mRNA-capping enzyme

Overview
NamemRNA-capping enzyme
Smed IDSMED30014011
Length (bp)2087
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of mRNA-capping enzyme (SMED30014011) t-SNE clustered cells

Violin plots show distribution of expression levels for mRNA-capping enzyme (SMED30014011) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014011

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30014011h1SMcG0003441 Contig40664newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30014011h1SMcG0003441 Contig40664uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
testisSMED30014011h1SMcG0003441 PL08008B1F01_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30014011h1SMcG0003441 PL08008B1F01_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
testis primordiumSMED30014011h1SMcG0003441 PL08008B1F01_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile stagecDNA to DNA expression microarray evidence
testisSMED30014011h1SMcG0003441 PL06020A2G07_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30014011h1SMcG0003441 PL06020A2G07_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
testis primordiumSMED30014011h1SMcG0003441 PL06020A2G07_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile stagecDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of mRNA-capping enzyme vs. Ensembl Human
Match: RNGTT (RNA guanylyltransferase and 5'-phosphatase [Source:HGNC Symbol;Acc:HGNC:10073])

HSP 1 Score: 247.669 bits (631), Expect = 1.754e-72
Identity = 148/330 (44.85%), Postives = 197/330 (59.70%), Query Frame = 3
Query: 1017 FMEGVSKVSAVLDVT---EMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPMSP--TEHHSNLILDGEMVIDIVKDIGFPRFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEKRKFLPQDA---KAQESFGILMKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIYNKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
            F+EGV+ V  V  VT   ++  V+Q           GFPG QPVSM  +N+KLL  K Y VSWK DG RYM+++ G++ V+M+DRDN VF V  L FP       H SN +LDGEM+ID V     PR+LI+DI+  NS  VG  +F  RL  I+ EII  R    +     K QE F +  K F+DI T+ KL +G+F  ++ HEMDGLIFQP  K   Y  G+    LKWKPP  NS+DF LK   +  +G  P+ VG L+V G + PFA+I+ +++E ++ Y+NKI+EC +   S  W  +R+RTDKS PN    A  +  SI NPV
Sbjct:  232 FLEGVT-VKGVTQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIKLLDLKPYKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDRVNGQAVPRYLIYDIIKFNSQPVGDCDFNVRLQCIEREIISPRHEKMKTGLIDKTQEPFSVRNKPFFDICTSRKLLEGNFAKEVSHEMDGLIFQPTGK---YKPGRCDDILKWKPPSLNSVDFRLKITRMGGEGLLPQNVGLLYVGGYERPFAQIK-VTKELKQ-YDNKIIECKFENNS--WVFMRQRTDKSFPNAYNTAMAVCNSISNPV 553          

HSP 2 Score: 147.517 bits (371), Expect = 8.789e-37
Identity = 71/172 (41.28%), Postives = 112/172 (65.12%), Query Frame = 3
Query:   63 PSKWLDCPNIGTIIHDMFVPFKTPLDQKFDPEIPPANRFS---LTSFLASKKSEKVGMIVNLTNTKKYYNVNELDG-IIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRKIY 566
            P +WL+CP  G  +   F+P KT L  ++D ++   NRF    L+++L S K  K+G++V+LTNT ++Y+ N+++   I+Y ++  +GH   P  +  + FI +C  F +R   ++IGVHCTHG+NRTGF++ +FL EK D  ++ AV  FA+ARPPGI++ DYL  L + Y
Sbjct:    7 PPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSMLSNYLKSLKV-KMGLLVDLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNERNPPELIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKGDYLKELFRRY 177          
BLAST of mRNA-capping enzyme vs. Ensembl Human
Match: RNGTT (RNA guanylyltransferase and 5'-phosphatase [Source:HGNC Symbol;Acc:HGNC:10073])

HSP 1 Score: 209.92 bits (533), Expect = 8.144e-59
Identity = 134/330 (40.61%), Postives = 182/330 (55.15%), Query Frame = 3
Query: 1017 FMEGVSKVSAVLDVT---EMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPMSP--TEHHSNLILDGEMVIDIVKDIGFPRFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEKRKFLPQDA---KAQESFGILMKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIYNKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
            F+EGV+ V  V  VT   ++  V+Q           GFPG QPVSM  +N+KLL  K Y VSWK DG RYM+++ G++ V+M+DRDN VF V  L FP       H SN +LDGEM+ID V     PR+LI+DI+  NS  VG  +F  RL  I+ EII  R    +     K QE F +  K F+DI T+ K                  ++P   +D+         LKWKPP  NS+DF LK   +  +G  P+ VG L+V G + PFA+I+ +++E ++ Y+NKI+EC +   S  W  +R+RTDKS PN    A  +  SI NPV
Sbjct:  232 FLEGVT-VKGVTQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIKLLDLKPYKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDRVNGQAVPRYLIYDIIKFNSQPVGDCDFNVRLQCIEREIISPRHEKMKTGLIDKTQEPFSVRNKPFFDICTSRKK-----------------YKPGRCDDI---------LKWKPPSLNSVDFRLKITRMGGEGLLPQNVGLLYVGGYERPFAQIK-VTKELKQ-YDNKIIECKFENNS--WVFMRQRTDKSFPNAYNTAMAVCNSISNPV 530          

HSP 2 Score: 147.517 bits (371), Expect = 7.612e-37
Identity = 71/172 (41.28%), Postives = 112/172 (65.12%), Query Frame = 3
Query:   63 PSKWLDCPNIGTIIHDMFVPFKTPLDQKFDPEIPPANRFS---LTSFLASKKSEKVGMIVNLTNTKKYYNVNELDG-IIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRKIY 566
            P +WL+CP  G  +   F+P KT L  ++D ++   NRF    L+++L S K  K+G++V+LTNT ++Y+ N+++   I+Y ++  +GH   P  +  + FI +C  F +R   ++IGVHCTHG+NRTGF++ +FL EK D  ++ AV  FA+ARPPGI++ DYL  L + Y
Sbjct:    7 PPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSMLSNYLKSLKV-KMGLLVDLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNERNPPELIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKGDYLKELFRRY 177          
BLAST of mRNA-capping enzyme vs. Ensembl Human
Match: RNGTT (RNA guanylyltransferase and 5'-phosphatase [Source:HGNC Symbol;Acc:HGNC:10073])

HSP 1 Score: 156.762 bits (395), Expect = 9.810e-41
Identity = 101/253 (39.92%), Postives = 133/253 (52.57%), Query Frame = 3
Query: 1017 FMEGVSKVSAVLDVT---EMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPMSP--TEHHSNLILDGEMVIDIVKDIGFPRFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEKRKFLPQDA---KAQESFGILMKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDG 1751
            F+EGV+ V  V  VT   ++  V+Q           GFPG QPVSM  +N+KLL  K Y VSWK DG RYM+++ G++ V+M+DRDN VF V  L FP       H SN +LDGEM+ID V     PR+LI+DI+  NS  VG  +F  RL  I+ EII  R    +     K QE F +  K F+DI T+ K                  ++P   +D+         LKWKPP  NS+DF LK   +  +G
Sbjct:  232 FLEGVT-VKGVTQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIKLLDLKPYKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDRVNGQAVPRYLIYDIIKFNSQPVGDCDFNVRLQCIEREIISPRHEKMKTGLIDKTQEPFSVRNKPFFDICTSRKK-----------------YKPGRCDDI---------LKWKPPSLNSVDFRLKITRMGGEG 457          

HSP 2 Score: 147.132 bits (370), Expect = 1.964e-37
Identity = 71/172 (41.28%), Postives = 112/172 (65.12%), Query Frame = 3
Query:   63 PSKWLDCPNIGTIIHDMFVPFKTPLDQKFDPEIPPANRFS---LTSFLASKKSEKVGMIVNLTNTKKYYNVNELDG-IIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRKIY 566
            P +WL+CP  G  +   F+P KT L  ++D ++   NRF    L+++L S K  K+G++V+LTNT ++Y+ N+++   I+Y ++  +GH   P  +  + FI +C  F +R   ++IGVHCTHG+NRTGF++ +FL EK D  ++ AV  FA+ARPPGI++ DYL  L + Y
Sbjct:    7 PPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSMLSNYLKSLKV-KMGLLVDLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNERNPPELIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKGDYLKELFRRY 177          
BLAST of mRNA-capping enzyme vs. Ensembl Human
Match: DUSP11 (dual specificity phosphatase 11 [Source:HGNC Symbol;Acc:HGNC:3066])

HSP 1 Score: 104.76 bits (260), Expect = 1.647e-23
Identity = 75/258 (29.07%), Postives = 127/258 (49.22%), Query Frame = 3
Query:   45 RGNFDPPSKWLDCPNIGTII-HDMFVPFKTPLDQKFDPEIPPANRFSLTSFLAS--KKSEKVGMIVNLTNTKKYYNVNELDGIIRYDQIFLEGHETYPDQKQVDKFIVICSYFF--DRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRKIYDFDGKLIAPKRPEWASLEEKKELCYVQHSLNVDKEDTKQLSQP---KETSRSPKS--HEIQDMEACEVERMETEVIDSA 788
            +G    P +W D   +G  +    F+ FK PL + F+ ++ P   FS         +++E++G+I++LT T++YY   +L   + Y +IF  GH+  PD + + KF    + F   ++  DK+IGVHCTHG NRTG+++  +L +   +  D A+ELF + R   + RQ+Y++ L+           P R  W S   +          + D ED+  L QP   K   + P+   H+IQ   A      +T+ +  +
Sbjct:   73 KGGNHIPERWKDYLPVGQRMPGTRFIAFKVPLQKSFEKKLAPEECFSPLDLFNKIREQNEELGLIIDLTYTQRYYKPEDLPETVPYLKIFTVGHQV-PDDETIFKFKHAVNGFLKENKDNDKLIGVHCTHGLNRTGYLICRYLIDVEGVRPDDAIELFNRCRGHCLERQNYIEDLQN---------GPIRKNWNSSVPR----------SSDFEDSAHLMQPVHNKPVKQGPRYNLHQIQGHSAPRHFHTQTQSLQQS 310          
BLAST of mRNA-capping enzyme vs. Ensembl Human
Match: DUSP11 (dual specificity phosphatase 11 [Source:HGNC Symbol;Acc:HGNC:3066])

HSP 1 Score: 82.8037 bits (203), Expect = 7.565e-17
Identity = 47/139 (33.81%), Postives = 79/139 (56.83%), Query Frame = 3
Query:   45 RGNFDPPSKWLDCPNIGTII-HDMFVPFKTPLDQKFDPEIPPANRFSLTSFLA--SKKSEKVGMIVNLTNTKKYYNVNELDGIIRYDQIFLEGHETYPDQKQVDKFIVICSYFF--DRFGDKVIGVHCTHGYNRTGFMV 446
            +G    P +W D   +G  +    F+ FK PL + F+ ++ P   FS         +++E++G+I++LT T++YY   +L   + Y +IF  GH+  PD + + KF    + F   ++  DK+IGVHCTHG NRTG+++
Sbjct:   73 KGGNHIPERWKDYLPVGQRMPGTRFIAFKVPLQKSFEKKLAPEECFSPLDLFNKIREQNEELGLIIDLTYTQRYYKPEDLPETVPYLKIFTVGHQV-PDDETIFKFKHAVNGFLKENKDNDKLIGVHCTHGLNRTGYLI 210          
BLAST of mRNA-capping enzyme vs. Ensembl Celegans
Match: cel-1 (mRNA-capping enzyme Polynucleotide 5'-triphosphatase mRNA guanylyltransferase [Source:UniProtKB/Swiss-Prot;Acc:Q17607])

HSP 1 Score: 225.328 bits (573), Expect = 7.911e-65
Identity = 135/334 (40.42%), Postives = 196/334 (58.68%), Query Frame = 3
Query: 1017 FMEG-VSKVSAVLDVTEMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPMSPTEHHSNLILDGEMVIDIVKDIGF----PRFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEKRKFLPQDAKAQESFGIL---MKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIY----NKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
            FM+G +  V    D  +   ++  ++NL K NK GFPG QPVS++  N+ LL ++ Y+VSWK DG+RY+I +   D VY  DRDN VF +E L F           ++D E++ID V+  G     PR LI+DI+  NSVNV    F  R  +IK+EII+ R    +  + +    I+    KDF+D++ T KL+   F   + HE+DGLIFQP  K+  Y +G+    LKWKPP +NS+DF LK E   K+G  P ++G LFV    +PF  ++  +    +KY+NKI+EC          K+W+ +RERTDKS PN +  A N++E+++NPV
Sbjct:  238 FMDGLIRGVKVCEDEGKKSMLQAKIKNLCKYNKQGFPGLQPVSLSRGNINLLEQESYMVSWKADGMRYIIYINDGD-VYAFDRDNEVFEIENLDFVTKNGAPLMETLVDTEVIIDKVEINGAMCDQPRMLIYDIMRFNSVNVMKEPFYKRFEIIKTEIIDMRTAAFKTGRLKHENQIMSVRRKDFYDLEATAKLFGPKFVQHVGHEIDGLIFQP--KKTKYETGRCDKVLKWKPPSHNSVDFLLKVEKKCKEGMLPEWIGYLFVQNLSDPFGTMK--ATATLKKYHNKIIECTLLVDNQGRPKEWKFMRERTDKSLPNGLRTAENVVETMVNPV 566          

HSP 2 Score: 147.132 bits (370), Expect = 3.428e-37
Identity = 76/194 (39.18%), Postives = 117/194 (60.31%), Query Frame = 3
Query:   63 PSKWLDCPNIGTIIHDMFVPFKTPLDQKFDPEIP-------PANRFSLTSFLASKKSEKVGMIVNLTNTKKYY---NVNELDGIIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRKIYD--FDGKLIAPKRPEW 608
            P +WL CP  GT+I+++F PFKTPL + +D +I        PA  FS          +K+G+ ++LTNT +YY    V E + I  Y ++ + G    P Q+  D FI +   F  ++ D+V+GVHCTHG+NRTGF++ ++L +  +  LD A+  FA+ R  GI++QDY+D L   YD   D K++AP++P+W
Sbjct:    4 PDRWLHCPKTGTLINNLFFPFKTPLCKMYDNQIAERRYQFHPAEVFSHPHL----HGKKIGLWIDLTNTDRYYFREEVTEHECI--YHKMKMAGRGVSPTQEDTDNFIKLVQEFHKKYPDRVVGVHCTHGFNRTGFLIAAYLFQVEEYGLDAAIGEFAENRQKGIYKQDYIDDLFARYDPTEDDKILAPEKPDW 191          
BLAST of mRNA-capping enzyme vs. Ensembl Celegans
Match: cel-1 (mRNA-capping enzyme Polynucleotide 5'-triphosphatase mRNA guanylyltransferase [Source:UniProtKB/Swiss-Prot;Acc:Q17607])

HSP 1 Score: 226.098 bits (575), Expect = 9.762e-65
Identity = 135/334 (40.42%), Postives = 196/334 (58.68%), Query Frame = 3
Query: 1017 FMEG-VSKVSAVLDVTEMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPMSPTEHHSNLILDGEMVIDIVKDIGF----PRFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEKRKFLPQDAKAQESFGIL---MKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIY----NKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
            FM+G +  V    D  +   ++  ++NL K NK GFPG QPVS++  N+ LL ++ Y+VSWK DG+RY+I +   D VY  DRDN VF +E L F           ++D E++ID V+  G     PR LI+DI+  NSVNV    F  R  +IK+EII+ R    +  + +    I+    KDF+D++ T KL+   F   + HE+DGLIFQP  K+  Y +G+    LKWKPP +NS+DF LK E   K+G  P ++G LFV    +PF  ++  +    +KY+NKI+EC          K+W+ +RERTDKS PN +  A N++E+++NPV
Sbjct:  250 FMDGLIRGVKVCEDEGKKSMLQAKIKNLCKYNKQGFPGLQPVSLSRGNINLLEQESYMVSWKADGMRYIIYINDGD-VYAFDRDNEVFEIENLDFVTKNGAPLMETLVDTEVIIDKVEINGAMCDQPRMLIYDIMRFNSVNVMKEPFYKRFEIIKTEIIDMRTAAFKTGRLKHENQIMSVRRKDFYDLEATAKLFGPKFVQHVGHEIDGLIFQP--KKTKYETGRCDKVLKWKPPSHNSVDFLLKVEKKCKEGMLPEWIGYLFVQNLSDPFGTMKATA--TLKKYHNKIIECTLLVDNQGRPKEWKFMRERTDKSLPNGLRTAENVVETMVNPV 578          

HSP 2 Score: 147.902 bits (372), Expect = 3.706e-37
Identity = 76/194 (39.18%), Postives = 117/194 (60.31%), Query Frame = 3
Query:   63 PSKWLDCPNIGTIIHDMFVPFKTPLDQKFDPEIP-------PANRFSLTSFLASKKSEKVGMIVNLTNTKKYY---NVNELDGIIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRKIYD--FDGKLIAPKRPEW 608
            P +WL CP  GT+I+++F PFKTPL + +D +I        PA  FS          +K+G+ ++LTNT +YY    V E + I  Y ++ + G    P Q+  D FI +   F  ++ D+V+GVHCTHG+NRTGF++ ++L +  +  LD A+  FA+ R  GI++QDY+D L   YD   D K++AP++P+W
Sbjct:   16 PDRWLHCPKTGTLINNLFFPFKTPLCKMYDNQIAERRYQFHPAEVFSHPHL----HGKKIGLWIDLTNTDRYYFREEVTEHECI--YHKMKMAGRGVSPTQEDTDNFIKLVQEFHKKYPDRVVGVHCTHGFNRTGFLIAAYLFQVEEYGLDAAIGEFAENRQKGIYKQDYIDDLFARYDPTEDDKILAPEKPDW 203          
BLAST of mRNA-capping enzyme vs. Ensembl Celegans
Match: cel-1 (mRNA-capping enzyme Polynucleotide 5'-triphosphatase mRNA guanylyltransferase [Source:UniProtKB/Swiss-Prot;Acc:Q17607])

HSP 1 Score: 226.098 bits (575), Expect = 9.762e-65
Identity = 135/334 (40.42%), Postives = 196/334 (58.68%), Query Frame = 3
Query: 1017 FMEG-VSKVSAVLDVTEMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPMSPTEHHSNLILDGEMVIDIVKDIGF----PRFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEKRKFLPQDAKAQESFGIL---MKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIY----NKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
            FM+G +  V    D  +   ++  ++NL K NK GFPG QPVS++  N+ LL ++ Y+VSWK DG+RY+I +   D VY  DRDN VF +E L F           ++D E++ID V+  G     PR LI+DI+  NSVNV    F  R  +IK+EII+ R    +  + +    I+    KDF+D++ T KL+   F   + HE+DGLIFQP  K+  Y +G+    LKWKPP +NS+DF LK E   K+G  P ++G LFV    +PF  ++  +    +KY+NKI+EC          K+W+ +RERTDKS PN +  A N++E+++NPV
Sbjct:  250 FMDGLIRGVKVCEDEGKKSMLQAKIKNLCKYNKQGFPGLQPVSLSRGNINLLEQESYMVSWKADGMRYIIYINDGD-VYAFDRDNEVFEIENLDFVTKNGAPLMETLVDTEVIIDKVEINGAMCDQPRMLIYDIMRFNSVNVMKEPFYKRFEIIKTEIIDMRTAAFKTGRLKHENQIMSVRRKDFYDLEATAKLFGPKFVQHVGHEIDGLIFQP--KKTKYETGRCDKVLKWKPPSHNSVDFLLKVEKKCKEGMLPEWIGYLFVQNLSDPFGTMKATA--TLKKYHNKIIECTLLVDNQGRPKEWKFMRERTDKSLPNGLRTAENVVETMVNPV 578          

HSP 2 Score: 147.902 bits (372), Expect = 3.706e-37
Identity = 76/194 (39.18%), Postives = 117/194 (60.31%), Query Frame = 3
Query:   63 PSKWLDCPNIGTIIHDMFVPFKTPLDQKFDPEIP-------PANRFSLTSFLASKKSEKVGMIVNLTNTKKYY---NVNELDGIIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRKIYD--FDGKLIAPKRPEW 608
            P +WL CP  GT+I+++F PFKTPL + +D +I        PA  FS          +K+G+ ++LTNT +YY    V E + I  Y ++ + G    P Q+  D FI +   F  ++ D+V+GVHCTHG+NRTGF++ ++L +  +  LD A+  FA+ R  GI++QDY+D L   YD   D K++AP++P+W
Sbjct:   16 PDRWLHCPKTGTLINNLFFPFKTPLCKMYDNQIAERRYQFHPAEVFSHPHL----HGKKIGLWIDLTNTDRYYFREEVTEHECI--YHKMKMAGRGVSPTQEDTDNFIKLVQEFHKKYPDRVVGVHCTHGFNRTGFLIAAYLFQVEEYGLDAAIGEFAENRQKGIYKQDYIDDLFARYDPTEDDKILAPEKPDW 203          
BLAST of mRNA-capping enzyme vs. Ensembl Celegans
Match: pir-1 (RNA/RNP complex-1-interacting phosphatase homolog [Source:UniProtKB/Swiss-Prot;Acc:Q22707])

HSP 1 Score: 90.1225 bits (222), Expect = 4.546e-20
Identity = 55/168 (32.74%), Postives = 91/168 (54.17%), Query Frame = 3
Query:   63 PSKWLDCPNIGTIIHDM-FVPFKTPLDQKF--DPEIPPANRFSLTSF--LASKKSEKVGMIVNLTNTKKYYNVNEL-DGIIRYDQIFLEGHETYPDQKQVDKFI-VICSYFFDRFGD-KVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDY 542
            P +W    N+G  I    FVPFKTPLD  F     +P   +F + +   LA + ++++G++++LTNT +YY   E  D  ++Y ++   GHE    +  V  FI  +  +  D+  D K+IGVHCTHG NRTG+++  ++ +  +     A+ +F   R   + R+ Y
Sbjct:   26 PDRWNIYDNVGRDIDGTRFVPFKTPLDSSFFDGKNMPVELQFGVKTLISLAQQANKQIGLVIDLTNTDRYYKKTEWADHGVKYLKLNCPGHEVNEREDLVQDFINAVKEFVNDKENDGKLIGVHCTHGLNRTGYLICRYMIDVDNYSASDAISMFEYYRGHPMEREHY 193          
BLAST of mRNA-capping enzyme vs. Ensembl Celegans
Match: F54C8.4 (Probable tyrosine-protein phosphatase F54C8.4 [Source:UniProtKB/Swiss-Prot;Acc:P34442])

HSP 1 Score: 82.4185 bits (202), Expect = 1.311e-16
Identity = 46/172 (26.74%), Postives = 89/172 (51.74%), Query Frame = 3
Query:   63 PSKWLDCPNIGTII-HDMFVPFKTPLDQKFDPEIPPANRFSLTSFLA--SKKSEKVGMIVNLTNTKKYYNVNELDGI-IRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGD--KVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRK 560
            P  W     +G +I    F+ FKTP++ +   +I    RF+        S++ + +G++V+L++T +YY+  ++ G+ ++Y+++   G         V+ F  +   + D+  D   +IGVHCT+G NR G+++  FL ++       A++ F +AR   I +  Y+  L K
Sbjct:    9 PKDWSKFQPVGNVIPRTRFIVFKTPINSQLSTKIHKEQRFTTNDLFRQLSERGQYLGLVVDLSDTDRYYDKKDITGMCVQYEKVNCPGRGFIERDDCVESFHQVIQDYTDKCDDPDALIGVHCTNGINRCGYLICRFLIDRLGWSSHEAIDAFEQARGYSIEKGAYVMALHK 180          
BLAST of mRNA-capping enzyme vs. Ensembl Fly
Match: mRNA-cap (gene:FBgn0030556 transcript:FBtr0073922)

HSP 1 Score: 344.739 bits (883), Expect = 5.812e-109
Identity = 224/657 (34.09%), Postives = 339/657 (51.60%), Query Frame = 3
Query:   45 RGNFDPPSKWLDCPNIG-TIIHDMFVPFKTPLDQKFDPEIPPANRFSLTSFLASKKSEKV--GMIVNLTNTKKYYNVNELDGI-IRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRKIY-DFDGKLIAPKRPEWASLEEKKELCYVQHSLNVDKEDTKQLSQPKETSRSPKSHEIQDMEACEVERMETEVIDSASNLTEFKITSLPEKQIEIPQSCIIEKVVAAKPSIIEKIEDIGKNIISSVTSALSEQSVKIVSIPPSATFCPPKVPKFMEGVSKVSAVLDVTEMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPMSP--TEHHSNLILDGEMVIDIVKDIGFPRFLIFDIVCINSVNVGIFNF-PHRLFLIKSEIIEKRKFLPQDA---KAQESFGILMKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIYNKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
            RG+   P++WL CP    TII + F+ FKTPL   F  ++P    F         K+ KV  G+ V+LTNTK++Y+ + ++ +  +Y ++   GH   P  +Q   FI I   F +     VI VHCTHG+NRTGF++V +L E+ D  +  A+ +FA ARPPGI++QDY++ L K Y D +    AP++P W               L+ D  +     Q   +S S ++ E QD +A EVE                                                ED G +  +S +     +  +   I  +ATF        M GV  V  V D   + ++++ V++     K GFPG QPVSM  EN+K L++  Y VSWK DG RYM+++ G D VY  DR++  F+VE + F  S    EH    ++DGEMV+D + +   PR+LI+DIV +++ +V    F P+RL  IK+E+I  R    +     +  ++F +  KDFWDI  + +L    F   L HE DGLIFQP+++   Y +G      KWKP E NS+DF LK    + +G   + VG L+V G   P+ +++ +++E RE  +N+I+EC  N+    W+ +RERTDK +PN    A ++++SI +PV
Sbjct:   10 RGSGPLPNRWLYCPRKSDTIIAERFLAFKTPLSNNFHDKMPIECTFQPEMLFEYCKTLKVKLGLWVDLTNTKRFYDRSAVEELGAKYIKLQCRGHGETPSPEQTHSFIEIVDNFINERPFDVIAVHCTHGFNRTGFLIVCYLVERLDCSVSAALAIFASARPPGIYKQDYINELYKRYEDTNAAPAAPEQPNWC--------------LDYDDGNGDGFVQDNSSSTSQQAGE-QDDDAEEVEG-----------------------------------------------EDAGGDCDASTSDGQPRKKRRREMIIKNATF--------MAGVPGVRQVSDQPRLGDLQRKVQDWCDWKKNGFPGAQPVSMDRENIKRLSEIPYRVSWKADGTRYMMLIDGRDEVYFFDRNHSCFQVENVTFVESRNLNEHLDGTLVDGEMVLDKIGETVTPRYLIYDIVRLSNRDVRDEPFYPNRLDYIKTEVIGPRILGMKHGIINQRLQAFSVRGKDFWDIWMSARLLGEKFSRTLAHEPDGLIFQPSKQP--YTAGTCSDVFKWKPHELNSVDFRLKIITERGEGLLTKKVGFLYVGGHDAPYGRMQRLTKETRE-LDNRIVECTMNQFG-NWDFMRERTDKKNPNSYNTARSVVDSIKHPV 592          
BLAST of mRNA-capping enzyme vs. Ensembl Fly
Match: CG13197 (gene:FBgn0062449 transcript:FBtr0088078)

HSP 1 Score: 93.5893 bits (231), Expect = 2.733e-20
Identity = 54/173 (31.21%), Postives = 95/173 (54.91%), Query Frame = 3
Query:   57 DPPSKWLDCPNIGTII-HDMFVPFKTPLDQKFDPEIPPANRFSLTSFLASKKSEKVGMIVNLTNTKKYYNVNEL-DGIIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGD--KVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRKI 563
            D P +WL    IG  +    F+ FK PL+Q  + ++    R +  S L  +    +G+I++LTNT +YY+ + + +  + + ++ + G +T P  K   +F    + F +R  D  K+IGVHCTHG NRTG+++  F+    ++  + A++ F+ AR   I R +YL  L+ +
Sbjct:    4 DIPDRWLKYKPIGDRVPGTRFIAFKVPLNQHVNAKVKENLRLAPESLL--QIVPDMGLIIDLTNTNRYYHPSAITNHDVLHQKLMIPGKQT-PSHKLAQRFCAFVTDFLERNADNDKLIGVHCTHGVNRTGYLICYFMISVMNMSPEEAIQTFSLARGHEIERDNYLSSLKTL 173          
BLAST of mRNA-capping enzyme vs. Ensembl Fly
Match: CG13197 (gene:FBgn0062449 transcript:FBtr0345619)

HSP 1 Score: 93.5893 bits (231), Expect = 2.733e-20
Identity = 54/173 (31.21%), Postives = 95/173 (54.91%), Query Frame = 3
Query:   57 DPPSKWLDCPNIGTII-HDMFVPFKTPLDQKFDPEIPPANRFSLTSFLASKKSEKVGMIVNLTNTKKYYNVNEL-DGIIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGD--KVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRKI 563
            D P +WL    IG  +    F+ FK PL+Q  + ++    R +  S L  +    +G+I++LTNT +YY+ + + +  + + ++ + G +T P  K   +F    + F +R  D  K+IGVHCTHG NRTG+++  F+    ++  + A++ F+ AR   I R +YL  L+ +
Sbjct:    4 DIPDRWLKYKPIGDRVPGTRFIAFKVPLNQHVNAKVKENLRLAPESLL--QIVPDMGLIIDLTNTNRYYHPSAITNHDVLHQKLMIPGKQT-PSHKLAQRFCAFVTDFLERNADNDKLIGVHCTHGVNRTGYLICYFMISVMNMSPEEAIQTFSLARGHEIERDNYLSSLKTL 173          
BLAST of mRNA-capping enzyme vs. Ensembl Zebrafish
Match: rngtt (RNA guanylyltransferase and 5'-phosphatase [Source:NCBI gene;Acc:405803])

HSP 1 Score: 241.121 bits (614), Expect = 3.271e-70
Identity = 138/329 (41.95%), Postives = 195/329 (59.27%), Query Frame = 3
Query: 1017 FMEGVS--KVSAVLDVTEMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPMSPTE--HHSNLILDGEMVIDIVKDIGFPRFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEKR---KFLPQDAKAQESFGILMKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIYNKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
            F+EGVS   VS V    ++  +++  +   + ++ GFPG QPVSM  +N+++L +  Y VSWK DG RYM+++ G + VYM+DRDN VF +E L FP       H SN +LDGEM+ID V     PR+LI+DI+  +   VG  +F  RL  I+ EII  R     L Q  KA+E F +  K F+DI    KL +G F  ++ HE+DGLIFQP  K   Y  G+    LKWKPP +NS+DF LK   V  +G  P+ VG L+V     PFA+++    +D ++Y+NKI+EC +  ++  W  +R+R DKS PN    A  +  SI +PV
Sbjct:  236 FLEGVSVKGVSQVTTQPKLGEIQRKCQQFSEWDRSGFPGAQPVSMDRKNIRMLEQNGYKVSWKADGTRYMMLIDGRNEVYMIDRDNSVFHIENLEFPFRKDLRIHLSNTLLDGEMIIDKVNGQPVPRYLIYDIIKFSGQPVGQCDFNRRLLCIEKEIISPRFEKMKLGQIDKAKEPFSVRNKPFFDIHAARKLLEGSFTSQVSHEVDGLIFQPIGK---YKPGRCDDILKWKPPSHNSVDFRLKITKVGGEGLIPQTVGLLYVGNYDMPFAQMKIT--KDLKQYDNKIIECTF--VNNTWVFMRQRVDKSFPNAYDTAMAVCNSIQHPV 557          

HSP 2 Score: 140.198 bits (352), Expect = 1.885e-34
Identity = 74/188 (39.36%), Postives = 119/188 (63.30%), Query Frame = 3
Query:   63 PSKWLDCPNIGTIIHDMFVPFKTPLDQKFDPEIPPANRFS---LTSFLASKKSEKVGMIVNLTNTKKYYNVNELDG-IIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGL-RKIYDFDGKLIAPKRPEWA 611
            P +W +CP  G  +   F+P KT L  ++D ++P  NRF    L+++L S K  K+G++V+LTNT ++Y+  +++   I+Y ++  +GH   P  +  + FI +C +F ++   ++IGVHCTHG+NRTGF++ ++L EK D  ++ AV  FA+ARPPGI++ DYL  L R+  D +    AP  PEW 
Sbjct:    7 PPRWRNCPRRGQPVAGKFLPMKTMLGPRYDDKVPEENRFHPSMLSNYLKSLKV-KMGLLVDLTNTTRFYDRADIEKEGIKYVKLSCKGHGECPTAETTEMFIRLCEHFIEKTPTELIGVHCTHGFNRTGFLICAYLVEKMDWSIEAAVAAFAQARPPGIYKGDYLKELFRRYGDVEDAPAAPPLPEWC 193          
BLAST of mRNA-capping enzyme vs. Ensembl Zebrafish
Match: dusp11 (dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) [Source:ZFIN;Acc:ZDB-GENE-050417-226])

HSP 1 Score: 97.4413 bits (241), Expect = 1.512e-21
Identity = 57/169 (33.73%), Postives = 89/169 (52.66%), Query Frame = 3
Query:   63 PSKWLDCPNIGTII-HDMFVPFKTPLDQKFDPEIPPANRFSLTSF--LASKKSEKVGMIVNLTNTKKYYNVNELDGIIRYDQIFLEGHETYPDQKQVDKFIVICSYFF--DRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGL 554
            P +W D  ++G  I    F+ FK PL Q F   +  +  F       L  K+ +++G+I++LT T +YY   +L   + Y +IF  GHE  P+   +  F     +F   +   DK+IGVHCTHG NRTG+++  +L +   +    A+ LF ++R   I RQ+YL  L
Sbjct:   10 PDRWTDYTSLGKRIPGTRFIAFKVPLKQSFRRHLSESEVFGPFDLVRLLEKERQQLGLIIDLTFTTRYYRAEDLPDTLYYMKIFTAGHEV-PNDATILSFKKAVRHFLHDNASNDKLIGVHCTHGLNRTGYLICRYLIDVDGMMPQKAINLFNESRGHSIERQNYLQDL 177          
BLAST of mRNA-capping enzyme vs. Ensembl Xenopus
Match: mgc147600 (RAS and EF-hand domain containing [Source:Xenbase;Acc:XB-GENE-1002559])

HSP 1 Score: 180.644 bits (457), Expect = 2.436e-48
Identity = 124/333 (37.24%), Postives = 175/333 (52.55%), Query Frame = 3
Query: 1017 FMEGVS--KVSAVLDVTEMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPMSPTEHHS--NLILDG----EMVIDIVKDIGFPRFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEKRKFLPQDA---KAQESFGILMKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIYNKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
            F+EGV+   V+ +    ++  +++  +        GFPG QPVSM   N+K L +K Y VSWKP    YM ++           +N+    E  +FP +   HHS  N  L+     EM+ID V     PR+LI+DI+  N   VG  +F  RL  I+ EII  R    +     KA+E F +  K F+DI    KL +G F  ++ HE+DGLIFQP  K   Y +G+    LKWKPP  NS+DF LK   V  +G   R VG L+V     PF++I+    +D ++Y NKI+EC +   + +W  +R+R DKS PN    A  +  SI NPV
Sbjct:  233 FLEGVTVKHVNQITTEPKLGEIQRKCQQFCSWRGSGFPGAQPVSMDRSNMKFLEQKAYKVSWKP----YMPLL----------SENYC--SENYHFPANWRLHHSRANTYLNKSHCKEMIIDKVNGQVVPRYLIYDIIKFNGQPVGDCDFNIRLSCIEKEIISPRHEKMKTGLIDKAKEPFSVRNKPFFDIHAARKLLEGSFAREVSHEVDGLIFQPIGK---YKAGRCDDILKWKPPNLNSVDFLLKITKVGGEGLLTRNVGLLYVGKYDCPFSEIK--VTKDLKQYENKIIECKFE--NNRWVFMRQRVDKSFPNSYDTALAVCNSIRNPV 542          

HSP 2 Score: 161.77 bits (408), Expect = 1.214e-41
Identity = 81/192 (42.19%), Postives = 122/192 (63.54%), Query Frame = 3
Query:   63 PSKWLDCPNIGTIIHDMFVPFKTPLDQKFDPEIPPANRFS---LTSFLASKKSEKVGMIVNLTNTKKYYNVNELDG-IIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRKIY-DFDGKLIAPKRPEWASLEE 623
            P +WL+CP  G  +   F+P KT L  K+D ++P  NRF    L+++L S K  K+G++V+LTNT ++Y+ N+++   I+Y ++  +GH   P Q+  D F+ +C  F DR   ++IGVHCTHG+NRTGF++ +FL EK D  ++ AV  FA+ARPPGI++ DYL  L   Y D +     P+ P+W   EE
Sbjct:    7 PPRWLNCPRRGQPVAAKFLPLKTMLGPKYDDQVPEENRFHPSMLSNYLKSLKV-KMGLLVDLTNTTRFYDRNDIEKEGIKYIKLQCKGHGECPSQENTDTFLRLCERFIDRNPTELIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKADYLKELFHRYGDIEDAPKPPELPDWCFEEE 197          
BLAST of mRNA-capping enzyme vs. Ensembl Xenopus
Match: mgc147600 (RAS and EF-hand domain containing [Source:Xenbase;Acc:XB-GENE-1002559])

HSP 1 Score: 175.637 bits (444), Expect = 1.417e-46
Identity = 121/327 (37.00%), Postives = 170/327 (51.99%), Query Frame = 3
Query: 1017 FMEGVS--KVSAVLDVTEMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPMSPTEHHSNLILDGEMVIDIVKDIGFPRFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEKRKFLPQDA---KAQESFGILMKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIYNKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
            F+EGV+   V+ +    ++  +++  +        GFPG QPVSM   N+K L +K Y VSWK D     +  I S   Y+ +R    F V       +P       +  GEM+ID V     PR+LI+DI+  N   VG  +F  RL  I+ EII  R    +     KA+E F +  K F+DI    KL +G F  ++ HE+DGLIFQP  K   Y +G+    LKWKPP  NS+DF LK   V  +G   R VG L+V     PF++I+    +D ++Y NKI+EC +   + +W  +R+R DKS PN    A  +  SI NPV
Sbjct:  233 FLEGVTVKHVNQITTEPKLGEIQRKCQQFCSWRGSGFPGAQPVSMDRSNMKFLEQKAYKVSWKADD--KALSWISS---YLYNRS---FSVSHSASTSTPQP-----LSVGEMIIDKVNGQVVPRYLIYDIIKFNGQPVGDCDFNIRLSCIEKEIISPRHEKMKTGLIDKAKEPFSVRNKPFFDIHAARKLLEGSFAREVSHEVDGLIFQPIGK---YKAGRCDDILKWKPPNLNSVDFLLKITKVGGEGLLTRNVGLLYVGKYDCPFSEIK--VTKDLKQYENKIIECKFE--NNRWVFMRQRVDKSFPNSYDTALAVCNSIRNPV 539          

HSP 2 Score: 161.77 bits (408), Expect = 1.104e-41
Identity = 81/192 (42.19%), Postives = 122/192 (63.54%), Query Frame = 3
Query:   63 PSKWLDCPNIGTIIHDMFVPFKTPLDQKFDPEIPPANRFS---LTSFLASKKSEKVGMIVNLTNTKKYYNVNELDG-IIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRKIY-DFDGKLIAPKRPEWASLEE 623
            P +WL+CP  G  +   F+P KT L  K+D ++P  NRF    L+++L S K  K+G++V+LTNT ++Y+ N+++   I+Y ++  +GH   P Q+  D F+ +C  F DR   ++IGVHCTHG+NRTGF++ +FL EK D  ++ AV  FA+ARPPGI++ DYL  L   Y D +     P+ P+W   EE
Sbjct:    7 PPRWLNCPRRGQPVAAKFLPLKTMLGPKYDDQVPEENRFHPSMLSNYLKSLKV-KMGLLVDLTNTTRFYDRNDIEKEGIKYIKLQCKGHGECPSQENTDTFLRLCERFIDRNPTELIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKADYLKELFHRYGDIEDAPKPPELPDWCFEEE 197          
BLAST of mRNA-capping enzyme vs. Ensembl Xenopus
Match: mgc147600 (RAS and EF-hand domain containing [Source:Xenbase;Acc:XB-GENE-1002559])

HSP 1 Score: 171.014 bits (432), Expect = 3.218e-45
Identity = 117/327 (35.78%), Postives = 161/327 (49.24%), Query Frame = 3
Query: 1017 FMEGVS--KVSAVLDVTEMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPMSPTEHHSNLILDGEMVIDIVKDIGFPRFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEKRKFLPQDA---KAQESFGILMKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIYNKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
            F+EGV+   V+ +    ++  +++  +        GFPG QPVSM   N+K L +K Y VSWK DG R              D  N                         EM+ID V     PR+LI+DI+  N   VG  +F  RL  I+ EII  R    +     KA+E F +  K F+DI    KL +G F  ++ HE+DGLIFQP  K   Y +G+    LKWKPP  NS+DF LK   V  +G   R VG L+V     PF++I+    +D ++Y NKI+EC +   + +W  +R+R DKS PN    A  +  SI NPV
Sbjct:  213 FLEGVTVKHVNQITTEPKLGEIQRKCQQFCSWRGSGFPGAQPVSMDRSNMKFLEQKAYKVSWKADGTR--------------DGKNQSL----------------------EMIIDKVNGQVVPRYLIYDIIKFNGQPVGDCDFNIRLSCIEKEIISPRHEKMKTGLIDKAKEPFSVRNKPFFDIHAARKLLEGSFAREVSHEVDGLIFQPIGK---YKAGRCDDILKWKPPNLNSVDFLLKITKVGGEGLLTRNVGLLYVGKYDCPFSEIK--VTKDLKQYENKIIECKFE--NNRWVFMRQRVDKSFPNSYDTALAVCNSIRNPV 496          

HSP 2 Score: 145.976 bits (367), Expect = 1.773e-36
Identity = 75/175 (42.86%), Postives = 113/175 (64.57%), Query Frame = 3
Query:  114 FVPFKTPLDQKFDPEIPPANRFS---LTSFLASKKSEKVGMIVNLTNTKKYYNVNELDG-IIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRKIY-DFDGKLIAPKRPEWASLEE 623
            F+P KT L  K+D ++P  NRF    L+++L S K  K+G++V+LTNT ++Y+ N+++   I+Y ++  +GH   P Q+  D F+ +C  F DR   ++IGVHCTHG+NRTGF++ +FL EK D  ++ AV  FA+ARPPGI++ DYL  L   Y D +     P+ P+W   EE
Sbjct:    4 FLPLKTMLGPKYDDQVPEENRFHPSMLSNYLKSLKV-KMGLLVDLTNTTRFYDRNDIEKEGIKYIKLQCKGHGECPSQENTDTFLRLCERFIDRNPTELIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKADYLKELFHRYGDIEDAPKPPELPDWCFEEE 177          
BLAST of mRNA-capping enzyme vs. Ensembl Xenopus
Match: mgc147600 (RAS and EF-hand domain containing [Source:Xenbase;Acc:XB-GENE-1002559])

HSP 1 Score: 171.014 bits (432), Expect = 4.532e-45
Identity = 117/327 (35.78%), Postives = 161/327 (49.24%), Query Frame = 3
Query: 1017 FMEGVS--KVSAVLDVTEMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPMSPTEHHSNLILDGEMVIDIVKDIGFPRFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEKRKFLPQDA---KAQESFGILMKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIYNKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
            F+EGV+   V+ +    ++  +++  +        GFPG QPVSM   N+K L +K Y VSWK DG R              D  N                         EM+ID V     PR+LI+DI+  N   VG  +F  RL  I+ EII  R    +     KA+E F +  K F+DI    KL +G F  ++ HE+DGLIFQP  K   Y +G+    LKWKPP  NS+DF LK   V  +G   R VG L+V     PF++I+    +D ++Y NKI+EC +   + +W  +R+R DKS PN    A  +  SI NPV
Sbjct:  233 FLEGVTVKHVNQITTEPKLGEIQRKCQQFCSWRGSGFPGAQPVSMDRSNMKFLEQKAYKVSWKADGTR--------------DGKNQSL----------------------EMIIDKVNGQVVPRYLIYDIIKFNGQPVGDCDFNIRLSCIEKEIISPRHEKMKTGLIDKAKEPFSVRNKPFFDIHAARKLLEGSFAREVSHEVDGLIFQPIGK---YKAGRCDDILKWKPPNLNSVDFLLKITKVGGEGLLTRNVGLLYVGKYDCPFSEIK--VTKDLKQYENKIIECKFE--NNRWVFMRQRVDKSFPNSYDTALAVCNSIRNPV 516          

HSP 2 Score: 161.384 bits (407), Expect = 1.053e-41
Identity = 81/192 (42.19%), Postives = 122/192 (63.54%), Query Frame = 3
Query:   63 PSKWLDCPNIGTIIHDMFVPFKTPLDQKFDPEIPPANRFS---LTSFLASKKSEKVGMIVNLTNTKKYYNVNELDG-IIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRKIY-DFDGKLIAPKRPEWASLEE 623
            P +WL+CP  G  +   F+P KT L  K+D ++P  NRF    L+++L S K  K+G++V+LTNT ++Y+ N+++   I+Y ++  +GH   P Q+  D F+ +C  F DR   ++IGVHCTHG+NRTGF++ +FL EK D  ++ AV  FA+ARPPGI++ DYL  L   Y D +     P+ P+W   EE
Sbjct:    7 PPRWLNCPRRGQPVAAKFLPLKTMLGPKYDDQVPEENRFHPSMLSNYLKSLKV-KMGLLVDLTNTTRFYDRNDIEKEGIKYIKLQCKGHGECPSQENTDTFLRLCERFIDRNPTELIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKADYLKELFHRYGDIEDAPKPPELPDWCFEEE 197          
BLAST of mRNA-capping enzyme vs. Ensembl Xenopus
Match: mgc147600 (RAS and EF-hand domain containing [Source:Xenbase;Acc:XB-GENE-1002559])

HSP 1 Score: 169.088 bits (427), Expect = 2.514e-44
Identity = 116/327 (35.47%), Postives = 167/327 (51.07%), Query Frame = 3
Query: 1017 FMEGVS--KVSAVLDVTEMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPMSPTEHHSNLILDGEMVIDIVKDIGFPRFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEKRKFLPQDA---KAQESFGILMKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIYNKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
            F+EGV+   V+ +    ++  +++  +        GFPG QPVSM   N+K L +K Y VSWK D     ++V+             V R ++++                EM+ID V     PR+LI+DI+  N   VG  +F  RL  I+ EII  R    +     KA+E F +  K F+DI    KL +G F  ++ HE+DGLIFQP  K   Y +G+    LKWKPP  NS+DF LK   V  +G   R VG L+V     PF++I+    +D ++Y NKI+EC +   + +W  +R+R DKS PN    A  +  SI NPV
Sbjct:  233 FLEGVTVKHVNQITTEPKLGEIQRKCQQFCSWRGSGFPGAQPVSMDRSNMKFLEQKAYKVSWKAD-----VLVVS------------VPRWDKVF----------------EMIIDKVNGQVVPRYLIYDIIKFNGQPVGDCDFNIRLSCIEKEIISPRHEKMKTGLIDKAKEPFSVRNKPFFDIHAARKLLEGSFAREVSHEVDGLIFQPIGK---YKAGRCDDILKWKPPNLNSVDFLLKITKVGGEGLLTRNVGLLYVGKYDCPFSEIK--VTKDLKQYENKIIECKFE--NNRWVFMRQRVDKSFPNSYDTALAVCNSIRNPV 519          

HSP 2 Score: 160.999 bits (406), Expect = 1.463e-41
Identity = 81/192 (42.19%), Postives = 122/192 (63.54%), Query Frame = 3
Query:   63 PSKWLDCPNIGTIIHDMFVPFKTPLDQKFDPEIPPANRFS---LTSFLASKKSEKVGMIVNLTNTKKYYNVNELDG-IIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRKIY-DFDGKLIAPKRPEWASLEE 623
            P +WL+CP  G  +   F+P KT L  K+D ++P  NRF    L+++L S K  K+G++V+LTNT ++Y+ N+++   I+Y ++  +GH   P Q+  D F+ +C  F DR   ++IGVHCTHG+NRTGF++ +FL EK D  ++ AV  FA+ARPPGI++ DYL  L   Y D +     P+ P+W   EE
Sbjct:    7 PPRWLNCPRRGQPVAAKFLPLKTMLGPKYDDQVPEENRFHPSMLSNYLKSLKV-KMGLLVDLTNTTRFYDRNDIEKEGIKYIKLQCKGHGECPSQENTDTFLRLCERFIDRNPTELIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKADYLKELFHRYGDIEDAPKPPELPDWCFEEE 197          
BLAST of mRNA-capping enzyme vs. Ensembl Mouse
Match: Rngtt (RNA guanylyltransferase and 5'-phosphatase [Source:MGI Symbol;Acc:MGI:1329041])

HSP 1 Score: 242.662 bits (618), Expect = 8.368e-71
Identity = 143/330 (43.33%), Postives = 196/330 (59.39%), Query Frame = 3
Query: 1017 FMEGVSKVSAVLDVT---EMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPMSP--TEHHSNLILDGEMVIDIVKDIGFPRFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEKRKFLPQDA---KAQESFGILMKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIYNKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
            F+EG++ V  V  VT   ++  V+Q           GFPG QPVSM  +N++LL +K Y VSWK DG RYM+++ G++ V+M+DRDN VF V  L FP       H SN +LDGEM+ID V     PR+LI+DI+  N+  VG  +F  RL  I+ EII  R    +     K QE F +  K F+DI  + KL +G+F  ++ HEMDGLIFQP  K   Y  G+    LKWKPP  NS+DF LK   +  +G  P+ VG L+V G + PFA+I+ +++E ++ Y+NKI+EC +   S  W  +R+R DKS PN    A  +  SI NPV
Sbjct:  232 FLEGIT-VKGVTQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIRLLEQKPYKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDKVNGQAVPRYLIYDIIKFNAQPVGDCDFNIRLQCIEREIISPRHEKMKTGLIDKTQEPFSVRPKQFFDINISRKLLEGNFAKEVSHEMDGLIFQPIGK---YKPGRCDDILKWKPPSLNSVDFRLKITRMGGEGLLPQNVGLLYVGGYERPFAQIK-VTKELKQ-YDNKIIECKFENNS--WVFMRQRIDKSFPNAYNTAMAVCNSISNPV 553          

HSP 2 Score: 148.288 bits (373), Expect = 3.892e-37
Identity = 74/188 (39.36%), Postives = 117/188 (62.23%), Query Frame = 3
Query:   63 PSKWLDCPNIGTIIHDMFVPFKTPLDQKFDPEIPPANRFS---LTSFLASKKSEKVGMIVNLTNTKKYYNVNELDG-IIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGL-RKIYDFDGKLIAPKRPEWA 611
            P +WL+CP  G  +   F+P KT L  ++D ++   NRF    L+++L S K  K+ ++V+LTNT ++Y+ N+++   I+Y ++  +GH   P  +  + FI +C  F +R   ++IGVHCTHG+NRTGF++ +FL EK D  ++ AV  FA+ARPPGI++ DYL  L R+  D +     P  P+W 
Sbjct:    7 PPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSMLSNYLKSLKV-KMSLLVDLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNERSPPELIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKGDYLKELFRRYGDIEEAPPPPVLPDWC 193          
BLAST of mRNA-capping enzyme vs. Ensembl Mouse
Match: Rngtt (RNA guanylyltransferase and 5'-phosphatase [Source:MGI Symbol;Acc:MGI:1329041])

HSP 1 Score: 235.728 bits (600), Expect = 2.284e-68
Identity = 138/324 (42.59%), Postives = 193/324 (59.57%), Query Frame = 3
Query: 1017 FMEGVSKVSAVLDVT---EMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPMSP--TEHHSNLILDGEMVIDIVKDIGFPRFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEKRKFLPQDA---KAQESFGILMKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIYNKISKKWELIRERTDKSSPNYVTVANNIME 1964
            F+EG++ V  V  VT   ++  V+Q           GFPG QPVSM  +N++LL +K Y VSWK DG RYM+++ G++ V+M+DRDN VF V  L FP       H SN +LDGEM+ID V     PR+LI+DI+  N+  VG  +F  RL  I+ EII  R    +     K QE F +  K F+DI  + KL +G+F  ++ HEMDGLIFQP  K   Y  G+    LKWKPP  NS+DF LK   +  +G  P+ VG L+V G + PFA+I+ +++E ++ Y+NKI+EC +   S  W  +R+R DKS PN    A ++ +
Sbjct:  232 FLEGIT-VKGVTQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIRLLEQKPYKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDKVNGQAVPRYLIYDIIKFNAQPVGDCDFNIRLQCIEREIISPRHEKMKTGLIDKTQEPFSVRPKQFFDINISRKLLEGNFAKEVSHEMDGLIFQPIGK---YKPGRCDDILKWKPPSLNSVDFRLKITRMGGEGLLPQNVGLLYVGGYERPFAQIK-VTKELKQ-YDNKIIECKFENNS--WVFMRQRIDKSFPNAYNTAMDVQQ 547          

HSP 2 Score: 148.288 bits (373), Expect = 3.182e-37
Identity = 74/188 (39.36%), Postives = 117/188 (62.23%), Query Frame = 3
Query:   63 PSKWLDCPNIGTIIHDMFVPFKTPLDQKFDPEIPPANRFS---LTSFLASKKSEKVGMIVNLTNTKKYYNVNELDG-IIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGL-RKIYDFDGKLIAPKRPEWA 611
            P +WL+CP  G  +   F+P KT L  ++D ++   NRF    L+++L S K  K+ ++V+LTNT ++Y+ N+++   I+Y ++  +GH   P  +  + FI +C  F +R   ++IGVHCTHG+NRTGF++ +FL EK D  ++ AV  FA+ARPPGI++ DYL  L R+  D +     P  P+W 
Sbjct:    7 PPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSMLSNYLKSLKV-KMSLLVDLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNERSPPELIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKGDYLKELFRRYGDIEEAPPPPVLPDWC 193          
BLAST of mRNA-capping enzyme vs. Ensembl Mouse
Match: Dusp11 (dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) [Source:MGI Symbol;Acc:MGI:1919352])

HSP 1 Score: 107.842 bits (268), Expect = 4.132e-25
Identity = 61/171 (35.67%), Postives = 98/171 (57.31%), Query Frame = 3
Query:   63 PSKWLDCPNIGTII-HDMFVPFKTPLDQKFDPEIPPANRFSLTSFLA--SKKSEKVGMIVNLTNTKKYYNVNELDGIIRYDQIFLEGHETYPDQKQVDKFIVICSYFF--DRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRK 560
            P +W D   +G  +    F+ FK PL +KF+ ++ P   FS         +++E++G+I++LT T++YY V +L   I Y +IF  GH+  PD   + +F      F   ++  DK+IGVHCTHG NRTG+++  +L +   +  D A+ELF   R   I RQ+Y++ L+K
Sbjct:   31 PERWKDYLPVGQRMPGTRFIAFKVPLQKKFEAKLMPEECFSPLDLFNKIQEQNEELGLIIDLTYTQRYYKVEDLPETISYIKIFTVGHQI-PDNDTIFQFKCAVKEFLKKNKNNDKLIGVHCTHGLNRTGYLICRYLIDVEGMRPDDAIELFNSCRGHCIERQNYIENLQK 200          
BLAST of mRNA-capping enzyme vs. Ensembl Mouse
Match: Dusp11 (dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) [Source:MGI Symbol;Acc:MGI:1919352])

HSP 1 Score: 85.5001 bits (210), Expect = 3.506e-19
Identity = 45/117 (38.46%), Postives = 71/117 (60.68%), Query Frame = 3
Query:  114 FVPFKTPLDQKFDPEIPPANRFSLTSFLA--SKKSEKVGMIVNLTNTKKYYNVNELDGIIRYDQIFLEGHETYPDQKQVDKFIVICSYFF--DRFGDKVIGVHCTHGYNRTGFMVVS 452
            F+ FK PL +KF+ ++ P   FS         +++E++G+I++LT T++YY V +L   I Y +IF  GH+  PD   + +F      F   ++  DK+IGVHCTHG NRTG+++ S
Sbjct:   15 FIAFKVPLQKKFEAKLMPEECFSPLDLFNKIQEQNEELGLIIDLTYTQRYYKVEDLPETISYIKIFTVGHQI-PDNDTIFQFKCAVKEFLKKNKNNDKLIGVHCTHGLNRTGYLICS 130          
BLAST of mRNA-capping enzyme vs. UniProt/SwissProt
Match: sp|O60942|MCE1_HUMAN (mRNA-capping enzyme OS=Homo sapiens OX=9606 GN=RNGTT PE=1 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 8.423e-72
Identity = 148/330 (44.85%), Postives = 197/330 (59.70%), Query Frame = 3
Query: 1017 FMEGVSKVSAVLDVT---EMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPMSP--TEHHSNLILDGEMVIDIVKDIGFPRFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEKRKFLPQDA---KAQESFGILMKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIYNKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
            F+EGV+ V  V  VT   ++  V+Q           GFPG QPVSM  +N+KLL  K Y VSWK DG RYM+++ G++ V+M+DRDN VF V  L FP       H SN +LDGEM+ID V     PR+LI+DI+  NS  VG  +F  RL  I+ EII  R    +     K QE F +  K F+DI T+ KL +G+F  ++ HEMDGLIFQP  K   Y  G+    LKWKPP  NS+DF LK   +  +G  P+ VG L+V G + PFA+I+ +++E ++ Y+NKI+EC +   S  W  +R+RTDKS PN    A  +  SI NPV
Sbjct:  232 FLEGVT-VKGVTQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIKLLDLKPYKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDRVNGQAVPRYLIYDIIKFNSQPVGDCDFNVRLQCIEREIISPRHEKMKTGLIDKTQEPFSVRNKPFFDICTSRKLLEGNFAKEVSHEMDGLIFQPTGK---YKPGRCDDILKWKPPSLNSVDFRLKITRMGGEGLLPQNVGLLYVGGYERPFAQIK-VTKELKQ-YDNKIIECKFENNS--WVFMRQRTDKSFPNAYNTAMAVCNSISNPV 553          

HSP 2 Score: 147.517 bits (371), Expect = 4.221e-36
Identity = 71/172 (41.28%), Postives = 112/172 (65.12%), Query Frame = 3
Query:   63 PSKWLDCPNIGTIIHDMFVPFKTPLDQKFDPEIPPANRFS---LTSFLASKKSEKVGMIVNLTNTKKYYNVNELDG-IIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRKIY 566
            P +WL+CP  G  +   F+P KT L  ++D ++   NRF    L+++L S K  K+G++V+LTNT ++Y+ N+++   I+Y ++  +GH   P  +  + FI +C  F +R   ++IGVHCTHG+NRTGF++ +FL EK D  ++ AV  FA+ARPPGI++ DYL  L + Y
Sbjct:    7 PPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSMLSNYLKSLKV-KMGLLVDLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNERNPPELIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKGDYLKELFRRY 177          
BLAST of mRNA-capping enzyme vs. UniProt/SwissProt
Match: sp|O55236|MCE1_MOUSE (mRNA-capping enzyme OS=Mus musculus OX=10090 GN=Rngtt PE=1 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 5.853e-70
Identity = 143/330 (43.33%), Postives = 196/330 (59.39%), Query Frame = 3
Query: 1017 FMEGVSKVSAVLDVT---EMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPMSP--TEHHSNLILDGEMVIDIVKDIGFPRFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEKRKFLPQDA---KAQESFGILMKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIYNKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
            F+EG++ V  V  VT   ++  V+Q           GFPG QPVSM  +N++LL +K Y VSWK DG RYM+++ G++ V+M+DRDN VF V  L FP       H SN +LDGEM+ID V     PR+LI+DI+  N+  VG  +F  RL  I+ EII  R    +     K QE F +  K F+DI  + KL +G+F  ++ HEMDGLIFQP  K   Y  G+    LKWKPP  NS+DF LK   +  +G  P+ VG L+V G + PFA+I+ +++E ++ Y+NKI+EC +   S  W  +R+R DKS PN    A  +  SI NPV
Sbjct:  232 FLEGIT-VKGVTQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIRLLEQKPYKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDKVNGQAVPRYLIYDIIKFNAQPVGDCDFNIRLQCIEREIISPRHEKMKTGLIDKTQEPFSVRPKQFFDINISRKLLEGNFAKEVSHEMDGLIFQPIGK---YKPGRCDDILKWKPPSLNSVDFRLKITRMGGEGLLPQNVGLLYVGGYERPFAQIK-VTKELKQ-YDNKIIECKFENNS--WVFMRQRIDKSFPNAYNTAMAVCNSISNPV 553          

HSP 2 Score: 148.288 bits (373), Expect = 2.723e-36
Identity = 74/188 (39.36%), Postives = 117/188 (62.23%), Query Frame = 3
Query:   63 PSKWLDCPNIGTIIHDMFVPFKTPLDQKFDPEIPPANRFS---LTSFLASKKSEKVGMIVNLTNTKKYYNVNELDG-IIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGL-RKIYDFDGKLIAPKRPEWA 611
            P +WL+CP  G  +   F+P KT L  ++D ++   NRF    L+++L S K  K+ ++V+LTNT ++Y+ N+++   I+Y ++  +GH   P  +  + FI +C  F +R   ++IGVHCTHG+NRTGF++ +FL EK D  ++ AV  FA+ARPPGI++ DYL  L R+  D +     P  P+W 
Sbjct:    7 PPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSMLSNYLKSLKV-KMSLLVDLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNERSPPELIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKGDYLKELFRRYGDIEEAPPPPVLPDWC 193          
BLAST of mRNA-capping enzyme vs. UniProt/SwissProt
Match: sp|Q6NY98|MCE1_DANRE (mRNA-capping enzyme OS=Danio rerio OX=7955 GN=rngtt PE=2 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 2.469e-69
Identity = 138/329 (41.95%), Postives = 195/329 (59.27%), Query Frame = 3
Query: 1017 FMEGVS--KVSAVLDVTEMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPMSPTE--HHSNLILDGEMVIDIVKDIGFPRFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEKR---KFLPQDAKAQESFGILMKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIYNKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
            F+EGVS   VS V    ++  +++  +   + ++ GFPG QPVSM  +N+++L +  Y VSWK DG RYM+++ G + VYM+DRDN VF +E L FP       H SN +LDGEM+ID V     PR+LI+DI+  +   VG  +F  RL  I+ EII  R     L Q  KA+E F +  K F+DI    KL +G F  ++ HE+DGLIFQP  K   Y  G+    LKWKPP +NS+DF LK   V  +G  P+ VG L+V     PFA+++    +D ++Y+NKI+EC +  ++  W  +R+R DKS PN    A  +  SI +PV
Sbjct:  236 FLEGVSVKGVSQVTTQPKLGEIQRKCQQFSEWDRSGFPGAQPVSMDRKNIRMLEQNGYKVSWKADGTRYMMLIDGRNEVYMIDRDNSVFHIENLEFPFRKDLRIHLSNTLLDGEMIIDKVNGQPVPRYLIYDIIKFSGQPVGQCDFNRRLLCIEKEIISPRFEKMKLGQIDKAKEPFSVRNKPFFDIHAARKLLEGSFTSQVSHEVDGLIFQPIGK---YKPGRCDDILKWKPPSHNSVDFRLKITKVGGEGLIPQTVGLLYVGNYDMPFAQMKIT--KDLKQYDNKIIECTF--VNNTWVFMRQRVDKSFPNAYDTAMAVCNSIQHPV 557          

HSP 2 Score: 140.198 bits (352), Expect = 1.423e-33
Identity = 74/188 (39.36%), Postives = 119/188 (63.30%), Query Frame = 3
Query:   63 PSKWLDCPNIGTIIHDMFVPFKTPLDQKFDPEIPPANRFS---LTSFLASKKSEKVGMIVNLTNTKKYYNVNELDG-IIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGL-RKIYDFDGKLIAPKRPEWA 611
            P +W +CP  G  +   F+P KT L  ++D ++P  NRF    L+++L S K  K+G++V+LTNT ++Y+  +++   I+Y ++  +GH   P  +  + FI +C +F ++   ++IGVHCTHG+NRTGF++ ++L EK D  ++ AV  FA+ARPPGI++ DYL  L R+  D +    AP  PEW 
Sbjct:    7 PPRWRNCPRRGQPVAGKFLPMKTMLGPRYDDKVPEENRFHPSMLSNYLKSLKV-KMGLLVDLTNTTRFYDRADIEKEGIKYVKLSCKGHGECPTAETTEMFIRLCEHFIEKTPTELIGVHCTHGFNRTGFLICAYLVEKMDWSIEAAVAAFAQARPPGIYKGDYLKELFRRYGDVEDAPAAPPLPEWC 193          
BLAST of mRNA-capping enzyme vs. UniProt/SwissProt
Match: sp|Q17607|MCE1_CAEEL (mRNA-capping enzyme OS=Caenorhabditis elegans OX=6239 GN=cel-1 PE=1 SV=2)

HSP 1 Score: 226.098 bits (575), Expect = 1.242e-63
Identity = 135/334 (40.42%), Postives = 196/334 (58.68%), Query Frame = 3
Query: 1017 FMEG-VSKVSAVLDVTEMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPMSPTEHHSNLILDGEMVIDIVKDIGF----PRFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEKRKFLPQDAKAQESFGIL---MKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIY----NKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
            FM+G +  V    D  +   ++  ++NL K NK GFPG QPVS++  N+ LL ++ Y+VSWK DG+RY+I +   D VY  DRDN VF +E L F           ++D E++ID V+  G     PR LI+DI+  NSVNV    F  R  +IK+EII+ R    +  + +    I+    KDF+D++ T KL+   F   + HE+DGLIFQP  K+  Y +G+    LKWKPP +NS+DF LK E   K+G  P ++G LFV    +PF  ++  +    +KY+NKI+EC          K+W+ +RERTDKS PN +  A N++E+++NPV
Sbjct:  250 FMDGLIRGVKVCEDEGKKSMLQAKIKNLCKYNKQGFPGLQPVSLSRGNINLLEQESYMVSWKADGMRYIIYINDGD-VYAFDRDNEVFEIENLDFVTKNGAPLMETLVDTEVIIDKVEINGAMCDQPRMLIYDIMRFNSVNVMKEPFYKRFEIIKTEIIDMRTAAFKTGRLKHENQIMSVRRKDFYDLEATAKLFGPKFVQHVGHEIDGLIFQP--KKTKYETGRCDKVLKWKPPSHNSVDFLLKVEKKCKEGMLPEWIGYLFVQNLSDPFGTMKATA--TLKKYHNKIIECTLLVDNQGRPKEWKFMRERTDKSLPNGLRTAENVVETMVNPV 578          

HSP 2 Score: 147.902 bits (372), Expect = 4.715e-36
Identity = 76/194 (39.18%), Postives = 117/194 (60.31%), Query Frame = 3
Query:   63 PSKWLDCPNIGTIIHDMFVPFKTPLDQKFDPEIP-------PANRFSLTSFLASKKSEKVGMIVNLTNTKKYY---NVNELDGIIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRKIYD--FDGKLIAPKRPEW 608
            P +WL CP  GT+I+++F PFKTPL + +D +I        PA  FS          +K+G+ ++LTNT +YY    V E + I  Y ++ + G    P Q+  D FI +   F  ++ D+V+GVHCTHG+NRTGF++ ++L +  +  LD A+  FA+ R  GI++QDY+D L   YD   D K++AP++P+W
Sbjct:   16 PDRWLHCPKTGTLINNLFFPFKTPLCKMYDNQIAERRYQFHPAEVFSHPHL----HGKKIGLWIDLTNTDRYYFREEVTEHECI--YHKMKMAGRGVSPTQEDTDNFIKLVQEFHKKYPDRVVGVHCTHGFNRTGFLIAAYLFQVEEYGLDAAIGEFAENRQKGIYKQDYIDDLFARYDPTEDDKILAPEKPDW 203          
BLAST of mRNA-capping enzyme vs. UniProt/SwissProt
Match: sp|Q6BT58|MCE1_DEBHA (mRNA-capping enzyme subunit alpha OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=CEG1 PE=3 SV=2)

HSP 1 Score: 117.857 bits (294), Expect = 7.823e-27
Identity = 105/363 (28.93%), Postives = 172/363 (47.38%), Query Frame = 3
Query: 1041 SAVLDVTEMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVK-LLTKKKYLVSWKPDGVRYMIVVIG----SDIVYMLDRDNFVFRVERLYFPMSPTE-----HHSNLILDGEMVIDIVKDIGFP--RFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEKRKFLPQDAKAQESFGILMKDFWDIKTTEKLWDGDFQ--------DKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQ------------------KPRYVGNLFVNGQQ--EPFAKIEDISREDREKYNN-------KIMECIYNKISKK--WELIRERTDKSSPNYVTVANNIMESILNPV 1982
              +LD  E + +R  V +L+      FPG QP+S    ++   L  K Y V  K DG+R ++ +I      + V+++ R+N  + +  ++FP++  E     +H   +LDGE+V++  K++  P  RF IFD + IN  ++   + P RL  I  ++++     P D   +++  I+    +  K + KL    +         D+L HE DGLIF  AE    Y+ G +   LKWKP   N++D+  K E + K  Q                  KP  +      G    E F K+  +  ED EK  N       +I+EC   K+S    WE++R R DKS+ N+++V + I+ SI + V
Sbjct:   14 GTILDRNETQELRLMVADLLGRRNPSFPGAQPISFERYHLNDTLMNKDYYVCEKSDGLRCLLFIINHPERGEGVFLITRENDYYYIPNIHFPLTNNEEKGKTYHHGTLLDGELVLE-TKNVPEPVLRFCIFDALAINGKDITKRHLPKRLGYITEQVMK-----PFDNFKRKNPEIVNAPDFPFKVSFKLMTSSYHADDVLSKMDQLFHESDGLIFTCAETP--YVFGTDSTLLKWKPAHENTVDY--KMEMIFKKFQDPDLDPRDPDSTYTDYDSKPELIKLRVWKGGADYEDFTKLS-LENEDWEKLKNLRQPLQGRIVEC-RKKLSDPGFWEMLRFRNDKSNGNHISVVDKILHSIQDGV 364          
BLAST of mRNA-capping enzyme vs. TrEMBL
Match: A0A084W2G9 (mRNA-capping enzyme OS=Anopheles sinensis OX=74873 GN=ZHAS_00012195 PE=3 SV=1)

HSP 1 Score: 343.584 bits (880), Expect = 1.692e-105
Identity = 231/657 (35.16%), Postives = 332/657 (50.53%), Query Frame = 3
Query:   45 RGNFDPPSKWLDCPNIG-TIIHDMFVPFKTPLDQKFDPEIPPANRF--SLTSFLASKKSEKVGMIVNLTNTKKYYNVNEL-DGIIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGL-RKIYDFDGKLIAPKRPEWASLEEKKELCYVQHSLNVDKEDTKQLSQPKETSRSPKSHEIQDMEACEVERMETEVIDSASNLTEFKITSLPEKQIEIPQSCIIEKVVAAKPSIIEKIEDIGKNIISSVTSALSEQSVKIVSIPPSATFCPPKVPKFMEGVSKVSAVLDVTEMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPM--SPTEHHSNLILDGEMVIDIVKDIGFPRFLIFDIVCINSVNVGIFNF-PHRLFLIKSEIIEKRKFLPQDA---KAQESFGILMKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIYNKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
            RG    P +WL CP    T+I   F+ FKTPL Q+F+ +IP   +F  S+   L  +   ++G+ ++LTNT ++Y+ +E+ D   +Y ++   GH   P ++Q   FI I   F +    + +GVHCTHG+NRTGF++VS++ EK D  +D A+  FA+ARPPGI++ DY+  L R+  D +   + P+ P W               L  D  D +Q                Q+ +A E      E  DSA                              K    E+ E+ G    +S+ +  S+      S  P+A F        MEGV  V+ + D   +  ++  VR +      GF G QPVSM   N++ LT+  Y VSWK DG RYM+++     +Y  DRDN VF VE + FP    P  H ++ ++DGEMVID   D   PR+L++D++   +  V    F P RL LI  E+I  R    Q     ++ E FG+ +K FWDIK +E L    F   L HE DGLI+QP+   D Y  G     LKWKP   NSIDF L  +  +K G  PR +G L+V G ++ + +I+ +++E R K NNKI+EC Y +    W L+RERTDKS PN    A ++ ESI  PV
Sbjct:    3 RGPGPIPHRWLHCPRKSDTLIAGRFLAFKTPLKQEFESQIPIECKFTPSMLVDLMRRHKVRIGLWIDLTNTNRFYDKHEIEDKGSQYIKLQCRGHGETPSREQAKAFIEIVEEFIENHPVEAVGVHCTHGFNRTGFLIVSYMVEKMDCAVDAALMAFAQARPPGIYKADYIRELFRRYGDEEDAPMPPELPAWC--------------LEYDDGDGQQQ---------------QEDDAVE------EQNDSARR---------------------------GKKRTREEGENSGNGGEASLPTKRSKGG---PSYNPNAVF--------MEGVPNVTLLQDKALIAKLQDRVRMMCGSKMQGFSGAQPVSMDMGNLRFLTQMPYRVSWKADGTRYMMLIHREKEIYFFDRDNSVFAVEGIRFPSLEDPNRHLADTLVDGEMVIDKYGDQLTPRYLVYDVIYFQNREVRTLPFHPDRLTLIDRELIASRTRAIQKGLIDRSIEPFGVRLKQFWDIKQSEALLGPKFTKTLGHEPDGLIYQPS--IDPYTPGVCKRVLKWKPHHMNSIDFRLVIQEERKLGMVPRKIGLLYVGGMEQSYGEIK-LTKELR-KLNNKIIECKYQE-GLGWVLMRERTDKSFPNSYETARSVWESIRRPV 581          
BLAST of mRNA-capping enzyme vs. TrEMBL
Match: Q9VY44 (mRNA-capping enzyme OS=Drosophila melanogaster OX=7227 GN=mRNA-cap PE=2 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 1.727e-105
Identity = 224/657 (34.09%), Postives = 339/657 (51.60%), Query Frame = 3
Query:   45 RGNFDPPSKWLDCPNIG-TIIHDMFVPFKTPLDQKFDPEIPPANRFSLTSFLASKKSEKV--GMIVNLTNTKKYYNVNELDGI-IRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRKIY-DFDGKLIAPKRPEWASLEEKKELCYVQHSLNVDKEDTKQLSQPKETSRSPKSHEIQDMEACEVERMETEVIDSASNLTEFKITSLPEKQIEIPQSCIIEKVVAAKPSIIEKIEDIGKNIISSVTSALSEQSVKIVSIPPSATFCPPKVPKFMEGVSKVSAVLDVTEMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPMSP--TEHHSNLILDGEMVIDIVKDIGFPRFLIFDIVCINSVNVGIFNF-PHRLFLIKSEIIEKRKFLPQDA---KAQESFGILMKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIYNKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
            RG+   P++WL CP    TII + F+ FKTPL   F  ++P    F         K+ KV  G+ V+LTNTK++Y+ + ++ +  +Y ++   GH   P  +Q   FI I   F +     VI VHCTHG+NRTGF++V +L E+ D  +  A+ +FA ARPPGI++QDY++ L K Y D +    AP++P W               L+ D  +     Q   +S S ++ E QD +A EVE                                                ED G +  +S +     +  +   I  +ATF        M GV  V  V D   + ++++ V++     K GFPG QPVSM  EN+K L++  Y VSWK DG RYM+++ G D VY  DR++  F+VE + F  S    EH    ++DGEMV+D + +   PR+LI+DIV +++ +V    F P+RL  IK+E+I  R    +     +  ++F +  KDFWDI  + +L    F   L HE DGLIFQP+++   Y +G      KWKP E NS+DF LK    + +G   + VG L+V G   P+ +++ +++E RE  +N+I+EC  N+    W+ +RERTDK +PN    A ++++SI +PV
Sbjct:   10 RGSGPLPNRWLYCPRKSDTIIAERFLAFKTPLSNNFHDKMPIECTFQPEMLFEYCKTLKVKLGLWVDLTNTKRFYDRSAVEELGAKYIKLQCRGHGETPSPEQTHSFIEIVDNFINERPFDVIAVHCTHGFNRTGFLIVCYLVERLDCSVSAALAIFASARPPGIYKQDYINELYKRYEDTNAAPAAPEQPNWC--------------LDYDDGNGDGFVQDNSSSTSQQAGE-QDDDAEEVEG-----------------------------------------------EDAGGDCDASTSDGQPRKKRRREMIIKNATF--------MAGVPGVRQVSDQPRLGDLQRKVQDWCDWKKNGFPGAQPVSMDRENIKRLSEIPYRVSWKADGTRYMMLIDGRDEVYFFDRNHSCFQVENVTFVESRNLNEHLDGTLVDGEMVLDKIGETVTPRYLIYDIVRLSNRDVRDEPFYPNRLDYIKTEVIGPRILGMKHGIINQRLQAFSVRGKDFWDIWMSARLLGEKFSRTLAHEPDGLIFQPSKQP--YTAGTCSDVFKWKPHELNSVDFRLKIITERGEGLLTKKVGFLYVGGHDAPYGRMQRLTKETRE-LDNRIVECTMNQFG-NWDFMRERTDKKNPNSYNTARSVVDSIKHPV 592          
BLAST of mRNA-capping enzyme vs. TrEMBL
Match: A0A1I8NM93 (mRNA-capping enzyme OS=Stomoxys calcitrans OX=35570 GN=106087451 PE=3 SV=1)

HSP 1 Score: 345.51 bits (885), Expect = 1.942e-105
Identity = 233/664 (35.09%), Postives = 334/664 (50.30%), Query Frame = 3
Query:   30 MARGYRGNFDPPSKWLDCPNIG-TIIHDMFVPFKTPLDQKFDPEIPPANRFSLTSFLASKKS--EKVGMIVNLTNTKKYYN---VNELDGIIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGL-RKIYDFDGKLIAPKRPEWASLEEKKELCYVQHSLNVDKEDTKQLSQPKETSRSPKSHEIQDMEACEVERMETEVIDSASNLTEFKITSLPEKQIEIPQSCIIEKVVAAKPSIIEKIEDIGKNIISSVTSALSEQSVKIVSIPPSATFCPPKVPKFMEGVSKVSAVLDVTEMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPM--SPTEHHSNLILDGEMVIDIVKDIGFPRFLIFDIVCINSVNVGIFNF-PHRLFLIKSEIIEKRKFLPQDA---KAQESFGILMKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIYNKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
            M+ G RG    P++WL CP     II   F+ FKTPL   FD ++P    F         KS   K+G+ ++LTNTK++Y+   V   D   +Y ++   GH   P  +Q   FI I   F +     +IGVHCTHG+NRTGF++ S+L E+ D  ++ A+  FAK RPPGI++ DY+  L R+  D D    AP+ P W                 ++ +D+ +  Q ++   S  S   Q   A    R +T    S  +L   +    PE + +  +    E   A         ED G            E  +K                KFMEGV  V+ V D   + +++Q V+++   NK GFPG QPVSM  EN+K L +  Y VSWK DG RYM+++   D +Y +DR+N  F+VE + F    +  EH  + +LDGEMV+D  +    PR+LI+DI+ I S  +G  +F P+RL  I  E+I  R    +     +  E F +  KDFWDI+ +  L    F   LLHE DGLIFQP+E+   Y +G      KWKP   NS+DF LK       G  PR +  L+V G + PFA+++       +  +NKI+EC  N    +WEL+RERTDK+ PN    A ++++SI  PV
Sbjct:    1 MSNGNRGPGPIPNRWLHCPRKSEGIIVGKFIAFKTPLSAAFDDQMPDDCLFYPEMIFGYCKSIKLKLGLWIDLTNTKRFYDSAVVKSKD--TQYVKLQCRGHGETPSPEQTQSFIEIVDNFINERPSDLIGVHCTHGFNRTGFLIASYLVERFDFSVEAALATFAKFRPPGIYKADYIRELYRRFDDEDDAPPAPELPGWC----------------LEFDDSDRGPQKRKYEESAHSSNSQQAMAA---RSQTH---SNGSLGLIETLDDPEDEAQEDEGEANEGNEA---------EDGGAPNGKPRKKRRREMIIKNA--------------KFMEGVPGVTLVTDQPRLGDIQQKVQDMCGWNKSGFPGCQPVSMDCENMKRLHEIPYRVSWKADGTRYMMLINKRDEIYFIDRNNSCFQVENITFVKYNNLHEHLEDTLLDGEMVLDKYQGQHIPRYLIYDIIKIGSREIGKEHFYPNRLQCIDMEVISPRHKAIEKGIIDRPSEPFSLRKKDFWDIRQSASLLGEKFAKSLLHEPDGLIFQPSEQ--AYTAGVCKDVFKWKPLNMNSVDFRLKVGEESGQGILPRKICLLYVGGHEPPFAQMKYTKAIKAQNLDNKIVECTVN-AQGQWELMRERTDKTLPNSFNTAKSVIDSIRTPV 614          
BLAST of mRNA-capping enzyme vs. TrEMBL
Match: B4R4N6 (mRNA-capping enzyme OS=Drosophila simulans OX=7240 GN=Dsim\GD15855 PE=3 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 7.707e-105
Identity = 223/657 (33.94%), Postives = 341/657 (51.90%), Query Frame = 3
Query:   45 RGNFDPPSKWLDCPNIG-TIIHDMFVPFKTPLDQKFDPEIPPANRFSLTSFLASKKSEKV--GMIVNLTNTKKYYNVNELDGI-IRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRKIY-DFDGKLIAPKRPEWASLEEKKELCYVQHSLNVDKEDTKQLSQPKETSRSPKSHEIQDMEACEVERMETEVIDSASNLTEFKITSLPEKQIEIPQSCIIEKVVAAKPSIIEKIEDIGKNIISSVTSALSEQSVKIVSIPPSATFCPPKVPKFMEGVSKVSAVLDVTEMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPMSP--TEHHSNLILDGEMVIDIVKDIGFPRFLIFDIVCINSVNVGIFNF-PHRLFLIKSEIIEKRKFLPQDA---KAQESFGILMKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIYNKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
            RG+   P++WL CP    TII + F+ FKTPL  KF  ++P    F         K+ KV  G+ V+LTNTK++Y+ + ++ +  +Y ++   GH   P  +Q   FI I   F +     VI VHCTHG+NRTGF++V ++ E+ D  +  A+ +FA ARPPGI++QDY++ L K Y D +    AP++P W               ++ D  +     Q   +S S ++ E QD +A EV+                                                ED G +  +S +     +  +   +  +ATF        M GV  V  V D   + ++++ V++     K GFPG QPVSM  EN+K L++  Y VSWK DG RYM+++ G D VY  DR++  F+VE + F  S    EH    ++DGEMV+D + +   PR+LI+DIV +++ +V    F P+RL  IK+E+I  R    +     +  ++F +  KDFWDI  + +L    F   L HE DGLIFQP+++   Y +G      KWKP E NS+DF LK    + +G   + VG L+V G+  P+ +++ +++E RE  +N+I+EC  N+    WE +RERTDK +PN  T A ++ +SI +PV
Sbjct:   10 RGSGPLPNRWLYCPRKSDTIIAERFLAFKTPLSSKFHDKMPIECTFQPEMLFEYCKTLKVKLGLWVDLTNTKRFYDRSAVEELGAKYIKLQCRGHGDAPSLEQTHSFIEIVDNFINERPFDVIAVHCTHGFNRTGFLIVCYMVERLDCSVSAALAIFAGARPPGIYKQDYVNELYKRYEDTNVAPAAPEQPNWC--------------MDYDDGNGDGYVQDNSSSTSQQAGE-QDDDAEEVDG-----------------------------------------------EDAGGDCDASTSDGQPRKKRRREMVVKNATF--------MAGVPGVRQVSDQPRLGDLQRKVQDWCDWKKNGFPGAQPVSMDRENIKRLSEIPYRVSWKADGTRYMMLIDGKDEVYFFDRNHSCFQVENVTFVESRNLNEHLDGTLVDGEMVLDKIGETVTPRYLIYDIVRLSNRDVREEPFYPNRLDYIKTEVIGPRILGMKHGIINQRLQAFSVRGKDFWDIWMSARLLGEKFSRTLAHEPDGLIFQPSKQP--YTAGTCFDVFKWKPHELNSVDFRLKIITERGEGLLTKKVGFLYVGGRDAPYGRMQKLTKETRE-LDNRIVECTMNQFG-NWEFMRERTDKKNPNSYTTARSVEDSIRHPV 592          
BLAST of mRNA-capping enzyme vs. TrEMBL
Match: A0A4E0RTK9 (mRNA-capping enzyme OS=Fasciola hepatica OX=6192 GN=D915_005034 PE=3 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 2.015e-104
Identity = 225/685 (32.85%), Postives = 352/685 (51.39%), Query Frame = 3
Query:   63 PSKWLDCPNIGTIIHDMFVPFKTPLDQKFDPEIPPANRFSLTSFLASKKSEKVGMIVNLTNTKKYYNVNE-LDGIIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRF-GDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRKIYDFDGKLI-APKRPEWASLEEKKELCYVQHSLNVDKEDTKQLSQPKETSRSPKSHEIQDMEACEVERMETEVIDSASNLTEFKITSLPEKQIEIPQSCIIEKVVAAKPSIIEKIEDIGKNIISSVTSALSEQSVKIVSIPPSATFC-----PPKVPKFMEGVSKVSAVLDVTEMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFP----------------MSPTE-------HHSNLILDGEMVI---------DIVKDI--GFPRFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEKRKFLPQDAKAQ---ESFGILMKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIYNKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
            P +WL+CP +G++I D+F+PFKTPLD KFD  + P + F +     + +  K+G +++LT +K++YN  E LD   ++ +I  +G+E  P Q+QVD FI + + F D   GD+ +GVHCTHG+NRTGFM++++L E+ +  +D+AV++FA ARPPGI++ DYL+ L   Y      + AP  P W   +   +  +     +   +D  + S  + +S S        M+  ++ R +  + ++ S      I SLP ++   P            P +++ +  +   I     S  + ++ ++         C      P  P       +  +    T  EN ++    L       F G+QPVS+T  N++ L    Y VS+K DG RY+++V G + VYM+DR NFV+RVE L+FP                 SP+E       H  N +LDGEMV+          I +++  G PRFLI+DIV +N   VG   F  R  +I  ++I  R             +SF +  K F  +K TE+L   +F   L H  DGLIFQP   ++ Y+ G  +  LKWKPP  N++DF  K  Y  K G+ P YVG+L++ G   P AK+  +  +D+   + KI+EC     +  W+++R RTDK+ PNY      ++ESI+ PV
Sbjct:   10 PPRWLNCPRMGSMIVDIFIPFKTPLDSKFDNFMEPEHIFHVDDVFQACEPYKLGFVLDLTKSKRFYNRREVLDMNCKHLKIECKGNEETPTQEQVDLFIRVVNQFLDSSSGDEKVGVHCTHGFNRTGFMIIAYLVEELNYGVDIAVKIFADARPPGIYKADYLEDLFTRYGNKEDCVPAPVLPAWCIEDGDGDRLHGSKRPHAPDDDFDRGSLKQTSSGS--------MDKTKLSRYDNSMAEAVS------IGSLPSQRYPTPPK--------GTPKLMDGVSHV---ITLDQDSPEAHEARELADRLFRMGGCMYENGQPVFPNAQSSEGEDDSSEPATSNENTKRFKHPLR------FRGSQPVSITQRNIEALISFDYCVSYKADGCRYLLLVSGPNQVYMIDRANFVYRVEVLHFPSVAWVKCVQQSGNIQSHSPSEFLSVADGHLRNTLLDGEMVLCHDPSKPPPSIHEEVTSGIPRFLIYDIVTLNGKPVGRSPFFERYSIIDKQVIWPRNTAGHLGLVNFGIQSFSVRRKQFRPLKETEELLKQEFIQSLDHVTDGLIFQPCGPDEFYVLGTCYQQLKWKPPHLNTVDFRCKIVYEAKVGEIPGYVGHLYLGGLNTPAAKLAHVGPKDK-VLDGKIVECSLIP-NLGWKVLRIRTDKTEPNYHKSGKAVIESIMFPV 661          
BLAST of mRNA-capping enzyme vs. Ensembl Cavefish
Match: rngtt (RNA guanylyltransferase and 5'-phosphatase [Source:NCBI gene;Acc:405803])

HSP 1 Score: 188.734 bits (478), Expect = 1.504e-53
Identity = 110/263 (41.83%), Postives = 152/263 (57.79%), Query Frame = 3
Query: 1209 VRYMIVVIGSDIVYMLDRDNFVFRVERLYFPMSP--TEHHSNLILDGEMVIDIVKDIGFPRFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEKRK---FLPQDAKAQESFGILMKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIYNKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
             RYM+++ G D VYM+DR+N +F +  L FP       H +N +LDGEM+ID V     PR+LI+DI+ IN   VG  +F  RL  I+ EII  R     + Q  K +E F +  K F+DI    KL +G F  ++ HE+DGLIFQP  K   Y  G+    LKWKPP  NS+DF LK   V  +G  P+ VG L+V     PFA+++ +S+E ++ Y+NKI+EC +   +  W  +R+R DKS PN    A  +  SI  PV
Sbjct:   52 CRYMMLIDGKDEVYMIDRENSIFHISNLEFPFRKDMNAHLTNTLLDGEMIIDKVNGQPIPRYLIYDIIKINGQPVGQCDFSRRLLCIEKEIIFPRSEKIKMGQIDKTKEPFSVRNKPFFDINAARKLLEGSFTSQVSHEVDGLIFQPIGK---YRPGRCDDILKWKPPSLNSVDFRLKISKVGGEGLIPQTVGLLYVGNYDVPFAQMK-VSKELKQ-YDNKIIECTFK--NNTWVFMRQRVDKSFPNSYDTAMAVCNSIQYPV 307          
BLAST of mRNA-capping enzyme vs. Ensembl Cavefish
Match: rngtt (RNA guanylyltransferase and 5'-phosphatase [Source:NCBI gene;Acc:405803])

HSP 1 Score: 134.035 bits (336), Expect = 3.897e-35
Identity = 73/189 (38.62%), Postives = 116/189 (61.38%), Query Frame = 3
Query:   60 PPSKWLDCPNIGTIIHDMFVPFKTPLDQKFDPEIPPANRFS---LTSFLASKKSEKVGMIVNLTNTKKYYNVNELDG-IIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGL-RKIYDFDGKLIAPKRPEWA 611
            PP +W +CP  G  +   F+P KT L  ++D  +P  NRF    L+++L S K  K+G++V+LTNT ++Y+  E++   ++Y ++  +GH   P  +    FI +C +F  +   ++IGVHCTHG+NRTGF++ ++L EK D  ++ AV  FA+AR PGI++ DYL  L R+  D D     P+ P+W 
Sbjct:    6 PPPRWRNCPRRGQPVAGKFLPMKTMLGPRYDDSVPEENRFHPSMLSNYLKSLKV-KMGLLVDLTNTTRFYDRAEIEKEGVKYVKLQCKGHGECPTAETTGMFIRLCEHFMQKNPTELIGVHCTHGFNRTGFLICAYLVEKMDWSIEAAVAAFAQARSPGIYKGDYLKELFRRYGDVDDTPAPPQLPDWC 193          
BLAST of mRNA-capping enzyme vs. Ensembl Cavefish
Match: dusp11 (dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) [Source:ZFIN;Acc:ZDB-GENE-050417-226])

HSP 1 Score: 70.8626 bits (172), Expect = 5.897e-14
Identity = 43/145 (29.66%), Postives = 77/145 (53.10%), Query Frame = 3
Query:   45 RGNFDPPSKWLDCPNIGTIIHDM-FVPFKTPLDQKFDPEIPPANRFSLTSF--LASKKSEKVGMIVNLTNTKKYYNVNELDGIIRYDQIFLEGHETYPDQKQVDKFIVICSYFF--DRFGDKVIGVHCTHGYNRTGFMVVSFLCE 464
            RG    P++ +    +G  I+   F+ FK PL ++ D     + RF       +  ++ +++G++++LT T +YY   +L    +Y +++  GH+  P  K +  F      F   ++  DK+IGVHCTHG NRTG++V  +L +
Sbjct:    4 RGKNSTPTRSVLYTAVGKRIYGTRFIAFKVPLKRQLDQ----SERFGPADLKEIMEQEGQELGLVIDLTFTDRYYKPQDLPESCQYLKLYTVGHDV-PTDKIILSFKRAVHRFLQENQDNDKLIGVHCTHGLNRTGYLVCRYLID 143          
BLAST of mRNA-capping enzyme vs. Ensembl Sea Lamprey
Match: rngtt (RNA guanylyltransferase and 5'-phosphatase [Source:NCBI gene;Acc:405803])

HSP 1 Score: 196.438 bits (498), Expect = 2.639e-55
Identity = 119/330 (36.06%), Postives = 178/330 (53.94%), Query Frame = 3
Query: 1017 FMEGVSKVSAVLDVT---EMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFP--MSPTEHHSNLILDGEMVIDIVKDIGFPRFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEKRKFLPQDA---KAQESFGILMKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIYNKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
            F+EGV +V  V  +T   ++  V++  +       +G P  QPVSM  +N+  L+ K Y+VSWK DG RYM+++ G + V+M++RDN +F V  L FP   +P  H +N +LDGEM++D V     PR+LI+DIV  N   VG  +F  R   I+ EIIE R    +     KA E F +  K FWD+                           +   VY+ G+    LKWKPP  NS+DF LK   +  +G   + +G L+V  +  PFA+++  + ++  +Y+NKI+EC ++  + +W  +R+RTDKS PN  T A  + ESI  PV
Sbjct:  178 FLEGV-QVPGVTQMTTQHKISMVQRKGQEFCMWKGYGVPQAQPVSMDRKNLVFLSNKHYMVSWKADGTRYMMLIDGENGVFMINRDNIIFNVASLEFPNRKNPDSHINNTLLDGEMIVDKVNGQDVPRYLIYDIVKFNGQPVGQCDFRTRQQCIQREIIEPRHEKMKAGHINKAMEPFSVRAKPFWDV--------------------------TQSRSVYVPGRCTDMLKWKPPSQNSVDFRLKISKIGGEGLLTKTMGLLYVGQKDTPFAQMK--ATKELRQYDNKIIECKFH--NNEWLFMRQRTDKSFPNSFTTAMGVCESIQFPV 476          

HSP 2 Score: 112.079 bits (279), Expect = 3.035e-26
Identity = 52/133 (39.10%), Postives = 82/133 (61.65%), Query Frame = 3
Query:  219 VGMIVNLTNTKKYYNVNEL-DGIIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRKIY-DFDGKLIAPKRPEWA 611
            +G++++LTNT ++Y+  E+ D  I Y +++  GH   P  +    F+  C  +  +   K+IGVHCTHG+NRTGF++ ++L EK D  ++ AV  F++ARPPGI++ DYLD L   Y D +     P  P+W 
Sbjct:    1 MGVLIDLTNTNRFYDKKEIEDAGITYFKLYCRGHGECPLPEHTQVFVKFCDNYIKKNPQKIIGVHCTHGFNRTGFLICAYLVEKLDWSVEAAVAEFSRARPPGIYKGDYLDDLFGRYGDSEDTPAPPPLPDWC 133          
BLAST of mRNA-capping enzyme vs. Ensembl Sea Lamprey
Match: rngtt (RNA guanylyltransferase and 5'-phosphatase [Source:NCBI gene;Acc:405803])

HSP 1 Score: 157.532 bits (397), Expect = 1.810e-41
Identity = 88/215 (40.93%), Postives = 126/215 (58.60%), Query Frame = 3
Query: 1017 FMEGVSKVSAVLDVT---EMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFP--MSPTEHHSNLILDGEMVIDIVKDIGFPRFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEKRKFLPQDA---KAQESFGILMKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPA 1637
            F+EGV +V  V  +T   ++  V++  +       +G P  QPVSM  +N+  L+ K Y+VSWK DG RYM+++ G + V+M++RDN +F V  L FP   +P  H +N +LDGEM++D V     PR+LI+DIV  N   VG  +F  R   I+ EIIE R    +     KA E F +  K FWD+  +  L +G F  ++ HE+DGLIFQPA
Sbjct:  209 FLEGV-QVPGVTQMTTQHKISMVQRKGQEFCMWKGYGVPQAQPVSMDRKNLVFLSNKHYMVSWKADGTRYMMLIDGENGVFMINRDNIIFNVASLEFPNRKNPDSHINNTLLDGEMIVDKVNGQDVPRYLIYDIVKFNGQPVGQCDFRTRQQCIQREIIEPRHEKMKAGHINKAMEPFSVRAKPFWDVTQSRSLLEGKFVQQVSHEVDGLIFQPA 422          

HSP 2 Score: 124.02 bits (310), Expect = 3.268e-30
Identity = 62/164 (37.80%), Postives = 100/164 (60.98%), Query Frame = 3
Query:  135 LDQKFDPEIPPANRFS---LTSFLASKKSEKVGMIVNLTNTKKYYNVNEL-DGIIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRKIY-DFDGKLIAPKRPEWA 611
            L  ++D ++P   RF+   L+ +L S+K E +G++++LTNT ++Y+  E+ D  I Y +++  GH   P  +    F+  C  +  +   K+IGVHCTHG+NRTGF++ ++L EK D  ++ AV  F++ARPPGI++ DYLD L   Y D +     P  P+W 
Sbjct:    2 LSTRYDDQVPEECRFNPSMLSVYLKSRKVE-MGVLIDLTNTNRFYDKKEIEDAGITYFKLYCRGHGECPLPEHTQVFVKFCDNYIKKNPQKIIGVHCTHGFNRTGFLICAYLVEKLDWSVEAAVAEFSRARPPGIYKGDYLDDLFGRYGDSEDTPAPPPLPDWC 164          
BLAST of mRNA-capping enzyme vs. Ensembl Sea Lamprey
Match: rngtt (RNA guanylyltransferase and 5'-phosphatase [Source:NCBI gene;Acc:405803])

HSP 1 Score: 148.288 bits (373), Expect = 6.514e-41
Identity = 72/188 (38.30%), Postives = 115/188 (61.17%), Query Frame = 3
Query:   63 PSKWLDCPNIGTIIHDMFVPFKTPLDQKFDPEIPPANRFS---LTSFLASKKSEKVGMIVNLTNTKKYYNVNEL-DGIIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRKIY-DFDGKLIAPKRPEWA 611
            P +WL CP  G ++ + F+P KT L  ++D ++P   RF+   L+ +L S+K E +G++++LTNT ++Y+  E+ D  I Y +++  GH   P  +    F+  C  +  +   K+IGVHCTHG+NRTGF++ ++L EK D  ++ AV  F++ARPPGI++ DYLD L   Y D +     P  P+W 
Sbjct:    7 PPRWLHCPRRGQLVAERFLPLKTMLSTRYDDQVPEECRFNPSMLSVYLKSRKVE-MGVLIDLTNTNRFYDKKEIEDAGITYFKLYCRGHGECPLPEHTQVFVKFCDNYIKKNPQKIIGVHCTHGFNRTGFLICAYLVEKLDWSVEAAVAEFSRARPPGIYKGDYLDDLFGRYGDSEDTPAPPPLPDWC 193          
BLAST of mRNA-capping enzyme vs. Ensembl Sea Lamprey
Match: dusp11 (dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) [Source:ZFIN;Acc:ZDB-GENE-050417-226])

HSP 1 Score: 105.531 bits (262), Expect = 2.846e-26
Identity = 67/188 (35.64%), Postives = 102/188 (54.26%), Query Frame = 3
Query:   21 NKFMARGYRGNFDPPSKWLDCPNIGTIIHDM-FVPFKTPLDQKFDPEIPP-ANRFSLTSFLA--SKKSEKVGMIVNLTNTKKYYNVNEL-DGIIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFG--DKVIGVHCTHGYNRTGFMVVSFL--CEKCDLELDVAVELFAKARPPGIFRQDYLDGLR 557
            +K++     G    P +W +   +G  +    F+ FK PL Q +   I     + S    L   S+++E +G++++LTNT +YY+  EL    I+Y++IF  GHE  P+ K +  F      F    G  DK+IGVHCTHG NRTG++V  +L  CEK  +E D A++ F  AR   I R++YL  L+
Sbjct:   16 SKYIPEKKGGKLQSPIRWENYVPVGKRVKGTRFISFKVPLRQNYSIRIQSEVTQMSPLGLLENISRQNESLGLVIDLTNTTRYYDPKELTKAGIKYEKIFTMGHEV-PNDKTIAHFKETIKTFIGENGENDKLIGVHCTHGVNRTGYLVCRYLIDCEK--MEPDEAIQAFNSARGHSIERENYLKDLK 200          
BLAST of mRNA-capping enzyme vs. Ensembl Yeast
Match: CEG1 (Guanylyltransferase involved in mRNA 5' capping; subunit of mRNA capping enzyme, which is a heterotetramer composed of two molecules of Ceg1p and a homodimer of Cet1p, the mRNA 5'-triphosphatase subunit; nuclear import of Ceg1p requires interaction with Cet1p; mammalian capping enzyme is a single bifunctional polypeptide; human homolog RNGTT can complement yeast ceg1 null mutant [Source:SGD;Acc:S000003098])

HSP 1 Score: 95.1301 bits (235), Expect = 3.279e-21
Identity = 102/359 (28.41%), Postives = 150/359 (41.78%), Query Frame = 3
Query: 1119 FPGTQPVSMTHENV--KLLTKKKYLVSWKPDGVRYMIVVI-----GSDIVYMLDRDNFVFRVERLYFPMSPTEHHSNL--------ILDGEMVIDI--VKDIGFPRFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEK----RKFLPQDAKAQESFGILMK----DFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEY-------VKKDGQKPRYV--------------GNLFVNGQ----QEPF------------AKIEDISREDRE---------KYNNKIMECIYNKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
            FPG+QPVS  H +V  KLL    Y V  K DG+R ++ ++     G    +M+DR+N  + V    FP  P +    L        +LDGE+VI    +  +   R+L+FD + IN   +       RL  +  E  +     R   P        F I MK     +  +K  + L      DKL H  DGLIF P  K      GK+   LKWKP + N++DF L  +        + KD +   Y               G   VN +     +PF             K  ++S  D E           N +I+EC  N+ +  WE++R R DK + N+ +V   ++ESI + V
Sbjct:   43 FPGSQPVSFQHSDVEEKLLA-HDYYVCEKTDGLRVLMFIVINPVTGEQGCFMIDRENNYYLVNGFRFPRLPQKKKEELLETLQDGTLLDGELVIQTNPMTKLQELRYLMFDCLAINGRCLTQSPTSSRLAHLGKEFFKPYFDLRAAYPNRCTTF-PFKISMKHMDFSYQLVKVAKSL------DKLPHLSDGLIFTPV-KAPYTAGGKDSLLLKWKPEQENTVDFKLILDIPMVEDPSLPKDDRNRWYYNYDVKPVFSLYVWQGGADVNSRLKHFDQPFDRKEFEILERTYRKFAELSVSDEEWQNLKNLEQPLNGRIVECAKNQETGAWEMLRFRDDKLNGNHTSVVQKVLESINDSV 392          
BLAST of mRNA-capping enzyme vs. Ensembl Nematostella
Match: EDO40094 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S832])

HSP 1 Score: 209.149 bits (531), Expect = 4.670e-59
Identity = 125/310 (40.32%), Postives = 177/310 (57.10%), Query Frame = 3
Query: 1068 ENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPM--SPTEHHSNLILDGEMVIDIVKDIGFPRFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEKRKFLPQDA---KAQESFGILMKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIYNKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
            E ++   + + K    GFPG+QPVSM  +N++ L +K Y VSWK DG RYM++V+G   VY++DRDN VF   +  FP   +P EH  + ++DGEMV D   D   PR+L +DI+         F  P +  ++         F  Q     K QE F I  K F+ ++ T  + +  +  KL HE DGLIF PA  ED Y+ G+    LKWKP   NS+DF LK   VK++G  PR VG L V G   PFA+I+ +++E +  YNN+++EC ++  +K+W+ +R R DKS  N  T A  + ESI NPV
Sbjct:  251 EEIQDMCQEMCKFELNGFPGSQPVSMDRQNIRFLHEKDYRVSWKADGTRYMMLVVGEGQVYLIDRDNAVFSAPQFRFPQRKNPREHIFDTLIDGEMVFDKEGDKIHPRYLAYDII--------KFQVPGK--IVPGHAPCATCFDVQQGLLNKTQEPFSIRAKQFFPLEKTAWILE-HWVPKLTHENDGLIFNPA--EDPYLPGRQASVLKWKPHTLNSVDFILKIATVKQEGCLPRSVGYLMVGGFDRPFAEIK-VTKELK-AYNNRVIECTWD--NKEWKFLRVREDKSHANAYTTAQGVCESIRNPV 543          

HSP 2 Score: 168.703 bits (426), Expect = 9.265e-45
Identity = 84/193 (43.52%), Postives = 124/193 (64.25%), Query Frame = 3
Query:   63 PSKWLDCPNIGTIIHDMFVPFKTPLDQKFDPEIPPANRFSL---TSFLASKKSEKVGMIVNLTNTKKYYNVNELDGI--IRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRKIY-DFDGKLIAPKRPEWASLEE 623
            P +WL+CP    +I D F  FKTPL  ++D +IP ANRF L    S+  + K  KVG+I++LTNT ++Y+ NEL+ +  I++ ++   GH   P   Q   FI IC  ++D+   ++IGVHCTHG+NRTGF+++S+L EK D  ++ AVE F K RPPGI++Q+YL+ L + Y D      AP+ P+W   +E
Sbjct:    4 PPRWLNCPRKSQVIADRFFAFKTPLSSRYDDQIPEANRFQLPMLCSYFQTLKV-KVGLIIDLTNTNRFYDKNELERLTGIKHVKLQCRGHGETPSPDQTQLFINICCRYWDKNPGELIGVHCTHGFNRTGFLIISYLVEKEDWSIEAAVECFTKCRPPGIYKQEYLNELSRRYGDSADPPSAPELPDWCYEDE 195          
BLAST of mRNA-capping enzyme vs. Ensembl Nematostella
Match: EDO47609 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLI3])

HSP 1 Score: 81.2629 bits (199), Expect = 5.472e-18
Identity = 56/172 (32.56%), Postives = 91/172 (52.91%), Query Frame = 3
Query:   69 KWLDCP--NIGTIIHDMFVPFKTPLDQKFDPEIPPANRFSLTSFLA--SKKSEKVGMIVNLTNTKKYYNVNEL--DGIIRYDQIFLEGHETYPDQKQVDKFIVICSYFF--DRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRK 560
            +W D    N   I     + FKTPL           N F+ T  +   +++  K+G++++ T T +YY+  E   +GII Y ++   GH   P +K + +F      F   D+ G  ++G+HCTHG NRTG+MV  +L + C  E + A+E F +AR   + R++YL+ L+K
Sbjct:    1 RWRDYSTCNWTPIEGQRIIIFKTPLSN--------VNMFTPTDLIEQLAQREMKLGLVLDFTFTTRYYDPREFTAEGII-YKKMMCAGH-VIPKKKDIKRFEDEVKNFLENDKTGS-LVGIHCTHGVNRTGYMVCRYLIDCCGYEPEKAIEAFNQARGHPLERENYLEDLKK 161          
BLAST of mRNA-capping enzyme vs. Ensembl Medaka
Match: rngtt (RNA guanylyltransferase and 5'-phosphatase [Source:NCBI gene;Acc:101173353])

HSP 1 Score: 239.58 bits (610), Expect = 1.579e-70
Identity = 136/329 (41.34%), Postives = 193/329 (58.66%), Query Frame = 3
Query: 1017 FMEGVS--KVSAVLDVTEMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPM--SPTEHHSNLILDGEMVIDIVKDIGFPRFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEKR---KFLPQDAKAQESFGILMKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIYNKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
            F+EG++   V+ V    ++  +++  + + + +K GFPG QPVSM  +N+  L++  Y VSWK DG RYM+V+ G D VYMLDRDN VF +  L FP    P  H SN +LDGEM+ID V     PR+LI+DI+  N   VG  +F  RL  I+ EII  R       Q  K +E F +  K F+DI  + KL +G F  ++ HE+DGLIFQP  +   Y +G+    LKWKPP  NS+DF LK   V  +G   + VG L+V     PFAK++  + ++ ++Y+NKI+EC +   +  W  +R+R DKS PN    A  + +SI  PV
Sbjct:  154 FLEGITVKGVTQVTSQPKLGEIQRMCQKMAEWDKSGFPGAQPVSMDRQNLNFLSQNPYKVSWKADGTRYMMVINGKDEVYMLDRDNSVFHIANLEFPFRKDPRVHLSNTLLDGEMIIDKVNGQPVPRYLIYDIIKFNGQPVGQCDFNIRLLCIEKEIISPRMEKMKTGQIDKTKEPFSVRNKPFFDIHASRKLLEGSFTSQVSHEVDGLIFQPCGR---YKAGRCDDILKWKPPNLNSVDFRLKITKVGGEGLLTQTVGLLYVGNYDMPFAKMK--ATKELKQYDNKIIECTF--ANNTWVFMRQRVDKSFPNSYDTAMAVCKSIQEPV 475          

HSP 2 Score: 85.1149 bits (209), Expect = 7.356e-17
Identity = 40/100 (40.00%), Postives = 56/100 (56.00%), Query Frame = 3
Query:  315 HETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGL-RKIYDFDGKLIAPKRPEWA 611
            H   P ++    F  +C  F  +   ++IGVHCTHG+NRTGF++ ++L EK D   + AV  F  AR PGI++ DYL  L R+  D      AP  P+W 
Sbjct:   13 HGECPSKEITATFTRLCELFIQKNPSELIGVHCTHGFNRTGFLICAYLVEKMDWSTEAAVATFTLARAPGIYKGDYLKELFRRYGDEKDAPPAPALPDWC 112          
BLAST of mRNA-capping enzyme vs. Ensembl Medaka
Match: rngtt (RNA guanylyltransferase and 5'-phosphatase [Source:NCBI gene;Acc:101173353])

HSP 1 Score: 238.81 bits (608), Expect = 1.662e-69
Identity = 136/329 (41.34%), Postives = 193/329 (58.66%), Query Frame = 3
Query: 1017 FMEGVS--KVSAVLDVTEMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPM--SPTEHHSNLILDGEMVIDIVKDIGFPRFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEKR---KFLPQDAKAQESFGILMKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIYNKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
            F+EG++   V+ V    ++  +++  + + + +K GFPG QPVSM  +N+  L++  Y VSWK DG RYM+V+ G D VYMLDRDN VF +  L FP    P  H SN +LDGEM+ID V     PR+LI+DI+  N   VG  +F  RL  I+ EII  R       Q  K +E F +  K F+DI  + KL +G F  ++ HE+DGLIFQP  +   Y +G+    LKWKPP  NS+DF LK   V  +G   + VG L+V     PFAK++  + ++ ++Y+NKI+EC +   +  W  +R+R DKS PN    A  + +SI  PV
Sbjct:  235 FLEGITVKGVTQVTSQPKLGEIQRMCQKMAEWDKSGFPGAQPVSMDRQNLNFLSQNPYKVSWKADGTRYMMVINGKDEVYMLDRDNSVFHIANLEFPFRKDPRVHLSNTLLDGEMIIDKVNGQPVPRYLIYDIIKFNGQPVGQCDFNIRLLCIEKEIISPRMEKMKTGQIDKTKEPFSVRNKPFFDIHASRKLLEGSFTSQVSHEVDGLIFQPCGR---YKAGRCDDILKWKPPNLNSVDFRLKITKVGGEGLLTQTVGLLYVGNYDMPFAKMK--ATKELKQYDNKIIECTF--ANNTWVFMRQRVDKSFPNSYDTAMAVCKSIQEPV 556          

HSP 2 Score: 149.058 bits (375), Expect = 1.889e-37
Identity = 75/188 (39.89%), Postives = 112/188 (59.57%), Query Frame = 3
Query:   60 PPSKWLDCPNIGTIIHDMFVPFKTPLDQKFDPEIPPANRFSLTSFLASKKSEKV--GMIVNLTNTKKYYNVNELDG-IIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGL-RKIYDFDGKLIAPKRPEWA 611
            PP +WL+CP  G II D F+P KT L  ++D ++  ANRF  +      KS KV  G++V+LTNT ++Y+ N+++   I+Y ++  +GH   P ++    F  +C  F  +   ++IGVHCTHG+NRTGF++ ++L EK D   + AV  F  AR PGI++ DYL  L R+  D      AP  P+W 
Sbjct:    6 PPPRWLNCPRKGHIIADKFLPMKTMLGPRYDDQVEEANRFHPSMLFNHLKSLKVKMGLLVDLTNTNRFYDRNDIEKEGIKYVKLACKGHGECPSKEITATFTRLCELFIQKNPSELIGVHCTHGFNRTGFLICAYLVEKMDWSTEAAVATFTLARAPGIYKGDYLKELFRRYGDEKDAPPAPALPDWC 193          
BLAST of mRNA-capping enzyme vs. Ensembl Medaka
Match: rngtt (RNA guanylyltransferase and 5'-phosphatase [Source:NCBI gene;Acc:101173353])

HSP 1 Score: 238.81 bits (608), Expect = 2.915e-69
Identity = 136/329 (41.34%), Postives = 193/329 (58.66%), Query Frame = 3
Query: 1017 FMEGVS--KVSAVLDVTEMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPM--SPTEHHSNLILDGEMVIDIVKDIGFPRFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEKR---KFLPQDAKAQESFGILMKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIYNKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
            F+EG++   V+ V    ++  +++  + + + +K GFPG QPVSM  +N+  L++  Y VSWK DG RYM+V+ G D VYMLDRDN VF +  L FP    P  H SN +LDGEM+ID V     PR+LI+DI+  N   VG  +F  RL  I+ EII  R       Q  K +E F +  K F+DI  + KL +G F  ++ HE+DGLIFQP  +   Y +G+    LKWKPP  NS+DF LK   V  +G   + VG L+V     PFAK++  + ++ ++Y+NKI+EC +   +  W  +R+R DKS PN    A  + +SI  PV
Sbjct:  261 FLEGITVKGVTQVTSQPKLGEIQRMCQKMAEWDKSGFPGAQPVSMDRQNLNFLSQNPYKVSWKADGTRYMMVINGKDEVYMLDRDNSVFHIANLEFPFRKDPRVHLSNTLLDGEMIIDKVNGQPVPRYLIYDIIKFNGQPVGQCDFNIRLLCIEKEIISPRMEKMKTGQIDKTKEPFSVRNKPFFDIHASRKLLEGSFTSQVSHEVDGLIFQPCGR---YKAGRCDDILKWKPPNLNSVDFRLKITKVGGEGLLTQTVGLLYVGNYDMPFAKMK--ATKELKQYDNKIIECTF--ANNTWVFMRQRVDKSFPNSYDTAMAVCKSIQEPV 582          

HSP 2 Score: 139.043 bits (349), Expect = 4.661e-34
Identity = 75/214 (35.05%), Postives = 112/214 (52.34%), Query Frame = 3
Query:   60 PPSKWLDCPNIGTIIHDMFVPFKTPLDQKFDPEIPPANRFSLTSFLASKKSEKV----------------------------GMIVNLTNTKKYYNVNELDG-IIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGL-RKIYDFDGKLIAPKRPEWA 611
            PP +WL+CP  G II D F+P KT L  ++D ++  ANRF  +      KS KV                            G++V+LTNT ++Y+ N+++   I+Y ++  +GH   P ++    F  +C  F  +   ++IGVHCTHG+NRTGF++ ++L EK D   + AV  F  AR PGI++ DYL  L R+  D      AP  P+W 
Sbjct:    6 PPPRWLNCPRKGHIIADKFLPMKTMLGPRYDDQVEEANRFHPSMLFNHLKSLKVGHSAPLAVELLNLLKAPFIVLFIHQVKMGLLVDLTNTNRFYDRNDIEKEGIKYVKLACKGHGECPSKEITATFTRLCELFIQKNPSELIGVHCTHGFNRTGFLICAYLVEKMDWSTEAAVATFTLARAPGIYKGDYLKELFRRYGDEKDAPPAPALPDWC 219          
BLAST of mRNA-capping enzyme vs. Ensembl Medaka
Match: dusp11 (dual specificity phosphatase 11 [Source:NCBI gene;Acc:101156622])

HSP 1 Score: 100.138 bits (248), Expect = 1.605e-22
Identity = 57/173 (32.95%), Postives = 95/173 (54.91%), Query Frame = 3
Query:   57 DPPSKWLDCPNIGTIIHDM-FVPFKTPLDQKFDPEIPPANRFSLTSFL--ASKKSEKVGMIVNLTNTKKYYNVNELDGIIRYDQIFLEGHETYPDQKQVDKFIVICSYFF--DRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRK 560
            D P +WLD   +G  +    F+ FK PL Q     +P ++ F     L   S+  +++G+I++LT T +YY++ +L   + + +IF  GH+  P    +  F    + F   ++  DK+IGVHCTHG NRTG+++  +L +   ++   AV+LF  +R   I RQ+YL  L +
Sbjct:   11 DIPDRWLDYTAVGRRLQGTRFIAFKVPLKQALTRMLPRSSVFGPWELLDAVSRDRQELGLIIDLTFTSRYYDLQDLPASLMFVKIFTAGHQV-PSDGTILSFKRAVNNFLRDNQDNDKLIGVHCTHGLNRTGYLICRYLIDVDGMDPAEAVKLFNSSRGHAIERQNYLKDLHR 182          
BLAST of mRNA-capping enzyme vs. Ensembl Medaka
Match: dusp11 (dual specificity phosphatase 11 [Source:NCBI gene;Acc:101156622])

HSP 1 Score: 97.8265 bits (242), Expect = 1.672e-21
Identity = 55/169 (32.54%), Postives = 93/169 (55.03%), Query Frame = 3
Query:   69 KWLDCPNIGTIIHDM-FVPFKTPLDQKFDPEIPPANRFSLTSFL--ASKKSEKVGMIVNLTNTKKYYNVNELDGIIRYDQIFLEGHETYPDQKQVDKFIVICSYFF--DRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRK 560
            +WLD   +G  +    F+ FK PL Q     +P ++ F     L   S+  +++G+I++LT T +YY++ +L   + + +IF  GH+  P    +  F    + F   ++  DK+IGVHCTHG NRTG+++  +L +   ++   AV+LF  +R   I RQ+YL  L +
Sbjct:   56 RWLDYTAVGRRLQGTRFIAFKVPLKQALTRMLPRSSVFGPWELLDAVSRDRQELGLIIDLTFTSRYYDLQDLPASLMFVKIFTAGHQV-PSDGTILSFKRAVNNFLRDNQDNDKLIGVHCTHGLNRTGYLICRYLIDVDGMDPAEAVKLFNSSRGHAIERQNYLKDLHR 223          
BLAST of mRNA-capping enzyme vs. Planmine SMEST
Match: SMESG000080877.1 (SMESG000080877.1)

HSP 1 Score: 798.119 bits (2060), Expect = 0.000e+0
Identity = 398/462 (86.15%), Postives = 402/462 (87.01%), Query Frame = 3
Query:   30 MARGYRGNFDPPSKWLDCPNIGTIIHDMFVPFKTPLDQKFDPEIPPANRFSLTSFLASKKSEKVGMIVNLTNTKKYYNVNELDGIIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRKIYDFDGKLIAPKRPEWASLEEKKELCYVQHSLNVDKEDTKQLSQPKETSRSPKSHEIQDMEACEVERMETEVIDSASNLTEFKITSLPEKQIEIPQSCIIEKVVAAKPSIIEKIEDIGKNIISSVTSALSEQSVKIVSIPPSATFCPPKVPKFMEGVSKVSAVLDVTEMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPMSPTEHHSNLILDGEMVIDIVKDIGFPRFLIFDIVCIN 1415
            MARGYRGNFDPPSKWLDCPNIGTIIHDMFVPFKTPLDQKFDPEIPPANRFSLTSFLASKKSEKVGMIVNLTNTKKYYNVNELDGIIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRKIYDFDGKLIAPKRPEWASLEEKKELCYVQHSLNVDKEDTKQLSQPKETSRSPKSHEIQDMEA    R                            +SC  +  V +                     ALSEQSVKIVSIPPSATFCPPKVPKFMEGVSKVSAVLDVTEMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPMSPTEHHSNLILDGEMVIDIVKDIGFPRFLIFDI+  N
Sbjct:    1 MARGYRGNFDPPSKWLDCPNIGTIIHDMFVPFKTPLDQKFDPEIPPANRFSLTSFLASKKSEKVGMIVNLTNTKKYYNVNELDGIIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRKIYDFDGKLIAPKRPEWASLEEKKELCYVQHSLNVDKEDTKQLSQPKETSRSPKSHEIQDMEAFMYYR----------------------------KSCSCQANVTS---------------------ALSEQSVKIVSIPPSATFCPPKVPKFMEGVSKVSAVLDVTEMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPMSPTEHHSNLILDGEMVIDIVKDIGFPRFLIFDIIISN 413          
BLAST of mRNA-capping enzyme vs. Planmine SMEST
Match: SMESG000024208.1 (SMESG000024208.1)

HSP 1 Score: 322.783 bits (826), Expect = 6.347e-104
Identity = 161/337 (47.77%), Postives = 232/337 (68.84%), Query Frame = 3
Query:  975 IPPSATFCPPKVPKFMEGVSKVSAVLDVTEMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPMSPTEHHSNLILDGEMVIDIVKDIGFPRFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEKR-KFLPQDAKAQESFGILMKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIYNKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
            +P +       +P FMEGVS VS V +   +  +++ VR+LM   KFGF G QPVSM  EN++ L +KK++VSWKPDG RY+++++    VYM DR+N V++V+ + FP S  + H + ++DGEMVIDI  +  FPR+LI+D++ ++   VG   F  RL +IK+ II+ R KF+  D K++ESFG+ +KDFW I   + LW+G F+ KL H+MDGLIFQ A + D Y  G+ +  LKWKP E NS+DF LKCE+ + + ++    G L+V  ++E FAKI++ISRE REKYNNKI+EC Y+   K W +IRER+DKS PN+++ A ++M+SIL PV
Sbjct:   48 VPKTKPVKAATIPSFMEGVSGVSPVTEEDVIGELQKKVRDLMNSKKFGFVGCQPVSMMRENLESLKEKKFMVSWKPDGTRYIMLILSDSKVYMFDRNNCVYKVDNINFPNSKNKGHFDTLVDGEMVIDIYNEKRFPRYLIYDVMSLDGKYVGNKIFVERLKIIKNFIIDCRNKFVRTDKKSKESFGVRIKDFWPINRAKDLWEGQFRTKLSHKMDGLIFQQAGENDFYEQGRCYSILKWKPAELNSVDFHLKCEHQRGENKESTNTGYLYV-SEREHFAKIDNISRELREKYNNKIVECTYDVEKKIWTIIRERSDKSFPNHISTAKSVMKSILEPV 383          
BLAST of mRNA-capping enzyme vs. Planmine SMEST
Match: SMESG000024237.1 (SMESG000024237.1)

HSP 1 Score: 287.345 bits (734), Expect = 1.771e-89
Identity = 146/336 (43.45%), Postives = 209/336 (62.20%), Query Frame = 3
Query:  975 IPPSATFCPPKVPKFMEGVSKVSAVLDVTEMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPMSPTEHHSNLILDGEMVIDIVKDIGFPRFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEKRKFLPQDAKAQESFGILMKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIYNKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
            +P +       +P FMEGVS VS V +   +E +++ VR+LM   KFGF G QPVSM  EN++ L +KK++VSWKPDG RY+++++    VYM DR+N V++V+ + FP S  + H + ++DGEMVIDI  +                                    ++ KF+  D K+ ESFG+ +KDFW I   + LW+G F+ KL H+MDGLIFQ A + D Y  G+ +  LKWKP E NS+DF LKCE+ + + ++    G L+V  ++E FAKI++ISRE REKYNNKI+EC Y+   K W +IRER+DKS PN+++ A ++M+SIL PV
Sbjct:   48 VPKTKPVKAATIPSFMEGVSGVSPVTEEDVIEELQKKVRDLMNSKKFGFVGCQPVSMMRENLESLKEKKFMVSWKPDGTRYIMLILSDSKVYMFDRNNCVYKVDNINFPNSKNKGHFDTLVDGEMVIDIYNE------------------------------------KRNKFVRTDKKSNESFGVRIKDFWPINRAKDLWEGQFRTKLSHKMDGLIFQQAGENDFYEQGRCYSILKWKPAELNSVDFHLKCEHQRGENKESTNTGYLYV-SEREHFAKIDNISRELREKYNNKIVECTYDVEKKIWTIIRERSDKSFPNHISTAKSVMKSILEPV 346          
BLAST of mRNA-capping enzyme vs. Planmine SMEST
Match: SMESG000080735.1 (SMESG000080735.1)

HSP 1 Score: 140.198 bits (352), Expect = 1.145e-38
Identity = 66/124 (53.23%), Postives = 88/124 (70.97%), Query Frame = 3
Query: 1611 MDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIYNKISKKWELIRERTDKSSPNYVTVANNIMESILNPV 1982
            MDGLIFQP   +D Y  G     LKWKPPE NSIDF L+CEY       P +VG L+V+G++  F KI+ I ++ REKYNNKI+EC+ N+ + +W +IRERTDKS PN+++ A +++ESI NPV
Sbjct:    1 MDGLIFQPCGPDDFYEPGTCPFILKWKPPELNSIDFLLRCEYETGVDIVPNFVGKLYVSGEKMFFGKIDHIKKDLREKYNNKIVECVLNRTTLQWVIIRERTDKSKPNHISTAKSVLESIGNPV 124          
BLAST of mRNA-capping enzyme vs. Planmine SMEST
Match: SMESG000080768.1 (SMESG000080768.1)

HSP 1 Score: 119.398 bits (298), Expect = 1.677e-27
Identity = 57/182 (31.32%), Postives = 105/182 (57.69%), Query Frame = 3
Query:   63 PSKWLDCPNIGTIIHDMFVPFKTPLDQKFDPEIPPANRFSLTSFLASKKSEKVGMIVNLTNTKKYYNVNELDGIIRYDQIFLEGHETYPDQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLELDVAVELFAKARPPGIFRQDYLDGLRKIYDFDGKLIAPKRPEW 608
            P  W+  P  G +I D+F P KT LD+++   +  +N F++  F    +  ++ ++++L +++KYY   ++  +++  +I + G E  P  K +  FI I +   +   +  I VHCT GYN TGFM+V++L  +  ++L+ A+E+FAK+RPPGI+   +L  L  ++  +  +  P  P+W
Sbjct:    7 PRGWIHSPRRGYMIADLFYPMKTVLDERYKDLVTESNSFNVGYFTEQAEMYQIVLLIDLIDSEKYYKSKDMKDVLQI-KITVPGLEALPTSKHITAFIKIVNKNIELDKEGKIAVHCTQGYNLTGFMIVNYLVTQRGMQLNEALEIFAKSRPPGIYNPAFLKHLLNLHQPNLPIHYPTPPKW 187          

HSP 2 Score: 116.316 bits (290), Expect = 1.350e-26
Identity = 102/381 (26.77%), Postives = 174/381 (45.67%), Query Frame = 3
Query:  819 LPEKQIEIPQSC----IIEKVVAAKPSIIEKIEDIGKNIISSVTSALSEQSVKIVSIPPSATF--CPPKV--PKFMEGVSKVSAVLDVTEMENVRQHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVVIGSDIVYMLDRDNFVFRVERLYFPMSPTEHH--SNLILDGEMVIDIVKDIGFPRFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEKRKFLPQDAKAQESFGILMKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHSLKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISREDREKYNNKIMECIYNKISKKWELIRERTDKSSP 1931
            LPE + +  +SC    +I   V  K      +ED      S  T +L ++    +SI P       P K+  P+F+  ++    + D   +  +R+ ++ L+K   +GF G +   +T +       K++  +W+ DG RY++ +I    +YM+D  N  F++E L FP    +     N ++DGE+V + +    +  FLI DI  +  + +   ++  RL  I+  I + RK         E F I++K   + +     W    +  + HEM GLIF P         G+    + W P     I F LK   + K  QK  ++G LF  G  EPF KI  ++ +++E Y+ KI+ C  NK   +W + +   D + P
Sbjct:  467 LPELEDKKEESCSKAELIHSPVIGKKRSSALLED------SFKTGSLKKRRTDDISIEPECKLEIKPKKIERPEFLVYMN----LKDEKTVFRLREELQYLLKTTMYGFVGHKYKLLTGKYYNHFMSKEFYHTWRTDGKRYLMFIINESHIYMIDEQNRYFKIENLKFPHPHRKGKFLINTVIDGELVAETISSKTYYLFLISDIYALGGIRLYHESYSKRLDKIQEFITDVRKERIDLKSVVEPFDIMIKTISESRELVNTW-VRLRKTIPHEMTGLIFYPYNDISYTFLGRATIYI-WIPTFSRYIKFKLKA-VIDKHNQK--WIGLLFAYGTLEPFTKIRYLTTKEKETYDGKIVRCYLNK--GRWNISKHNPDDTIP 830          
The following BLAST results are available for this feature:
BLAST of mRNA-capping enzyme vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RNGTT1.754e-7244.85RNA guanylyltransferase and 5'-phosphatase [Source... [more]
RNGTT8.144e-5940.61RNA guanylyltransferase and 5'-phosphatase [Source... [more]
RNGTT9.810e-4139.92RNA guanylyltransferase and 5'-phosphatase [Source... [more]
DUSP111.647e-2329.07dual specificity phosphatase 11 [Source:HGNC Symbo... [more]
DUSP117.565e-1733.81dual specificity phosphatase 11 [Source:HGNC Symbo... [more]
back to top
BLAST of mRNA-capping enzyme vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cel-17.911e-6540.42mRNA-capping enzyme Polynucleotide 5'-triphosphata... [more]
cel-19.762e-6540.42mRNA-capping enzyme Polynucleotide 5'-triphosphata... [more]
cel-19.762e-6540.42mRNA-capping enzyme Polynucleotide 5'-triphosphata... [more]
pir-14.546e-2032.74RNA/RNP complex-1-interacting phosphatase homolog ... [more]
F54C8.41.311e-1626.74Probable tyrosine-protein phosphatase F54C8.4 [So... [more]
back to top
BLAST of mRNA-capping enzyme vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mRNA-cap5.812e-10934.09gene:FBgn0030556 transcript:FBtr0073922[more]
CG131972.733e-2031.21gene:FBgn0062449 transcript:FBtr0088078[more]
CG131972.733e-2031.21gene:FBgn0062449 transcript:FBtr0345619[more]
back to top
BLAST of mRNA-capping enzyme vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rngtt3.271e-7041.95RNA guanylyltransferase and 5'-phosphatase [Source... [more]
dusp111.512e-2133.73dual specificity phosphatase 11 (RNA/RNP complex 1... [more]
back to top
BLAST of mRNA-capping enzyme vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mgc1476002.436e-4837.24RAS and EF-hand domain containing [Source:Xenbase;... [more]
mgc1476001.417e-4637.00RAS and EF-hand domain containing [Source:Xenbase;... [more]
mgc1476003.218e-4535.78RAS and EF-hand domain containing [Source:Xenbase;... [more]
mgc1476004.532e-4535.78RAS and EF-hand domain containing [Source:Xenbase;... [more]
mgc1476002.514e-4435.47RAS and EF-hand domain containing [Source:Xenbase;... [more]
back to top
BLAST of mRNA-capping enzyme vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Rngtt8.368e-7143.33RNA guanylyltransferase and 5'-phosphatase [Source... [more]
Rngtt2.284e-6842.59RNA guanylyltransferase and 5'-phosphatase [Source... [more]
Dusp114.132e-2535.67dual specificity phosphatase 11 (RNA/RNP complex 1... [more]
Dusp113.506e-1938.46dual specificity phosphatase 11 (RNA/RNP complex 1... [more]
back to top
BLAST of mRNA-capping enzyme vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O60942|MCE1_HUMAN8.423e-7244.85mRNA-capping enzyme OS=Homo sapiens OX=9606 GN=RNG... [more]
sp|O55236|MCE1_MOUSE5.853e-7043.33mRNA-capping enzyme OS=Mus musculus OX=10090 GN=Rn... [more]
sp|Q6NY98|MCE1_DANRE2.469e-6941.95mRNA-capping enzyme OS=Danio rerio OX=7955 GN=rngt... [more]
sp|Q17607|MCE1_CAEEL1.242e-6340.42mRNA-capping enzyme OS=Caenorhabditis elegans OX=6... [more]
sp|Q6BT58|MCE1_DEBHA7.823e-2728.93mRNA-capping enzyme subunit alpha OS=Debaryomyces ... [more]
back to top
BLAST of mRNA-capping enzyme vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A084W2G91.692e-10535.16mRNA-capping enzyme OS=Anopheles sinensis OX=74873... [more]
Q9VY441.727e-10534.09mRNA-capping enzyme OS=Drosophila melanogaster OX=... [more]
A0A1I8NM931.942e-10535.09mRNA-capping enzyme OS=Stomoxys calcitrans OX=3557... [more]
B4R4N67.707e-10533.94mRNA-capping enzyme OS=Drosophila simulans OX=7240... [more]
A0A4E0RTK92.015e-10432.85mRNA-capping enzyme OS=Fasciola hepatica OX=6192 G... [more]
back to top
BLAST of mRNA-capping enzyme vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rngtt1.504e-5341.83RNA guanylyltransferase and 5'-phosphatase [Source... [more]
rngtt3.897e-3538.62RNA guanylyltransferase and 5'-phosphatase [Source... [more]
dusp115.897e-1429.66dual specificity phosphatase 11 (RNA/RNP complex 1... [more]
back to top
BLAST of mRNA-capping enzyme vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rngtt2.639e-5536.06RNA guanylyltransferase and 5'-phosphatase [Source... [more]
rngtt1.810e-4140.93RNA guanylyltransferase and 5'-phosphatase [Source... [more]
rngtt6.514e-4138.30RNA guanylyltransferase and 5'-phosphatase [Source... [more]
dusp112.846e-2635.64dual specificity phosphatase 11 (RNA/RNP complex 1... [more]
back to top
BLAST of mRNA-capping enzyme vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CEG13.279e-2128.41Guanylyltransferase involved in mRNA 5' capping; s... [more]
back to top
BLAST of mRNA-capping enzyme vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO400944.670e-5940.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476095.472e-1832.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of mRNA-capping enzyme vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rngtt1.579e-7041.34RNA guanylyltransferase and 5'-phosphatase [Source... [more]
rngtt1.662e-6941.34RNA guanylyltransferase and 5'-phosphatase [Source... [more]
rngtt2.915e-6941.34RNA guanylyltransferase and 5'-phosphatase [Source... [more]
dusp111.605e-2232.95dual specificity phosphatase 11 [Source:NCBI gene;... [more]
dusp111.672e-2132.54dual specificity phosphatase 11 [Source:NCBI gene;... [more]
back to top
BLAST of mRNA-capping enzyme vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080877.10.000e+086.15SMESG000080877.1[more]
SMESG000024208.16.347e-10447.77SMESG000024208.1[more]
SMESG000024237.11.771e-8943.45SMESG000024237.1[more]
SMESG000080735.11.145e-3853.23SMESG000080735.1[more]
SMESG000080768.11.677e-2731.32SMESG000080768.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014011 ID=SMED30014011|Name=mRNA-capping enzyme|organism=Schmidtea mediterranea sexual|type=transcript|length=2087bp
TCTTCCGATCTGTTTACTAAAATAAATTTATGGCTAGAGGTTATCGAGGT
AATTTTGATCCACCGTCTAAATGGTTAGATTGCCCAAATATTGGGACTAT
TATACACGACATGTTTGTTCCATTTAAAACCCCTTTAGACCAAAAATTTG
ATCCTGAAATTCCTCCGGCCAACCGATTTTCATTGACTTCTTTTTTAGCG
TCAAAAAAATCAGAAAAGGTGGGCATGATAGTAAATTTAACCAACACTAA
AAAATATTACAACGTAAATGAGTTGGATGGTATTATAAGATATGACCAAA
TTTTCCTTGAAGGCCATGAAACCTACCCAGATCAAAAGCAAGTTGATAAA
TTTATTGTGATTTGCAGCTATTTCTTTGACCGGTTTGGAGATAAAGTTAT
CGGTGTTCATTGCACTCACGGATACAACCGAACGGGATTTATGGTTGTAT
CATTTTTGTGTGAAAAATGTGATTTAGAGCTTGATGTTGCTGTTGAGCTA
TTTGCGAAAGCGCGACCTCCAGGAATTTTTAGGCAAGACTATTTGGATGG
CTTAAGGAAAATCTATGATTTTGATGGAAAATTAATTGCCCCAAAAAGAC
CAGAATGGGCCTCGCTTGAAGAGAAAAAGGAATTATGTTACGTTCAACAT
TCTCTAAATGTAGACAAGGAAGATACTAAACAATTATCACAACCAAAAGA
AACTTCCAGATCACCCAAATCACATGAAATTCAAGATATGGAAGCCTGTG
AAGTTGAGAGAATGGAGACAGAAGTCATCGATTCTGCTTCTAATCTGACA
GAATTCAAAATAACTTCATTACCTGAGAAACAAATCGAAATTCCCCAGTC
ATGTATTATAGAAAAAGTTGTAGCTGCCAAGCCAAGTATTATAGAAAAAA
TTGAAGATATTGGCAAGAATATTATTTCAAGTGTAACTAGTGCATTATCA
GAACAGAGTGTAAAAATAGTCTCAATACCACCGTCAGCAACGTTTTGCCC
TCCAAAGGTTCCTAAATTCATGGAAGGAGTGAGTAAAGTTTCCGCAGTAT
TGGATGTGACAGAGATGGAAAATGTACGCCAACATGTTCGAAATTTAATG
AAAGTTAATAAATTTGGCTTTCCAGGCACTCAGCCGGTATCAATGACTCA
TGAAAATGTAAAATTATTAACTAAGAAAAAATATTTGGTAAGCTGGAAAC
CCGACGGAGTCCGTTACATGATCGTTGTGATTGGAAGCGATATCGTGTAC
ATGCTGGACAGGGACAATTTTGTATTCCGAGTTGAGAGACTATATTTCCC
AATGTCACCCACCGAGCATCATTCAAATTTAATCCTGGACGGTGAAATGG
TCATTGATATAGTAAAAGATATCGGATTCCCAAGATTTCTCATTTTTGAC
ATCGTATGCATCAATTCGGTCAATGTCGGGATTTTTAATTTCCCTCACAG
ATTATTTCTAATTAAAAGTGAAATTATTGAGAAAAGAAAGTTTTTACCCC
AAGATGCAAAAGCCCAAGAATCATTTGGTATTCTAATGAAAGATTTTTGG
GACATAAAAACCACTGAAAAGTTATGGGACGGAGATTTTCAGGATAAACT
GCTACATGAAATGGATGGACTGATTTTCCAACCAGCGGAGAAGGAAGATG
TTTATATTTCAGGAAAGAACCACCACAGTTTGAAATGGAAACCTCCAGAA
TATAATTCTATAGATTTCTTTCTCAAATGTGAATATGTCAAAAAGGATGG
TCAGAAACCGAGATATGTGGGAAATCTTTTTGTAAACGGTCAACAAGAAC
CATTCGCAAAGATTGAGGATATTTCAAGAGAAGACAGAGAAAAGTATAAC
AACAAAATTATGGAATGTATTTATAACAAAATATCTAAGAAATGGGAATT
GATCAGAGAACGAACAGATAAGTCCAGCCCTAATTATGTTACGGTGGCAA
ATAATATAATGGAGAGCATTCTGAACCCTGTTTTCATTGACGATATCTAT
AATATCATCAATTCTATAAAGAAATGATATAAAGCAAAAATATTATTTCT
TTAAAAATGGACGTACATTTCAAATACTATGTGAGGG
back to top

protein sequence of SMED30014011-orf-1

>SMED30014011-orf-1 ID=SMED30014011-orf-1|Name=SMED30014011-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=666bp
MARGYRGNFDPPSKWLDCPNIGTIIHDMFVPFKTPLDQKFDPEIPPANRF
SLTSFLASKKSEKVGMIVNLTNTKKYYNVNELDGIIRYDQIFLEGHETYP
DQKQVDKFIVICSYFFDRFGDKVIGVHCTHGYNRTGFMVVSFLCEKCDLE
LDVAVELFAKARPPGIFRQDYLDGLRKIYDFDGKLIAPKRPEWASLEEKK
ELCYVQHSLNVDKEDTKQLSQPKETSRSPKSHEIQDMEACEVERMETEVI
DSASNLTEFKITSLPEKQIEIPQSCIIEKVVAAKPSIIEKIEDIGKNIIS
SVTSALSEQSVKIVSIPPSATFCPPKVPKFMEGVSKVSAVLDVTEMENVR
QHVRNLMKVNKFGFPGTQPVSMTHENVKLLTKKKYLVSWKPDGVRYMIVV
IGSDIVYMLDRDNFVFRVERLYFPMSPTEHHSNLILDGEMVIDIVKDIGF
PRFLIFDIVCINSVNVGIFNFPHRLFLIKSEIIEKRKFLPQDAKAQESFG
ILMKDFWDIKTTEKLWDGDFQDKLLHEMDGLIFQPAEKEDVYISGKNHHS
LKWKPPEYNSIDFFLKCEYVKKDGQKPRYVGNLFVNGQQEPFAKIEDISR
EDREKYNNKIMECIYNKISKKWELIRERTDKSSPNYVTVANNIMESILNP
VFIDDIYNIINSIKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0042025host cell nucleus
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000208testis
PLANA:0002030early male germ cell
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR017074mRNA_cap_enz_bifunc
IPR013846mRNA_cap_enzyme_C
IPR001339mRNA_cap_enzyme
IPR000340Dual-sp_phosphatase_cat-dom
IPR012340NA-bd_OB-fold
IPR029021Prot-tyrosine_phosphatase-like
IPR016130Tyr_Pase_AS
IPR000387TYR_PHOSPHATASE_dom
Vocabulary: molecular function
TermDefinition
GO:0004484mRNA guanylyltransferase activity
GO:0008138protein tyrosine/serine/threonine phosphatase activity
GO:0004725protein tyrosine phosphatase activity
GO:0016791phosphatase activity
GO:0000166nucleotide binding
GO:0004651polynucleotide 5'-phosphatase activity
GO:0005525GTP binding
GO:0016740transferase activity
GO:0016779nucleotidyltransferase activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006397mRNA processing
GO:00063707-methylguanosine mRNA capping
GO:0006470protein dephosphorylation
GO:0016311dephosphorylation
GO:0035335peptidyl-tyrosine dephosphorylation
GO:0098507polynucleotide 5' dephosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.30.470.30coord: 332..554
e-value: 2.9E-60
score: 205.8
NoneNo IPR availableGENE3DG3DSA:2.40.50.140coord: 555..651
e-value: 5.0E-27
score: 95.9
NoneNo IPR availablePANTHERPTHR10367MRNA-CAPPING ENZYMEcoord: 10..664
NoneNo IPR availableCDDcd07895Adenylation_mRNA_cappingcoord: 347..555
e-value: 1.71285E-64
score: 210.177
NoneNo IPR availableCDDcd17664Mce1_Ncoord: 14..175
e-value: 2.92593E-60
score: 197.133
NoneNo IPR availableSUPERFAMILYSSF56091DNA ligase/mRNA capping enzyme, catalytic domaincoord: 341..555
IPR017074mRNA capping enzyme, bifunctionalPIRSFPIRSF036958mRNA_capping_HCEcoord: 321..665
e-value: 2.9E-94
score: 314.0
coord: 2..284
e-value: 5.7E-65
score: 217.2
IPR001339mRNA capping enzyme, catalytic domainPFAMPF01331mRNA_cap_enzymecoord: 368..554
e-value: 3.5E-52
score: 177.1
IPR013846mRNA capping enzyme, C-terminalPFAMPF03919mRNA_cap_Ccoord: 559..656
e-value: 1.3E-17
score: 64.4
IPR000340Dual specificity phosphatase, catalytic domainPFAMPF00782DSPccoord: 56..169
e-value: 1.4E-7
score: 31.4
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 4..200
e-value: 5.8E-50
score: 172.0
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 11..181
IPR016130Protein-tyrosine phosphatase, active sitePROSITEPS00383TYR_PHOSPHATASE_1coord: 126..136
IPR000387Tyrosine specific protein phosphatases domainPROSITEPS50056TYR_PHOSPHATASE_2coord: 106..173
score: 10.424
IPR012340Nucleic acid-binding, OB-foldSUPERFAMILYSSF50249Nucleic acid-binding proteinscoord: 558..664