + R  E
Sbjct:   16 VPPSRHTIFIRGLPGSTNVDSVKNHFCQETDTKCTVEFFSTSDDKVKFSVAIRFKSHELAREMLERYNGKELLGHPVEVTWFKNLKKARARAYE 109          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A564ZDY2 (RRM domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS15109 PE=4 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 6.675e-21
Identity = 44/94 (46.81%), Postives = 64/94 (68.09%), Query Frame = 3
Query:  159 IPTSRHSIFIRGFPASMNSKSVKAFFVDETRSNVLIDFVSYTDEHKKLCIAIRFESHQIAKEMYNKFNNREILGHVVEFSWFKDMKAVKGRYNE 440
            +P SRH+IFIRG P S N  SVK  F  ET +   ++F S +D+  K  +AIRF+SH++A+EM  ++N +E+LGH VE +WFK++K  + R  E
Sbjct:   16 VPPSRHTIFIRGLPGSTNVDSVKNHFCQETDTKCTVEFFSTSDDKVKFSVAIRFKSHELAREMLERYNGKELLGHPVEVTWFKNLKKARARAYE 109          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: E2IXF9 (Secondary spermatocytes accumulation 1 protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=spac-1 PE=2 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 8.459e-21
Identity = 44/89 (49.44%), Postives = 69/89 (77.53%), Query Frame = 3
Query:  159 IPTSRHSIFIRGFPASMNSKSVKAFFVDETRSNVLIDFVSYTDEHKKLCIAIRFESHQIAKEMYNKFNNREILGHVVEFSWFKDMKAVK 425
            +  SRHSIFIRGFP++M+ ++V++FF  E++ N  IDF SY+++ KKL IA+RFESH+ A ++   F+++E+LGH +E SWFKD++  +
Sbjct:   19 VTPSRHSIFIRGFPSNMSMENVRSFFKTESKENCKIDFFSYSEDRKKLFIALRFESHEKAVDIIENFDSKEVLGHSIEVSWFKDLRKAR 107          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000064851.1 (SMESG000064851.1)

HSP 1 Score: 587.415 bits (1513), Expect = 0.000e+0
Identity = 373/373 (100.00%), Postives = 373/373 (100.00%), Query Frame = 3
Query:   69 MSVSRNYFSDRGRDRQGFNYRRNDRSFGGNIPTSRHSIFIRGFPASMNSKSVKAFFVDETRSNVLIDFVSYTDEHKKLCIAIRFESHQIAKEMYNKFNNREILGHVVEFSWFKDMKAVKGRYNEXXXXXXXXXXXXXXXFTEXXXXXXXXXXXXXXKQRYRDSFEKKKEYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPTRLIRXXXXXXXXXXXXSDSYTSRDHSRDRSRYKSDDNSDQARKPHRSESKKPKEQPAPSVKQDPVVSVEKKPELTLATDDPDPVSIDLPSNVESDECIKIKSKSTELLDNYSKEIENYLNIINAFIGKNPDLEAPLVASLKDILNEVGEKYVYQFLKYIENVPAEIVAS 1187
            MSVSRNYFSDRGRDRQGFNYRRNDRSFGGNIPTSRHSIFIRGFPASMNSKSVKAFFVDETRSNVLIDFVSYTDEHKKLCIAIRFESHQIAKEMYNKFNNREILGHVVEFSWFKDMKAVKGRYNERRFRDRPYPNRRPRRFTERSGRSGSRNFRSRSKQRYRDSFEKKKEYKSRSHSRDSASSSSFSKSRSGSESVSASSSASPTRLIRNINKHKYKKKNNSDSYTSRDHSRDRSRYKSDDNSDQARKPHRSESKKPKEQPAPSVKQDPVVSVEKKPELTLATDDPDPVSIDLPSNVESDECIKIKSKSTELLDNYSKEIENYLNIINAFIGKNPDLEAPLVASLKDILNEVGEKYVYQFLKYIENVPAEIVAS
Sbjct:    1 MSVSRNYFSDRGRDRQGFNYRRNDRSFGGNIPTSRHSIFIRGFPASMNSKSVKAFFVDETRSNVLIDFVSYTDEHKKLCIAIRFESHQIAKEMYNKFNNREILGHVVEFSWFKDMKAVKGRYNERRFRDRPYPNRRPRRFTERSGRSGSRNFRSRSKQRYRDSFEKKKEYKSRSHSRDSASSSSFSKSRSGSESVSASSSASPTRLIRNINKHKYKKKNNSDSYTSRDHSRDRSRYKSDDNSDQARKPHRSESKKPKEQPAPSVKQDPVVSVEKKPELTLATDDPDPVSIDLPSNVESDECIKIKSKSTELLDNYSKEIENYLNIINAFIGKNPDLEAPLVASLKDILNEVGEKYVYQFLKYIENVPAEIVAS 373          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000038824.1 (SMESG000038824.1)

HSP 1 Score: 109.768 bits (273), Expect = 2.367e-26
Identity = 47/91 (51.65%), Postives = 66/91 (72.53%), Query Frame = 3
Query:  159 IPTSRHSIFIRGFPASMNSKSVKAFFVDETRSNVLIDFVSYTDEHKKLCIAIRFESHQIAKEMYNKFNNREILGHVVEFSWFKDMKAVKGR 431
            +P SRH+IFIRGF   +++  ++ FF + ++SN  +DF SY DE +KL IA+RFESH IAK+M  +FNN EI G+ VE +WFKD+K  + R
Sbjct:   29 VPPSRHAIFIRGFANDVDTHKIRDFFQEASKSNCGVDFTSYNDEQRKLSIALRFESHDIAKDMLLRFNNTEIFGYRVEVTWFKDLKKARDR 119          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000038824.1 (SMESG000038824.1)

HSP 1 Score: 109.768 bits (273), Expect = 3.713e-26
Identity = 47/91 (51.65%), Postives = 66/91 (72.53%), Query Frame = 3
Query:  159 IPTSRHSIFIRGFPASMNSKSVKAFFVDETRSNVLIDFVSYTDEHKKLCIAIRFESHQIAKEMYNKFNNREILGHVVEFSWFKDMKAVKGR 431
            +P SRH+IFIRGF   +++  ++ FF + ++SN  +DF SY DE +KL IA+RFESH IAK+M  +FNN EI G+ VE +WFKD+K  + R
Sbjct:   29 VPPSRHAIFIRGFANDVDTHKIRDFFQEASKSNCGVDFTSYNDEQRKLSIALRFESHDIAKDMLLRFNNTEIFGYRVEVTWFKDLKKARDR 119          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000038824.1 (SMESG000038824.1)

HSP 1 Score: 109.768 bits (273), Expect = 4.127e-26
Identity = 47/91 (51.65%), Postives = 66/91 (72.53%), Query Frame = 3
Query:  159 IPTSRHSIFIRGFPASMNSKSVKAFFVDETRSNVLIDFVSYTDEHKKLCIAIRFESHQIAKEMYNKFNNREILGHVVEFSWFKDMKAVKGR 431
            +P SRH+IFIRGF   +++  ++ FF + ++SN  +DF SY DE +KL IA+RFESH IAK+M  +FNN EI G+ VE +WFKD+K  + R
Sbjct:   29 VPPSRHAIFIRGFANDVDTHKIRDFFQEASKSNCGVDFTSYNDEQRKLSIALRFESHDIAKDMLLRFNNTEIFGYRVEVTWFKDLKKARDR 119          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000002926.1 (SMESG000002926.1)

HSP 1 Score: 103.605 bits (257), Expect = 6.705e-24
Identity = 44/89 (49.44%), Postives = 69/89 (77.53%), Query Frame = 3
Query:  159 IPTSRHSIFIRGFPASMNSKSVKAFFVDETRSNVLIDFVSYTDEHKKLCIAIRFESHQIAKEMYNKFNNREILGHVVEFSWFKDMKAVK 425
            +  SRHSIFIRGFP++M+ ++V++FF  E++ N  IDF SY+++ KKL IA+RFESH+ A ++   F+++E+LGH +E SWFKD++  +
Sbjct:   19 VTPSRHSIFIRGFPSNMSMENVRSFFKTESKENCKIDFFSYSEDRKKLFIALRFESHEKAVDIIENFDSKEVLGHSIEVSWFKDLRKAR 107          
The following BLAST results are available for this feature:
BLAST of RRM domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Y57G11C.95.173e-1232.18pep chromosome:WBcel235:IV:14787168:14790843:1 gen... [more]
Y57G11C.98.158e-1232.18pep chromosome:WBcel235:IV:14787168:14790843:1 gen... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564ZDM53.423e-2146.81RRM domain-containing protein OS=Hymenolepis dimin... [more]
A0A158QG003.462e-2146.81RRM domain-containing protein OS=Hymenolepis dimin... [more]
A0A564ZDI95.118e-2146.81RRM domain-containing protein OS=Hymenolepis dimin... [more]
A0A564ZDY26.675e-2146.81RRM domain-containing protein OS=Hymenolepis dimin... [more]
E2IXF98.459e-2149.44Secondary spermatocytes accumulation 1 protein (Fr... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064851.10.000e+0100.00SMESG000064851.1[more]
SMESG000038824.12.367e-2651.65SMESG000038824.1[more]
SMESG000038824.13.713e-2651.65SMESG000038824.1[more]
SMESG000038824.14.127e-2651.65SMESG000038824.1[more]
SMESG000002926.16.705e-2449.44SMESG000002926.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014012 ID=SMED30014012|Name=RRM domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1219bp
ATTTTAACTTTTTTAGAAAATATTAATTTGAAGTCGACATTTTTAAATAA
TAATTTTTTTGTATATTTATGTCAGTATCTAGAAATTATTTTAGTGATAG
AGGAAGAGACAGGCAAGGGTTTAATTACCGACGAAATGATCGATCTTTCG
GTGGGAATATTCCAACAAGCCGGCATTCTATTTTTATTCGTGGTTTTCCA
GCGTCAATGAATTCAAAATCTGTAAAAGCTTTTTTCGTCGATGAAACTCG
ATCCAATGTACTTATAGATTTCGTTAGCTATACAGATGAGCATAAAAAAT
TATGCATTGCTATTCGATTTGAAAGTCATCAAATAGCCAAAGAAATGTAT
AACAAATTTAACAATCGCGAAATATTGGGACATGTAGTGGAATTTTCTTG
GTTTAAAGACATGAAAGCAGTTAAAGGTCGATATAATGAACGGCGCTTTA
GAGATCGTCCTTATCCTAATAGGAGACCAAGAAGATTTACTGAAAGATCT
GGTAGATCTGGTTCTCGTAATTTCCGAAGTAGATCTAAACAGCGTTATCG
TGATAGTTTTGAAAAGAAAAAAGAATATAAATCTCGATCACATTCAAGAG
ATTCGGCCTCATCATCAAGTTTTTCCAAATCACGATCAGGAAGTGAATCG
GTGTCAGCAAGTTCATCAGCATCTCCTACTAGATTAATTAGAAATATTAA
TAAGCACAAGTATAAAAAGAAAAATAATTCAGATTCTTATACTTCTAGAG
ATCATAGTAGAGATCGAAGTCGATATAAAAGTGATGATAACTCAGATCAA
GCAAGAAAACCTCATCGTAGCGAATCTAAAAAACCGAAAGAACAGCCTGC
TCCCTCTGTAAAGCAGGATCCGGTTGTGAGTGTTGAGAAGAAACCTGAAC
TAACGCTAGCAACGGATGATCCAGATCCGGTATCTATCGATCTGCCGTCA
AATGTCGAATCGGATGAGTGCATCAAGATCAAATCAAAATCAACGGAACT
ACTCGATAATTATAGCAAAGAGATTGAAAATTACCTGAACATAATCAACG
CGTTTATCGGTAAGAATCCCGATTTGGAAGCACCGCTAGTTGCGTCATTG
AAAGACATTCTCAATGAAGTCGGGGAGAAATATGTCTATCAATTCCTGAA
GTATATTGAAAATGTTCCAGCTGAGATCGTTGCCAGCTAAACCTGTGCTC
TTTTTGCTGTCTATTATTT
back to top

protein sequence of SMED30014012-orf-1

>SMED30014012-orf-1 ID=SMED30014012-orf-1|Name=SMED30014012-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=374bp
MSVSRNYFSDRGRDRQGFNYRRNDRSFGGNIPTSRHSIFIRGFPASMNSK
SVKAFFVDETRSNVLIDFVSYTDEHKKLCIAIRFESHQIAKEMYNKFNNR
EILGHVVEFSWFKDMKAVKGRYNERRFRDRPYPNRRPRRFTERSGRSGSR
NFRSRSKQRYRDSFEKKKEYKSRSHSRDSASSSSFSKSRSGSESVSASSS
ASPTRLIRNINKHKYKKKNNSDSYTSRDHSRDRSRYKSDDNSDQARKPHR
SESKKPKEQPAPSVKQDPVVSVEKKPELTLATDDPDPVSIDLPSNVESDE
CIKIKSKSTELLDNYSKEIENYLNIINAFIGKNPDLEAPLVASLKDILNE
VGEKYVYQFLKYIENVPAEIVAS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0000166nucleotide binding
GO:0003676nucleic acid binding
Vocabulary: biological process
TermDefinition
GO:0045892negative regulation of transcription, DNA-templated
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR035979RBD_domain_sf
IPR012677Nucleotide-bd_a/b_plait_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 29..110
e-value: 1.1E-5
score: 27.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 128..284
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 177..207
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 128..176
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 216..261
NoneNo IPR availableCDDcd00590RRM_SFcoord: 38..108
e-value: 0.00860409
score: 32.6621
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 36..139