Huntingtin-interacting protein 1

Overview
NameHuntingtin-interacting protein 1
Smed IDSMED30014010
Length (bp)3178
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Huntingtin-interacting protein 1 (SMED30014010) t-SNE clustered cells

Violin plots show distribution of expression levels for Huntingtin-interacting protein 1 (SMED30014010) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Huntingtin-interacting protein 1 (SMED30014010) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Huntingtin-interacting protein 1 (SMED30014010) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014010

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30014010h1SMcG0012767 dd_Smed_v4_5939_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014010h1SMcG0012767 dd_Smed_v4_5939_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014010h1SMcG0012767 dd_Smed_v4_5939_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014010h1SMcG0012767 dd_Smed_v4_5939_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30014010h1SMcG0012767 dd_Smed_v4_5939_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014010h1SMcG0012767 dd_Smed_v4_5939_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Human
Match: HIP1 (huntingtin interacting protein 1 [Source:HGNC Symbol;Acc:HGNC:4913])

HSP 1 Score: 526.939 bits (1356), Expect = 1.313e-169
Identity = 360/1015 (35.47%), Postives = 551/1015 (54.29%), Query Frame = 3
Query:   84 ENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGK-NVDSLFELGLDILDYLE-ELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEE---PDVDLNNCDSPTDRNSTLIDFNQIDNN---DRFDQIFGE-METFPFNNDERN------------ELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEVKGLVQMKDQYEE-------RLREYESHRHDSVDAEK---------------FNKIKDAYSKLREEHVKKLREQGIDRQQIETNKK---ELESLQKQLEDRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSKYDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILN-NDSGNLYDQINESYYNVYNQSKSFLENIENNDDV-NLSSTRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAG 2984
            E E FE+ Q   I+KAIN+ E A KEKH R  ILGT H  G+  F+   +   L  N ++CWK+ +  HK++RDGH   L D ++   E+  +   WGHL  GYG + S + KLL  K ++H K  + PGNL +   ++ + G+ +V++ F+L +++ DYLE EL +F+ +V +SLD S+S S+T  GQCRL PLIQVI D + LYD +V++LFKLHS L  D L GHR RF++ F  ++D F  +  LQYFK L+Q+P LPENPPNF+  S L    + VV +  E   PD +      P      L+D +    N   ++FD IFG    + PFN + +N             L +EI  LKA +E MK E +  V  L   +  LE ++     ++ Q  +        L E    R D+  A++               ++K+K+ YS+L + H   LR+     +Q+   ++   +LE  +K+LED ++E    + +      +E  ++    ELA +Q +L+  + S   +     N  ++  +L K+ ++L +     ++ E   LS + KEL D++  L  +   + +L    ++M                    ++  + + ++Q I+     L+   L SC  S+D +  T+    + I+ +     + L   E       SI       SD +  G            D + E+      ++ ++L ++E    + N  ST +   L+++K + E +    L+       DL D+E+  T  AI+ A  R + +L +SR+  +G++LEVNE+IL  C  LM AI+VLI  SKD+Q+EI+  G+GT S  +FY K+ +WTEGLISA+KAVG GAT + +AAD ++   GKFEELM+CS EI AST QLV +S+VKA+  S N   L QASRGV+ AT  V+A+  +    +EE  + +FS++TLTQ KR EMDSQV+VLELEN+L+KER++LGELRKKHY+LAG
Sbjct:   32 ERESFERTQTVSINKAINTQEVAVKEKHARTCILGTHHEKGAQTFWSVVNRLPLSSNAVLCWKFCHVFHKLLRDGHPNVLKDSLRYRNELSDMSRMWGHLSEGYGQLCSIYLKLLRTKMEYHTKNPRFPGNLQMSDRQLDEAGESDVNNFFQLTVEMFDYLECELNLFQ-TVFNSLDMSRSVSVTAAGQCRLAPLIQVILDCSHLYDYTVKLLFKLHSCLPADTLQGHRDRFMEQFTKLKDLFYRSSNLQYFKRLIQIPQLPENPPNFLRASALSEHISPVVVIPAEASSPDSE------PVLEKDDLMDMDASQQNLFDNKFDDIFGSSFSSDPFNFNSQNGVNKDEKDHLIERLYREISGLKAQLENMKTESQRVVLQLKGHVSELEADLAEQQHLRQQAADDCEFLRAELDELRRQREDTEKAQRSLSEIERKAQANEQRYSKLKEKYSELVQNHADLLRKNAEVTKQVSMARQAQVDLEREKKELED-SLERISDQGQRKTQEQLEV-LESLKQELATSQRELQVLQGSLETSAQSEANWAAEFAELEKERDSL-VSGAAHREEE---LSALRKELQDTQLKLASTEESMCQLAKDQRKM--------------------LLVGSRKAAEQVIQDALNQLEEPPLISCAGSADHLLSTVTSISSCIEQLEKSWSQYLACPEDISGLLHSITLLAHLTSDAIAHGATTCLRAPPEPADSLTEACKQYGRETLAYLASLEEEGSLENADSTAMRNCLSKIKAIGEELLPRGLDIKQEELGDLVDKEMAATSAAIETATARIEEMLSKSRAGDTGVKLEVNERILGCCTSLMQAIQVLIVASKDLQREIVESGRGTASPKEFYAKNSRWTEGLISASKAVGWGATVMVDAADLVVQGRGKFEELMVCSHEIAASTAQLVAASKVKADKDSPNLAQLQQASRGVNQATAGVVASTISGKSQIEETDNMDFSSMTLTQIKRQEMDSQVRVLELENELQKERQKLGELRKKHYELAG 1013          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Human
Match: HIP1 (huntingtin interacting protein 1 [Source:HGNC Symbol;Acc:HGNC:4913])

HSP 1 Score: 517.694 bits (1332), Expect = 1.920e-166
Identity = 355/1003 (35.39%), Postives = 545/1003 (54.34%), Query Frame = 3
Query:  120 ISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGK-NVDSLFELGLDILDYLE-ELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEE---PDVDLNNCDSPTDRNSTLIDFNQIDNN---DRFDQIFGE-METFPFNNDERN------------ELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEVKGLVQMKDQYEE-------RLREYESHRHDSVDAEK---------------FNKIKDAYSKLREEHVKKLREQGIDRQQIETNKK---ELESLQKQLEDRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSKYDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILN-NDSGNLYDQINESYYNVYNQSKSFLENIENNDDV-NLSSTRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAG 2984
            I+KAIN+ E A KEKH R  ILGT H  G+  F+   +   L  N ++CWK+ +  HK++RDGH   L D ++   E+  +   WGHL  GYG + S + KLL  K ++H K  + PGNL +   ++ + G+ +V++ F+L +++ DYLE EL +F+ +V +SLD S+S S+T  GQCRL PLIQVI D + LYD +V++LFKLHS L  D L GHR RF++ F  ++D F  +  LQYFK L+Q+P LPENPPNF+  S L    + VV +  E   PD +      P      L+D +    N   ++FD IFG    + PFN + +N             L +EI  LKA +E MK E +  V  L   +  LE ++     ++ Q  +        L E    R D+  A++               ++K+K+ YS+L + H   LR+     +Q+   ++   +LE  +K+LED ++E    + +      +E  ++    ELA +Q +L+  + S   +     N  ++  +L K+ ++L +     ++ E   LS + KEL D++  L  +   + +L    ++M                    ++  + + ++Q I+     L+   L SC  S+D +  T+    + I+ +     + L   E       SI       SD +  G            D + E+      ++ ++L ++E    + N  ST +   L+++K + E +    L+       DL D+E+  T  AI+ A  R + +L +SR+  +G++LEVNE+IL  C  LM AI+VLI  SKD+Q+EI+  G+GT S  +FY K+ +WTEGLISA+KAVG GAT + +AAD ++   GKFEELM+CS EI AST QLV +S+VKA+  S N   L QASRGV+ AT  V+A+  +    +EE  + +FS++TLTQ KR EMDSQV+VLELEN+L+KER++LGELRKKHY+LAG
Sbjct:   15 INKAINTQEVAVKEKHARTCILGTHHEKGAQTFWSVVNRLPLSSNAVLCWKFCHVFHKLLRDGHPNVLKDSLRYRNELSDMSRMWGHLSEGYGQLCSIYLKLLRTKMEYHTKNPRFPGNLQMSDRQLDEAGESDVNNFFQLTVEMFDYLECELNLFQ-TVFNSLDMSRSVSVTAAGQCRLAPLIQVILDCSHLYDYTVKLLFKLHSCLPADTLQGHRDRFMEQFTKLKDLFYRSSNLQYFKRLIQIPQLPENPPNFLRASALSEHISPVVVIPAEASSPDSE------PVLEKDDLMDMDASQQNLFDNKFDDIFGSSFSSDPFNFNSQNGVNKDEKDHLIERLYREISGLKAQLENMKTESQRVVLQLKGHVSELEADLAEQQHLRQQAADDCEFLRAELDELRRQREDTEKAQRSLSEIERKAQANEQRYSKLKEKYSELVQNHADLLRKNAEVTKQVSMARQAQVDLEREKKELED-SLERISDQGQRKTQEQLEV-LESLKQELATSQRELQVLQGSLETSAQSEANWAAEFAELEKERDSL-VSGAAHREEE---LSALRKELQDTQLKLASTEESMCQLAKDQRKM--------------------LLVGSRKAAEQVIQDALNQLEEPPLISCAGSADHLLSTVTSISSCIEQLEKSWSQYLACPEDISGLLHSITLLAHLTSDAIAHGATTCLRAPPEPADSLTEACKQYGRETLAYLASLEEEGSLENADSTAMRNCLSKIKAIGEELLPRGLDIKQEELGDLVDKEMAATSAAIETATARIEEMLSKSRAGDTGVKLEVNERILGCCTSLMQAIQVLIVASKDLQREIVESGRGTASPKEFYAKNSRWTEGLISASKAVGWGATVMVDAADLVVQGRGKFEELMVCSHEIAASTAQLVAASKVKADKDSPNLAQLQQASRGVNQATAGVVASTISGKSQIEETDNMDFSSMTLTQIKRQEMDSQVRVLELENELQKERQKLGELRKKHYELAG 984          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Human
Match: HIP1R (huntingtin interacting protein 1 related [Source:HGNC Symbol;Acc:HGNC:18415])

HSP 1 Score: 481.1 bits (1237), Expect = 8.314e-152
Identity = 340/1043 (32.60%), Postives = 553/1043 (53.02%), Query Frame = 3
Query:   45 KVFQQRKKTPTELENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQ--LGKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEEPDVDLNNCDSPTDRNSTLIDFN-------QIDNNDRFDQIFGEMETFPFNN---DERN----ELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEV--------KGLV---------------QMKDQYEERLREYESHRHDSVDAEKFNKIKDAYSKLREEHVKKLREQGIDRQQI---ETNKKELESLQKQLE------DRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLES-----------KNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSKYDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILNN-DSGNLYDQINESYYNVYNQSKSFLENIENNDDVNLSSTRLIKT-LNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAGET 2990
            +V  +R     E E EQF+K Q   ISKAIN+ E   KEKH R +ILGT H  G+  F+ +     L  + I+ WK+ + +HK++RDGH   L D  +    I+ +G+ WGHL   YG +++ ++KLLL K  FH K+ + P  L + +DE+ +   G +V+++F+L +++ DY++  +   +SV   L+ + + S    GQCRL PLIQVIQD + LY  +V++LFKLHS L  D L GHR RF + F S+R+FF+ A  + YFK L+Q+P LPE PPNF+  S      AL  ++  +P V +       +    LI+ +        +   D FDQ FG     P N    D+R+     LK+E+E L++ +E++K+E +  +  L +++  LE E+        K LV               Q++ +  + LRE E+ R  S    ++NK+K+ +S+L   H + LR+     +Q+   + +++E+  +++QL        R  EL KLE+++     +++ ++    ELA AQ  L   E+SK E  ++   L +           +  DLL   ++L  E++     E  R SQ + EL     + +       E GL  + ++EQ             +       A    Q A+ K +  L       C +S D +     +AL  +  +     + L S         ++ +F    +DT+  G   ++    +  D++ ++      ++   +  +++   +      L++T L  +  L + ++  +L+        + D+E+  T  AI+ AV R + ++ Q+R   SG++LEVNE+IL SC +LM AI++L+  S  +QKEI+  G+G  +  +FY K+ +WTEGLISA+KAVG GAT L EAAD ++   GK+EEL++CS EI AST QLV +S+VKAN  S +   L + SR V++    V+A+ K+    +E++ + +FS L+L + K+ EM++QV+VLELE  LE ER RLGELRK+HY LAG +
Sbjct:   10 RVLSRRPGHSLEAEREQFDKTQAISISKAINTQEAPVKEKHARRIILGTHHEKGAFTFWSYAIGLPLPSSSILSWKFCHVLHKVLRDGHPNVLHDCQRYRSNIREIGDLWGHLHDRYGQLVNVYTKLLLTKISFHLKHPQFPAGLEV-TDEVLEKAAGTDVNNIFQLTVEMFDYMDCELKLSESVFRQLNTAIAVSQMSSGQCRLAPLIQVIQDCSHLYHYTVKLLFKLHSCLPADTLQGHRDRFHEQFHSLRNFFRRASDMLYFKRLIQIPRLPEGPPNFLRAS------ALAEHI--KPVVVIPEEAPEDEEPENLIEISTGPPAGEPVVVADLFDQTFG-----PPNGSVKDDRDLQIESLKREVEMLRSELEKIKLEAQRYIAQLKSQVNALEGELEEQRKQKQKALVDNEQLRHELAQLRAAQLEGERSQGLRE-EAERKASATEARYNKLKEKHSELVHVHAELLRKNADTAKQLTVTQQSQEEVARVKEQLAFQVEQVKRESEL-KLEEKSDQLEKLKRELEAKAGELARAQEALSHTEQSKSELSSRLDTLSAEKDALSGAVRQREADLLA-AQSLVRETEAALSREQQRSSQEQGELQGRLAERES-----QEQGLRQRLLDEQFA-----------VLRGAAAEAAGILQDAVSKLDDPLHLR----CTSSPDYLVSRAQEALDAVSTLEEGHAQYLTSLADASALVAALTRFSHLAADTIINGGATSHLAPTDPADRLIDTCRECGARALELMGQLQDQQALRHMQASLVRTPLQGILQLGQELKPKSLDVRQEELGAVVDKEMAATSAAIEDAVRRIEDMMNQARHASSGVKLEVNERILNSCTDLMKAIRLLVTTSTSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVEAADKVVLHTGKYEELIVCSHEIAASTAQLVAASKVKANKHSPHLSRLQECSRTVNERAANVVASTKSGQEQIEDRDTMDFSGLSLIKLKKQEMETQVRVLELEKTLEAERMRLGELRKQHYVLAGAS 1015          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Human
Match: HIP1 (huntingtin interacting protein 1 [Source:HGNC Symbol;Acc:HGNC:4913])

HSP 1 Score: 451.44 bits (1160), Expect = 2.069e-141
Identity = 334/1015 (32.91%), Postives = 513/1015 (50.54%), Query Frame = 3
Query:   84 ENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGK-NVDSLFELGLDILDYLE-ELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEE---PDVDLNNCDSPTDRNSTLIDFNQIDNN---DRFDQIFG-EMETFPFNNDERN------------ELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEVKGLVQMKDQYEE-------RLREYESHRHDSVDA---------------EKFNKIKDAYSKLREEHVKKLREQGIDRQQIETNKK---ELESLQKQLEDRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSKYDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILN-NDSGNLYDQINESYYNVYNQSKSFLENIENNDDV-NLSSTRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAG 2984
            E E FE+ Q   I+KAIN+ E A KEKH R  ILGT H  G+  F+   +   L  N ++CWK+ +  HK++RDGH   L D ++   E+  +   WGHL  GYG + S + KLL  K ++H K  + PGNL +   ++ + G+ +V++ F+L +++ DYLE EL +F+ +V +SLD S+S S+T  GQCRL PLIQVI D + LYD +V++LFKLHS L  D L GHR RF++ F  ++D F  +  LQYFK L+Q+P LPENPPNF+  S L    + VV +  E   PD +      P      L+D +    N   ++FD IFG    + PFN + +N             L +EI  LKA +E MK E +  V  L   +  LE ++     ++ Q  +        L E    R D+  A               ++++K+K+ YS+L + H   LR+     +Q+   ++   +LE  +K+LED ++E    + +      +E  ++    ELA +Q +L+  + S   +     N  ++  +L K+ ++L +     ++ E   LS + KEL D++  L  +   + +L    ++M                    ++  + + ++Q I+     L+   L SC  S+D +  T+    + I+ +     + L   E       SI       SD +  G            D + E+      ++ ++L ++E    + N  ST +   L+++K + E +    L+       DL D+E+  T  AI+ A  R                                                    +GT S  +FY K+ +WTEGLISA+KAVG GAT + +AAD ++   GKFEELM+CS EI AST QLV +S+VKA+  S N   L QASRGV+ AT  V+A+  +    +EE  + +FS++TLTQ KR EMDSQV+VLELEN+L+KER++LGELRKKHY+LAG
Sbjct:   32 ERESFERTQTVSINKAINTQEVAVKEKHARTCILGTHHEKGAQTFWSVVNRLPLSSNAVLCWKFCHVFHKLLRDGHPNVLKDSLRYRNELSDMSRMWGHLSEGYGQLCSIYLKLLRTKMEYHTKNPRFPGNLQMSDRQLDEAGESDVNNFFQLTVEMFDYLECELNLFQ-TVFNSLDMSRSVSVTAAGQCRLAPLIQVILDCSHLYDYTVKLLFKLHSCLPADTLQGHRDRFMEQFTKLKDLFYRSSNLQYFKRLIQIPQLPENPPNFLRASALSEHISPVVVIPAEASSPDSE------PVLEKDDLMDMDASQQNLFDNKFDDIFGSSFSSDPFNFNSQNGVNKDEKDHLIERLYREISGLKAQLENMKTESQRVVLQLKGHVSELEADLAEQQHLRQQAADDCEFLRAELDELRRQREDTEKAQRSLSEIERKAQANEQRYSKLKEKYSELVQNHADLLRKNAEVTKQVSMARQAQVDLEREKKELED-SLERISDQGQRKTQEQLEV-LESLKQELATSQRELQVLQGSLETSAQSEANWAAEFAELEKERDSL-VSGAAHREEE---LSALRKELQDTQLKLASTEESMCQLAKDQRKM--------------------LLVGSRKAAEQVIQDALNQLEEPPLISCAGSADHLLSTVTSISSCIEQLEKSWSQYLACPEDISGLLHSITLLAHLTSDAIAHGATTCLRAPPEPADSLTEACKQYGRETLAYLASLEEEGSLENADSTAMRNCLSKIKAIGEELLPRGLDIKQEELGDLVDKEMAATSAAIETATARI---------------------------------------------------EGTASPKEFYAKNSRWTEGLISASKAVGWGATVMVDAADLVVQGRGKFEELMVCSHEIAASTAQLVAASKVKADKDSPNLAQLQQASRGVNQATAGVVASTISGKSQIEETDNMDFSSMTLTQIKRQEMDSQVRVLELENELQKERQKLGELRKKHYELAG 962          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Human
Match: HIP1 (huntingtin interacting protein 1 [Source:HGNC Symbol;Acc:HGNC:4913])

HSP 1 Score: 108.997 bits (271), Expect = 6.500e-27
Identity = 52/132 (39.39%), Postives = 77/132 (58.33%), Query Frame = 3
Query:  120 ISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGK 515
            I+KAIN+ E A KEKH R  ILGT H  G+  F+   +   L  N ++CWK+ +  HK++RDGH   L D ++   E+  +   WGHL  GYG + S + KLL  K ++H K  + PGNL +   ++ + G+
Sbjct:   15 INKAINTQEVAVKEKHARTCILGTHHEKGAQTFWSVVNRLPLSSNAVLCWKFCHVFHKLLRDGHPNVLKDSLRYRNELSDMSRMWGHLSEGYGQLCSIYLKLLRTKMEYHTKNPRFPGNLQMSDRQLDEAGE 146          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Celegans
Match: hipr-1 (Huntington interacting protein related 1 [Source:UniProtKB/Swiss-Prot;Acc:Q02328])

HSP 1 Score: 229.565 bits (584), Expect = 3.237e-62
Identity = 163/575 (28.35%), Postives = 276/575 (48.00%), Query Frame = 3
Query:   90 EQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKT-GYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQK---ALVVNVAEEPDVDLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFGEMETFPFNNDERNE----LKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEVKGLVQMKDQYEERLREYESHRHDS---------VDA---------------------EKFNKIKDAYSKLREEHVKKLREQGIDRQQIETNKK-------ELESLQKQLEDRNIELAKLEKENLVYASMEKN-IDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIE 1676
            E F + Q   + KAI   E   K KH R +I+GT     S IF+       L  +P++ WK+ + VHK++RDGH +   +  +       L + W HL T GYG  I  + KLL  +  FH KY  VPG L +   ++  L  ++D++FE+ +D+LD ++ L++ +  V + ++  + NS+ PQGQC L+PLI  I D +  YD  V+++FKLHS++  D L GHR RF  +F+  + F++ +  LQYFK LV +PTLP + PNF+ +SDL + +   A + +   E    LN  D        L++  + +          +  +     D R E    L + +E  K   ER+  E R ++     R          L+QM+ +++   RE + +R ++          DA                     E+FNK+K  Y K R EHV  L + G  ++Q+E ++K       E+ +L +++E+   E  +     L  A  +   +D+   +L +A  +++E +R+               +D L++  A Q+     ++    RL+++E
Sbjct:    9 EVFVRAQLEAVQKAITKNEVPLKPKHARTIIVGTHKEKSSGIFWHTVGRIQLEKHPVLTWKFCHLVHKLLRDGHRKVPEETYRYVNRFTQLSQFWKHLNTSGYGPCIESYCKLLHDRVTFHNKYPVVPGKLDLNDSQLKTLEGDLDNMFEMTIDMLDQMDALLVLQDRVYEMMNSLRWNSLIPQGQCMLSPLIIAILDTSKFYDYLVKMIFKLHSQVPPDALEGHRSRFRTIFERTKKFYEESSNLQYFKYLVSIPTLPSHAPNFLQQSDLESYRTPHAYLHSEGSEDGTSLNGHD------GELLNLAEAE---------PQQASPSSQPDPREEQIVMLSRAVEDEKFAKERLIQEARSRIEQYENR----------LLQMQGEFDHAKREADENREEAQRLKNELALRDASRTQTDDARVKEAELKATAAEERFNKMKGVYEKFRSEHVLALTKLGDIQKQLEASEKSKFDKDEEITALNRKVEEAQREAGR----ALTKAEGDAGAVDEMRTQLVKADIEVEELKRT---------------IDHLRESHANQLVQSSAEETNKIRLAELE 539          

HSP 2 Score: 199.519 bits (506), Expect = 2.504e-52
Identity = 127/294 (43.20%), Postives = 180/294 (61.22%), Query Frame = 3
Query: 2115 ESYYNVYNQSKSFLE--NIENNDDVNLSSTRLIKTLNQLKNLSESVRINNLESGNANTDDL---FDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLA 2981
            ESY  V +Q K  L    +  +DD  LS    +K L Q      S+ I+     + + D +    ++E+    +AI  AV   + I  ++R +  GI+LEVNE IL +C  LM  I  L+  S+++Q EI+A GK  GS  +FYK++H+WTEGL+SAAKAVG  A  L E+AD ++T  GKFE L++ ++EI AST QL VSSRVKA+  S     LS A++ V+  T +V+A  KN    L ++GS +FS L+L  AK+ EM+SQVK+LELE  L +ER +L  LRK+HY +A
Sbjct:  621 ESYEGVNDQCKKVLAAAKVAFSDDSALSRADKMKLLRQDIQTLNSLMISLPLQTDIDKDVVGNELEQEMRRMDDAIRRAVQEIEAIQRRARESSDGIRLEVNESILANCQALMSVIMQLVIASRELQTEIVAAGKAGGSPAEFYKRNHQWTEGLLSAAKAVGVAARVLVESADGVVTGKGKFEHLIVAAQEIAASTAQLFVSSRVKADKDSSKLDALSVAAKAVNQNTAQVVAAVKNGQTTLNDEGSLDFSYLSLHAAKKEEMESQVKMLELEQSLNQERAKLAALRKQHYHMA 914          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Celegans
Match: hipr-1 (Huntington interacting protein related 1 [Source:UniProtKB/Swiss-Prot;Acc:Q02328])

HSP 1 Score: 229.565 bits (584), Expect = 3.237e-62
Identity = 163/575 (28.35%), Postives = 276/575 (48.00%), Query Frame = 3
Query:   90 EQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKT-GYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQK---ALVVNVAEEPDVDLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFGEMETFPFNNDERNE----LKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEVKGLVQMKDQYEERLREYESHRHDS---------VDA---------------------EKFNKIKDAYSKLREEHVKKLREQGIDRQQIETNKK-------ELESLQKQLEDRNIELAKLEKENLVYASMEKN-IDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIE 1676
            E F + Q   + KAI   E   K KH R +I+GT     S IF+       L  +P++ WK+ + VHK++RDGH +   +  +       L + W HL T GYG  I  + KLL  +  FH KY  VPG L +   ++  L  ++D++FE+ +D+LD ++ L++ +  V + ++  + NS+ PQGQC L+PLI  I D +  YD  V+++FKLHS++  D L GHR RF  +F+  + F++ +  LQYFK LV +PTLP + PNF+ +SDL + +   A + +   E    LN  D        L++  + +          +  +     D R E    L + +E  K   ER+  E R ++     R          L+QM+ +++   RE + +R ++          DA                     E+FNK+K  Y K R EHV  L + G  ++Q+E ++K       E+ +L +++E+   E  +     L  A  +   +D+   +L +A  +++E +R+               +D L++  A Q+     ++    RL+++E
Sbjct:    9 EVFVRAQLEAVQKAITKNEVPLKPKHARTIIVGTHKEKSSGIFWHTVGRIQLEKHPVLTWKFCHLVHKLLRDGHRKVPEETYRYVNRFTQLSQFWKHLNTSGYGPCIESYCKLLHDRVTFHNKYPVVPGKLDLNDSQLKTLEGDLDNMFEMTIDMLDQMDALLVLQDRVYEMMNSLRWNSLIPQGQCMLSPLIIAILDTSKFYDYLVKMIFKLHSQVPPDALEGHRSRFRTIFERTKKFYEESSNLQYFKYLVSIPTLPSHAPNFLQQSDLESYRTPHAYLHSEGSEDGTSLNGHD------GELLNLAEAE---------PQQASPSSQPDPREEQIVMLSRAVEDEKFAKERLIQEARSRIEQYENR----------LLQMQGEFDHAKREADENREEAQRLKNELALRDASRTQTDDARVKEAELKATAAEERFNKMKGVYEKFRSEHVLALTKLGDIQKQLEASEKSKFDKDEEITALNRKVEEAQREAGR----ALTKAEGDAGAVDEMRTQLVKADIEVEELKRT---------------IDHLRESHANQLVQSSAEETNKIRLAELE 539          

HSP 2 Score: 199.519 bits (506), Expect = 2.504e-52
Identity = 127/294 (43.20%), Postives = 180/294 (61.22%), Query Frame = 3
Query: 2115 ESYYNVYNQSKSFLE--NIENNDDVNLSSTRLIKTLNQLKNLSESVRINNLESGNANTDDL---FDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLA 2981
            ESY  V +Q K  L    +  +DD  LS    +K L Q      S+ I+     + + D +    ++E+    +AI  AV   + I  ++R +  GI+LEVNE IL +C  LM  I  L+  S+++Q EI+A GK  GS  +FYK++H+WTEGL+SAAKAVG  A  L E+AD ++T  GKFE L++ ++EI AST QL VSSRVKA+  S     LS A++ V+  T +V+A  KN    L ++GS +FS L+L  AK+ EM+SQVK+LELE  L +ER +L  LRK+HY +A
Sbjct:  621 ESYEGVNDQCKKVLAAAKVAFSDDSALSRADKMKLLRQDIQTLNSLMISLPLQTDIDKDVVGNELEQEMRRMDDAIRRAVQEIEAIQRRARESSDGIRLEVNESILANCQALMSVIMQLVIASRELQTEIVAAGKAGGSPAEFYKRNHQWTEGLLSAAKAVGVAARVLVESADGVVTGKGKFEHLIVAAQEIAASTAQLFVSSRVKADKDSSKLDALSVAAKAVNQNTAQVVAAVKNGQTTLNDEGSLDFSYLSLHAAKKEEMESQVKMLELEQSLNQERAKLAALRKQHYHMA 914          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Celegans
Match: hipr-1 (Huntington interacting protein related 1 [Source:UniProtKB/Swiss-Prot;Acc:Q02328])

HSP 1 Score: 229.565 bits (584), Expect = 3.237e-62
Identity = 163/575 (28.35%), Postives = 276/575 (48.00%), Query Frame = 3
Query:   90 EQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKT-GYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQK---ALVVNVAEEPDVDLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFGEMETFPFNNDERNE----LKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEVKGLVQMKDQYEERLREYESHRHDS---------VDA---------------------EKFNKIKDAYSKLREEHVKKLREQGIDRQQIETNKK-------ELESLQKQLEDRNIELAKLEKENLVYASMEKN-IDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIE 1676
            E F + Q   + KAI   E   K KH R +I+GT     S IF+       L  +P++ WK+ + VHK++RDGH +   +  +       L + W HL T GYG  I  + KLL  +  FH KY  VPG L +   ++  L  ++D++FE+ +D+LD ++ L++ +  V + ++  + NS+ PQGQC L+PLI  I D +  YD  V+++FKLHS++  D L GHR RF  +F+  + F++ +  LQYFK LV +PTLP + PNF+ +SDL + +   A + +   E    LN  D        L++  + +          +  +     D R E    L + +E  K   ER+  E R ++     R          L+QM+ +++   RE + +R ++          DA                     E+FNK+K  Y K R EHV  L + G  ++Q+E ++K       E+ +L +++E+   E  +     L  A  +   +D+   +L +A  +++E +R+               +D L++  A Q+     ++    RL+++E
Sbjct:    9 EVFVRAQLEAVQKAITKNEVPLKPKHARTIIVGTHKEKSSGIFWHTVGRIQLEKHPVLTWKFCHLVHKLLRDGHRKVPEETYRYVNRFTQLSQFWKHLNTSGYGPCIESYCKLLHDRVTFHNKYPVVPGKLDLNDSQLKTLEGDLDNMFEMTIDMLDQMDALLVLQDRVYEMMNSLRWNSLIPQGQCMLSPLIIAILDTSKFYDYLVKMIFKLHSQVPPDALEGHRSRFRTIFERTKKFYEESSNLQYFKYLVSIPTLPSHAPNFLQQSDLESYRTPHAYLHSEGSEDGTSLNGHD------GELLNLAEAE---------PQQASPSSQPDPREEQIVMLSRAVEDEKFAKERLIQEARSRIEQYENR----------LLQMQGEFDHAKREADENREEAQRLKNELALRDASRTQTDDARVKEAELKATAAEERFNKMKGVYEKFRSEHVLALTKLGDIQKQLEASEKSKFDKDEEITALNRKVEEAQREAGR----ALTKAEGDAGAVDEMRTQLVKADIEVEELKRT---------------IDHLRESHANQLVQSSAEETNKIRLAELE 539          

HSP 2 Score: 199.519 bits (506), Expect = 2.504e-52
Identity = 127/294 (43.20%), Postives = 180/294 (61.22%), Query Frame = 3
Query: 2115 ESYYNVYNQSKSFLE--NIENNDDVNLSSTRLIKTLNQLKNLSESVRINNLESGNANTDDL---FDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLA 2981
            ESY  V +Q K  L    +  +DD  LS    +K L Q      S+ I+     + + D +    ++E+    +AI  AV   + I  ++R +  GI+LEVNE IL +C  LM  I  L+  S+++Q EI+A GK  GS  +FYK++H+WTEGL+SAAKAVG  A  L E+AD ++T  GKFE L++ ++EI AST QL VSSRVKA+  S     LS A++ V+  T +V+A  KN    L ++GS +FS L+L  AK+ EM+SQVK+LELE  L +ER +L  LRK+HY +A
Sbjct:  621 ESYEGVNDQCKKVLAAAKVAFSDDSALSRADKMKLLRQDIQTLNSLMISLPLQTDIDKDVVGNELEQEMRRMDDAIRRAVQEIEAIQRRARESSDGIRLEVNESILANCQALMSVIMQLVIASRELQTEIVAAGKAGGSPAEFYKRNHQWTEGLLSAAKAVGVAARVLVESADGVVTGKGKFEHLIVAAQEIAASTAQLFVSSRVKADKDSSKLDALSVAAKAVNQNTAQVVAAVKNGQTTLNDEGSLDFSYLSLHAAKKEEMESQVKMLELEQSLNQERAKLAALRKQHYHMA 914          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Celegans
Match: hipr-1 (Huntington interacting protein related 1 [Source:UniProtKB/Swiss-Prot;Acc:Q02328])

HSP 1 Score: 229.565 bits (584), Expect = 3.658e-62
Identity = 156/531 (29.38%), Postives = 260/531 (48.96%), Query Frame = 3
Query:   90 EQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKT-GYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQK---ALVVNVAEEPDVDLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFGEMETFPFNNDERNE----LKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEVKGLVQMKDQYEERLREYESHRHDS---------VDA---------------------EKFNKIKDAYSKLREEHVKKLREQGIDRQQIETNKK-------ELESLQKQLEDRNIELAKLEKENLVYASMEKN-IDQYNHELAEAQAKLKEYERS 1544
            E F + Q   + KAI   E   K KH R +I+GT     S IF+       L  +P++ WK+ + VHK++RDGH +   +  +       L + W HL T GYG  I  + KLL  +  FH KY  VPG L +   ++  L  ++D++FE+ +D+LD ++ L++ +  V + ++  + NS+ PQGQC L+PLI  I D +  YD  V+++FKLHS++  D L GHR RF  +F+  + F++ +  LQYFK LV +PTLP + PNF+ +SDL + +   A + +   E    LN  D        L++  + +          +  +     D R E    L + +E  K   ER+  E R ++     R          L+QM+ +++   RE + +R ++          DA                     E+FNK+K  Y K R EHV  L + G  ++Q+E ++K       E+ +L +++E+   E  +     L  A  +   +D+   +L +A  +++E +R+
Sbjct:    9 EVFVRAQLEAVQKAITKNEVPLKPKHARTIIVGTHKEKSSGIFWHTVGRIQLEKHPVLTWKFCHLVHKLLRDGHRKVPEETYRYVNRFTQLSQFWKHLNTSGYGPCIESYCKLLHDRVTFHNKYPVVPGKLDLNDSQLKTLEGDLDNMFEMTIDMLDQMDALLVLQDRVYEMMNSLRWNSLIPQGQCMLSPLIIAILDTSKFYDYLVKMIFKLHSQVPPDALEGHRSRFRTIFERTKKFYEESSNLQYFKYLVSIPTLPSHAPNFLQQSDLESYRTPHAYLHSEGSEDGTSLNGHD------GELLNLAEAE---------PQQASPSSQPDPREEQIVMLSRAVEDEKFAKERLIQEARSRIEQYENR----------LLQMQGEFDHAKREADENREEAQRLKNELALRDASRTQTDDARVKEAELKATAAEERFNKMKGVYEKFRSEHVLALTKLGDIQKQLEASEKSKFDKDEEITALNRKVEEAQREAGRA----LTKAEGDAGAVDEMRTQLVKADIEVEELKRT 510          

HSP 2 Score: 199.519 bits (506), Expect = 2.443e-52
Identity = 127/294 (43.20%), Postives = 180/294 (61.22%), Query Frame = 3
Query: 2115 ESYYNVYNQSKSFLE--NIENNDDVNLSSTRLIKTLNQLKNLSESVRINNLESGNANTDDL---FDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLA 2981
            ESY  V +Q K  L    +  +DD  LS    +K L Q      S+ I+     + + D +    ++E+    +AI  AV   + I  ++R +  GI+LEVNE IL +C  LM  I  L+  S+++Q EI+A GK  GS  +FYK++H+WTEGL+SAAKAVG  A  L E+AD ++T  GKFE L++ ++EI AST QL VSSRVKA+  S     LS A++ V+  T +V+A  KN    L ++GS +FS L+L  AK+ EM+SQVK+LELE  L +ER +L  LRK+HY +A
Sbjct:  621 ESYEGVNDQCKKVLAAAKVAFSDDSALSRADKMKLLRQDIQTLNSLMISLPLQTDIDKDVVGNELEQEMRRMDDAIRRAVQEIEAIQRRARESSDGIRLEVNESILANCQALMSVIMQLVIASRELQTEIVAAGKAGGSPAEFYKRNHQWTEGLLSAAKAVGVAARVLVESADGVVTGKGKFEHLIVAAQEIAASTAQLFVSSRVKADKDSSKLDALSVAAKAVNQNTAQVVAAVKNGQTTLNDEGSLDFSYLSLHAAKKEEMESQVKMLELEQSLNQERAKLAALRKQHYHMA 914          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Celegans
Match: hipr-1 (Huntington interacting protein related 1 [Source:UniProtKB/Swiss-Prot;Acc:Q02328])

HSP 1 Score: 229.565 bits (584), Expect = 3.658e-62
Identity = 156/531 (29.38%), Postives = 260/531 (48.96%), Query Frame = 3
Query:   90 EQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKT-GYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQK---ALVVNVAEEPDVDLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFGEMETFPFNNDERNE----LKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEVKGLVQMKDQYEERLREYESHRHDS---------VDA---------------------EKFNKIKDAYSKLREEHVKKLREQGIDRQQIETNKK-------ELESLQKQLEDRNIELAKLEKENLVYASMEKN-IDQYNHELAEAQAKLKEYERS 1544
            E F + Q   + KAI   E   K KH R +I+GT     S IF+       L  +P++ WK+ + VHK++RDGH +   +  +       L + W HL T GYG  I  + KLL  +  FH KY  VPG L +   ++  L  ++D++FE+ +D+LD ++ L++ +  V + ++  + NS+ PQGQC L+PLI  I D +  YD  V+++FKLHS++  D L GHR RF  +F+  + F++ +  LQYFK LV +PTLP + PNF+ +SDL + +   A + +   E    LN  D        L++  + +          +  +     D R E    L + +E  K   ER+  E R ++     R          L+QM+ +++   RE + +R ++          DA                     E+FNK+K  Y K R EHV  L + G  ++Q+E ++K       E+ +L +++E+   E  +     L  A  +   +D+   +L +A  +++E +R+
Sbjct:    9 EVFVRAQLEAVQKAITKNEVPLKPKHARTIIVGTHKEKSSGIFWHTVGRIQLEKHPVLTWKFCHLVHKLLRDGHRKVPEETYRYVNRFTQLSQFWKHLNTSGYGPCIESYCKLLHDRVTFHNKYPVVPGKLDLNDSQLKTLEGDLDNMFEMTIDMLDQMDALLVLQDRVYEMMNSLRWNSLIPQGQCMLSPLIIAILDTSKFYDYLVKMIFKLHSQVPPDALEGHRSRFRTIFERTKKFYEESSNLQYFKYLVSIPTLPSHAPNFLQQSDLESYRTPHAYLHSEGSEDGTSLNGHD------GELLNLAEAE---------PQQASPSSQPDPREEQIVMLSRAVEDEKFAKERLIQEARSRIEQYENR----------LLQMQGEFDHAKREADENREEAQRLKNELALRDASRTQTDDARVKEAELKATAAEERFNKMKGVYEKFRSEHVLALTKLGDIQKQLEASEKSKFDKDEEITALNRKVEEAQREAGRA----LTKAEGDAGAVDEMRTQLVKADIEVEELKRT 510          

HSP 2 Score: 199.519 bits (506), Expect = 2.443e-52
Identity = 127/294 (43.20%), Postives = 180/294 (61.22%), Query Frame = 3
Query: 2115 ESYYNVYNQSKSFLE--NIENNDDVNLSSTRLIKTLNQLKNLSESVRINNLESGNANTDDL---FDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLA 2981
            ESY  V +Q K  L    +  +DD  LS    +K L Q      S+ I+     + + D +    ++E+    +AI  AV   + I  ++R +  GI+LEVNE IL +C  LM  I  L+  S+++Q EI+A GK  GS  +FYK++H+WTEGL+SAAKAVG  A  L E+AD ++T  GKFE L++ ++EI AST QL VSSRVKA+  S     LS A++ V+  T +V+A  KN    L ++GS +FS L+L  AK+ EM+SQVK+LELE  L +ER +L  LRK+HY +A
Sbjct:  621 ESYEGVNDQCKKVLAAAKVAFSDDSALSRADKMKLLRQDIQTLNSLMISLPLQTDIDKDVVGNELEQEMRRMDDAIRRAVQEIEAIQRRARESSDGIRLEVNESILANCQALMSVIMQLVIASRELQTEIVAAGKAGGSPAEFYKRNHQWTEGLLSAAKAVGVAARVLVESADGVVTGKGKFEHLIVAAQEIAASTAQLFVSSRVKADKDSSKLDALSVAAKAVNQNTAQVVAAVKNGQTTLNDEGSLDFSYLSLHAAKKEEMESQVKMLELEQSLNQERAKLAALRKQHYHMA 914          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Fly
Match: Hip1 (gene:FBgn0036309 transcript:FBtr0075948)

HSP 1 Score: 265.388 bits (677), Expect = 1.978e-73
Identity = 181/603 (30.02%), Postives = 325/603 (53.90%), Query Frame = 3
Query:  111 NNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIF-QLGKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEEPDVDLNNCDSPTDRNSTLIDFNQIDNN-DRFDQIFGE----METFPFNNDERNELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEVKGLVQMKDQ------------YEERLREYESHRHDSVDAEKFNKIKDAYSKLREEHVKKLREQGIDRQQIETNKK-------ELESLQKQLEDRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMEN------ARLSQIEKELNDSKYDLDKSLSKIN-ELGLIIKRMEEQ-LKSENESKSKMSYLYENM 1820
            N  +SKA+N +E   K KH R +I+       +  F+   S   L  +    WK+ + +HK++R+GHE A+     ++K I  +G+ WG L+   G  I  +SKLL  K  FH K R  PG L I   E+F  + ++++  F+L ++I DYLE+++  + ++  S++K + +SMTPQGQCRL P++ +IQD   LYD+SVR++FKLH  +  D+++GHR RF  LF  ++ F+ + + LQYFK L+ +P LP++ PNF  ++D  +    VV+V +EPD  +   D     N  L  F+Q        + I  E    +E   F  D    ++K  + L+    R  ++  ++ N++L+   VL  E+    +M++              ++ + E E H+   + +EKFNK+K  Y+K+R+EH++ LREQ    + +   K+       E + L  ++    + + + EK NL+   ++K I+++  ++A  +A +K   + KF+ + K K  E + +D++   E L++   K +++         +LS  E ++N    D++K L     E  L++ ++E+Q ++S++ S+++ + L E M
Sbjct:   13 NVSVSKALNGLEAPLKTKHARSIIIMIHKAKEAKTFWMIISRQPLMQSRFTAWKFSHLLHKVLREGHESAIRHSQSHKKMILEVGKMWGLLQDDIGCCIQAYSKLLATKLNFHDKNRMFPGTLNISFTELFIAVDRDLNYCFQLCVEIFDYLEDIIALQLTIFSSMEKYRMSSMTPQGQCRLAPIVCLIQDSNALYDLSVRLMFKLHDGVPYDVVSGHRDRFHGLFLKLKSFYNNVRPLQYFKDLITIPELPDSSPNFKSQNDFTSYVPPVVHVPQEPDPVVE--DLVDTNNHELEAFSQAQQQLSMLEGIISEKEASIEELSFKLD---AMQKNFDALQQSY-RHDVQELQQNNTVLSNDLVLAREMCATFRMQNDDLEMQLNQNPILLQKAMEEEEKHK---LSSEKFNKLKTLYTKIRDEHIQLLREQSDCNKSLNKEKQVNSQLLLETKELTNEISKIKVNVEEKEKTNLI---LQKQIEEHKEKIAHLEA-VKNEMKEKFDDVVKQK--EIQELDIISTSENLRLNCLKVEELNGNLNDTLEKLSNAESQINAKTEDIEKMLKAFEAEKALLLTQIEQQSVESKSHSEAQNAQLQEIM 600          

HSP 2 Score: 164.466 bits (415), Expect = 7.422e-41
Identity = 87/213 (40.85%), Postives = 136/213 (63.85%), Query Frame = 3
Query: 2283 DDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLL-TKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELE 2918
            D L + EL     AID A ++   +L ++R   +   LEVN KI+++C  LM  +K LI +S+ +Q EI+A  KG  S  +FY+++ +W++GLISA+K+V   A +L EAA+  + ++ GK  EL++ ++EI A TTQ+V++S+VKA   S    +L++ASR V+ ATG ++A  K+    LE+Q     S LT +Q K +EM+  VKVLE+E
Sbjct:  889 DKLLEIELREMDAAIDDAASKITDLLAKAREKDNQTNLEVNGKIVDACTTLMECVKALIQKSRLLQHEIVASQKGNASANEFYRRNSQWSDGLISASKSVAKAANYLVEAANKAIESESGKNFELIVAAQEIAACTTQMVIASKVKAERNSQKLTDLTKASRSVTQATGTLVATVKDCNSQLEQQSEIELSKLTPSQIKTMEMEIHVKVLEIE 1101          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Fly
Match: Hip1 (gene:FBgn0036309 transcript:FBtr0075949)

HSP 1 Score: 246.128 bits (627), Expect = 5.456e-67
Identity = 167/551 (30.31%), Postives = 303/551 (54.99%), Query Frame = 3
Query:  267 WKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIF-QLGKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEEPDVDLNNCDSPTDRNSTLIDFNQIDNN-DRFDQIFGE----METFPFNNDERNELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEVKGLVQMKDQ------------YEERLREYESHRHDSVDAEKFNKIKDAYSKLREEHVKKLREQGIDRQQIETNKK-------ELESLQKQLEDRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMEN------ARLSQIEKELNDSKYDLDKSLSKIN-ELGLIIKRMEEQ-LKSENESKSKMSYLYENM 1820
            WK+ + +HK++R+GHE A+     ++K I  +G+ WG L+   G  I  +SKLL  K  FH K R  PG L I   E+F  + ++++  F+L ++I DYLE+++  + ++  S++K + +SMTPQGQCRL P++ +IQD   LYD+SVR++FKLH  +  D+++GHR RF  LF  ++ F+ + + LQYFK L+ +P LP++ PNF  ++D  +    VV+V +EPD  +   D     N  L  F+Q        + I  E    +E   F  D    ++K  + L+    R  ++  ++ N++L+   VL  E+    +M++              ++ + E E H+   + +EKFNK+K  Y+K+R+EH++ LREQ    + +   K+       E + L  ++    + + + EK NL+   ++K I+++  ++A  +A +K   + KF+ + K K  E + +D++   E L++   K +++         +LS  E ++N    D++K L     E  L++ ++E+Q ++S++ S+++ + L E M
Sbjct:   28 WKFSHLLHKVLREGHESAIRHSQSHKKMILEVGKMWGLLQDDIGCCIQAYSKLLATKLNFHDKNRMFPGTLNISFTELFIAVDRDLNYCFQLCVEIFDYLEDIIALQLTIFSSMEKYRMSSMTPQGQCRLAPIVCLIQDSNALYDLSVRLMFKLHDGVPYDVVSGHRDRFHGLFLKLKSFYNNVRPLQYFKDLITIPELPDSSPNFKSQNDFTSYVPPVVHVPQEPDPVVE--DLVDTNNHELEAFSQAQQQLSMLEGIISEKEASIEELSFKLD---AMQKNFDALQQSY-RHDVQELQQNNTVLSNDLVLAREMCATFRMQNDDLEMQLNQNPILLQKAMEEEEKHK---LSSEKFNKLKTLYTKIRDEHIQLLREQSDCNKSLNKEKQVNSQLLLETKELTNEISKIKVNVEEKEKTNLI---LQKQIEEHKEKIAHLEA-VKNEMKEKFDDVVKQK--EIQELDIISTSENLRLNCLKVEELNGNLNDTLEKLSNAESQINAKTEDIEKMLKAFEAEKALLLTQIEQQSVESKSHSEAQNAQLQEIM 563          

HSP 2 Score: 164.466 bits (415), Expect = 6.817e-41
Identity = 87/213 (40.85%), Postives = 136/213 (63.85%), Query Frame = 3
Query: 2283 DDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLL-TKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELE 2918
            D L + EL     AID A ++   +L ++R   +   LEVN KI+++C  LM  +K LI +S+ +Q EI+A  KG  S  +FY+++ +W++GLISA+K+V   A +L EAA+  + ++ GK  EL++ ++EI A TTQ+V++S+VKA   S    +L++ASR V+ ATG ++A  K+    LE+Q     S LT +Q K +EM+  VKVLE+E
Sbjct:  852 DKLLEIELREMDAAIDDAASKITDLLAKAREKDNQTNLEVNGKIVDACTTLMECVKALIQKSRLLQHEIVASQKGNASANEFYRRNSQWSDGLISASKSVAKAANYLVEAANKAIESESGKNFELIVAAQEIAACTTQMVIASKVKAERNSQKLTDLTKASRSVTQATGTLVATVKDCNSQLEQQSEIELSKLTPSQIKTMEMEIHVKVLEIE 1064          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Fly
Match: rhea (gene:FBgn0260442 transcript:FBtr0305210)

HSP 1 Score: 64.6994 bits (156), Expect = 5.092e-10
Identity = 46/147 (31.29%), Postives = 76/147 (51.70%), Query Frame = 3
Query: 2394 LEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQ 2834
            ++ +E ILE+   +M A   L+  +   Q+E+I  GK             +W+EGLISAA+ V      L EAA NL+   G  E L+  ++++ AST QL+++ +VK+N  S   + L  A   V  +T  ++ +A+  +   EE 
Sbjct: 2346 MKFDEMILEAAKGIMGASAALVRAANAAQRELIDTGK-VARRPLTSSDDGQWSEGLISAARLVAAATHSLVEAAQNLVRGVGTEEMLISTAKQVAASTAQLLIACKVKSNPNSEAGRRLQAAGNAVIKSTDNLVHSAQQGLEAEEEH 2491          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Fly
Match: rhea (gene:FBgn0260442 transcript:FBtr0333105)

HSP 1 Score: 64.6994 bits (156), Expect = 5.092e-10
Identity = 46/147 (31.29%), Postives = 76/147 (51.70%), Query Frame = 3
Query: 2394 LEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQ 2834
            ++ +E ILE+   +M A   L+  +   Q+E+I  GK             +W+EGLISAA+ V      L EAA NL+   G  E L+  ++++ AST QL+++ +VK+N  S   + L  A   V  +T  ++ +A+  +   EE 
Sbjct: 2346 MKFDEMILEAAKGIMGASAALVRAANAAQRELIDTGK-VARRPLTSSDDGQWSEGLISAARLVAAATHSLVEAAQNLVRGVGTEEMLISTAKQVAASTAQLLIACKVKSNPNSEAGRRLQAAGNAVIKSTDNLVHSAQQGLEAEEEH 2491          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Fly
Match: rhea (gene:FBgn0260442 transcript:FBtr0333106)

HSP 1 Score: 64.6994 bits (156), Expect = 5.092e-10
Identity = 46/147 (31.29%), Postives = 76/147 (51.70%), Query Frame = 3
Query: 2394 LEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQ 2834
            ++ +E ILE+   +M A   L+  +   Q+E+I  GK             +W+EGLISAA+ V      L EAA NL+   G  E L+  ++++ AST QL+++ +VK+N  S   + L  A   V  +T  ++ +A+  +   EE 
Sbjct: 2346 MKFDEMILEAAKGIMGASAALVRAANAAQRELIDTGK-VARRPLTSSDDGQWSEGLISAARLVAAATHSLVEAAQNLVRGVGTEEMLISTAKQVAASTAQLLIACKVKSNPNSEAGRRLQAAGNAVIKSTDNLVHSAQQGLEAEEEH 2491          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Zebrafish
Match: hip1 (huntingtin interacting protein 1 [Source:ZFIN;Acc:ZDB-GENE-010328-15])

HSP 1 Score: 519.62 bits (1337), Expect = 7.357e-167
Identity = 366/1046 (34.99%), Postives = 572/1046 (54.68%), Query Frame = 3
Query:   39 IQKVFQQRKKTPT--ELENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGKN-VDSLFELGLDILDYLE-ELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEE---PDV-------DLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFG-EMETFPFNNDERNELKK------------EIEYLKALIERMKIEHREKVNSLLARIRVLEEEVKGLVQMKDQY---EERLRE-------------------YESHRHDSVDAEKFNKIKDAYSKLREEHVKKLREQG-IDRQQI--ETNKKELESLQKQLEDRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSKYDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQS-----EDLS--SCRASSDIIRVTIDDALAEIDNINNLAIRD---LDSSEVRIQFADSIYKFGAKLSDTLYQGKILNNDSG-NLYDQINESYYNVYNQSKSFLENIENNDDVNLS-STRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAG 2984
            I KV  +R       E+E E FE+NQ   I+KAIN+ E A KEKH R  ILGT H  G+  F+   +   L  N ++CWK+ +  HK++RDGH   + D ++++ ++  +   WGHL  GYG + S + KLL+ K +FH K  + PGNL + + ++ + G+N V++ F+L +++ DYLE EL +F   V  SLD S+S S+T  GQCRL PLIQVI D + LYD +V++LFKLHS L  D L GHR RF + F+ ++  F  +  LQYFK L+Q+P LPENPPNF+  S L    + VV +  E   P+        DL + D P    +          + +FD +FG    T PFN + +N ++K            E++ LK  +E  ++E      +L  R+  LE E+     +K Q     E LR                     E  R    + +++ K+K+ Y++L + H   LR+   + RQ       + E+E+++K+++DR +++A+        A +E+ +     EL  ++ +L+  + +   +   N+ L ++   L+ +   L +E+   K++E   LS +  EL      L  SL+   E G  +K  E      NE +S+   L   ++     + + A+E+  K +Q      ED +  SC +S+D +      AL  ++ + +   RD    D+++V      ++ +F   + D + QG   ++       D + +S      ++ + L  ++  + +  +  +RL   L+ +K L E +R   LE       DL ++E+  T  A++ A  R + +L +SR+  +GI++EVNE+IL SC +LM AI+VL+  SKD+Q++I+  G+G  S+ +FY K+ +WTEGLISA+KAVG GAT L +AAD ++   GKFEELM+CS EI AST QLV +S+VKA   S N   L QAS+GV+ AT  V+A+ K+    +E+  + +FS +TLTQ KR EMD+QV VLELE  L+KER RLGELRKKHY+LAG
Sbjct:   15 IPKVLSRRAGGANSLEVEKENFERNQAVSINKAINTQEVAVKEKHARTCILGTHHEKGAHTFWLAVNRLPLSSNAVLCWKFCHVFHKLLRDGHPNVIKDSMRHKADLNDMSRMWGHLSEGYGKLCSIYLKLLITKMEFHIKNPRFPGNLQMSNRQLDEAGENDVNNFFQLTVEMFDYLECELNLF-LGVFSSLDMSRSVSVTAAGQCRLAPLIQVILDSSHLYDYTVKLLFKLHSCLPADTLQGHRDRFQEQFKKLKSLFYRSSNLQYFKRLIQIPQLPENPPNFLRASALSEHISPVVVIPAEASSPESEHVVETEDLVDTDIPPLTGT---------GDSKFDDLFGTSAATDPFNFNSQNGMRKDDKDRLIEQLTAELQALKEELESFRLESGRLCQALRGRVNELEAELAEQTHLKQQALGESEFLRAELDDLRRVKEDTEKEQRSLSEIERKAQANEQRYTKLKEKYTELVQSHADLLRKNAEVTRQMTVARAAQDEVENVKKEMQDR-LKVAQDSASQQEKAQLEQ-LQALQAELMSSRTELETLKSTVTSSQQSNEQLGTQLSALVAEKAGL-VETVSRKEVE---LSGLGAELER----LQSSLTNERESG--VKAAEALQNQLNEKESREQALESELVSLRWASLRAALEEAGKIVQDSLNQLEDPAHISCTSSADYLVSRCQVALDCVERLRS--SRDGFVSDNTDVS-GLVRAVTQFAHLVGDVIVQGSATSHMVPVEQADALADSVKACGAEALTLLCQLKEQESMGAADCSRLRTALDSVKALGEKLRPRGLELQQGELGDLVEQEMAATSAAVESAAARIEEMLNKSRAVDTGIKMEVNERILASCTDLMQAIRVLVLSSKDLQRDIVESGRGAASMKEFYAKNSRWTEGLISASKAVGWGATMLVDAADQVVQGKGKFEELMVCSHEIAASTAQLVAASKVKAEKGSSNLSRLQQASKGVTQATAGVVASTKSGKSQIEDTETMDFSAMTLTQIKRQEMDAQVLVLELETRLQKERERLGELRKKHYELAG 1035          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Zebrafish
Match: hip1 (huntingtin interacting protein 1 [Source:ZFIN;Acc:ZDB-GENE-010328-15])

HSP 1 Score: 517.309 bits (1331), Expect = 6.016e-166
Identity = 365/1045 (34.93%), Postives = 571/1045 (54.64%), Query Frame = 3
Query:   39 IQKVFQQRKKTPT--ELENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGKN-VDSLFELGLDILDYLE-ELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEE---PDV-------DLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFG-EMETFPFNNDERNELKK------------EIEYLKALIERMKIEHREKVNSLLARIRVLEEEVKGLVQMKDQY---EERLRE-------------------YESHRHDSVDAEKFNKIKDAYSKLREEHVKKLREQG-IDRQQI--ETNKKELESLQKQLEDRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSKYDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQS-----EDLS--SCRASSDIIRVTIDDALAEIDNINNLAIRD---LDSSEVRIQFADSIYKFGAKLSDTLYQGKILNNDSG-NLYDQINESYYNVYNQSKSFLENIENNDDVNLS-STRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLA 2981
            I KV  +R       E+E E FE+NQ   I+KAIN+ E A KEKH R  ILGT H  G+  F+   +   L  N ++CWK+ +  HK++RDGH   + D ++++ ++  +   WGHL  GYG + S + KLL+ K +FH K  + PGNL + + ++ + G+N V++ F+L +++ DYLE EL +F   V  SLD S+S S+T  GQCRL PLIQVI D + LYD +V++LFKLHS L  D L GHR RF + F+ ++  F  +  LQYFK L+Q+P LPENPPNF+  S L    + VV +  E   P+        DL + D P    +          + +FD +FG    T PFN + +N ++K            E++ LK  +E  ++E      +L  R+  LE E+     +K Q     E LR                     E  R    + +++ K+K+ Y++L + H   LR+   + RQ       + E+E+++K+++DR +++A+        A +E+ +     EL  ++ +L+  + +   +   N+ L ++   L+ +   L +E+   K++E   LS +  EL      L  SL+   E G  +K  E      NE +S+   L   ++     + + A+E+  K +Q      ED +  SC +S+D +      AL  ++ + +   RD    D+++V      ++ +F   + D + QG   ++       D + +S      ++ + L  ++  + +  +  +RL   L+ +K L E +R   LE       DL ++E+  T  A++ A  R + +L +SR+  +GI++EVNE+IL SC +LM AI+VL+  SKD+Q++I+  G+G  S+ +FY K+ +WTEGLISA+KAVG GAT L +AAD ++   GKFEELM+CS EI AST QLV +S+VKA   S N   L QAS+GV+ AT  V+A+ K+    +E+  + +FS +TLTQ KR EMD+QV VLELE  L+KER RLGELRKKHY+LA
Sbjct:   15 IPKVLSRRAGGANSLEVEKENFERNQAVSINKAINTQEVAVKEKHARTCILGTHHEKGAHTFWLAVNRLPLSSNAVLCWKFCHVFHKLLRDGHPNVIKDSMRHKADLNDMSRMWGHLSEGYGKLCSIYLKLLITKMEFHIKNPRFPGNLQMSNRQLDEAGENDVNNFFQLTVEMFDYLECELNLF-LGVFSSLDMSRSVSVTAAGQCRLAPLIQVILDSSHLYDYTVKLLFKLHSCLPADTLQGHRDRFQEQFKKLKSLFYRSSNLQYFKRLIQIPQLPENPPNFLRASALSEHISPVVVIPAEASSPESEHVVETEDLVDTDIPPLTGT---------GDSKFDDLFGTSAATDPFNFNSQNGMRKDDKDRLIEQLTAELQALKEELESFRLESGRLCQALRGRVNELEAELAEQTHLKQQALGESEFLRAELDDLRRVKEDTEKEQRSLSEIERKAQANEQRYTKLKEKYTELVQSHADLLRKNAEVTRQMTVARAAQDEVENVKKEMQDR-LKVAQDSASQQEKAQLEQ-LQALQAELMSSRTELETLKSTVTSSQQSNEQLGTQLSALVAEKAGL-VETVSRKEVE---LSGLGAELER----LQSSLTNERESG--VKAAEALQNQLNEKESREQALESELVSLRWASLRAALEEAGKIVQDSLNQLEDPAHISCTSSADYLVSRCQVALDCVERLRS--SRDGFVSDNTDVS-GLVRAVTQFAHLVGDVIVQGSATSHMVPVEQADALADSVKACGAEALTLLCQLKEQESMGAADCSRLRTALDSVKALGEKLRPRGLELQQGELGDLVEQEMAATSAAVESAAARIEEMLNKSRAVDTGIKMEVNERILASCTDLMQAIRVLVLSSKDLQRDIVESGRGAASMKEFYAKNSRWTEGLISASKAVGWGATMLVDAADQVVQGKGKFEELMVCSHEIAASTAQLVAASKVKAEKGSSNLSRLQQASKGVTQATAGVVASTKSGKSQIEDTETMDFSAMTLTQIKRQEMDAQVLVLELETRLQKERERLGELRKKHYELA 1034          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Zebrafish
Match: hip1 (huntingtin interacting protein 1 [Source:ZFIN;Acc:ZDB-GENE-010328-15])

HSP 1 Score: 506.523 bits (1303), Expect = 8.933e-162
Identity = 362/1046 (34.61%), Postives = 570/1046 (54.49%), Query Frame = 3
Query:   39 IQKVFQQRKKTPT--ELENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGKN-VDSLFELGLDILDYLE-ELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEE---PDV-------DLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFG-EMETFPFNNDERNELKK------------EIEYLKALIERMKIEHREKVNSLLARIRVLEEEVKGLVQMKDQY---EERLRE-------------------YESHRHDSVDAEKFNKIKDAYSKLREEHVKKLREQG-IDRQQI--ETNKKELESLQKQLEDRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSKYDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQS-----EDLS--SCRASSDIIRVTIDDALAEIDNINNLAIRD---LDSSEVRIQFADSIYKFGAKLSDTLYQGKILNNDSG-NLYDQINESYYNVYNQSKSFLENIENNDDVNLS-STRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAG 2984
            I KV  +R       E+E E FE+NQ   I+KAIN+ E A KEKH R ++L      G+  F+   +   L  N ++CWK+ +  HK++RDGH   + D ++++ ++  +   WGHL  GYG + S + KLL+ K +FH K  + PGNL + + ++ + G+N V++ F+L +++ DYLE EL +F   V  SLD S+S S+T  GQCRL PLIQVI D + LYD +V++LFKLHS L  D L GHR RF + F+ ++  F  +  LQYFK L+Q+P LPENPPNF+  S L    + VV +  E   P+        DL + D P    +          + +FD +FG    T PFN + +N ++K            E++ LK  +E  ++E      +L  R+  LE E+     +K Q     E LR                     E  R    + +++ K+K+ Y++L + H   LR+   + RQ       + E+E+++K+++DR +++A+        A +E+ +     EL  ++ +L+  + +   +   N+ L ++   L+ +   L +E+   K++E   LS +  EL      L  SL+   E G  +K  E      NE +S+   L   ++     + + A+E+  K +Q      ED +  SC +S+D +      AL  ++ + +   RD    D+++V      ++ +F   + D + QG   ++       D + +S      ++ + L  ++  + +  +  +RL   L+ +K L E +R   LE       DL ++E+  T  A++ A  R + +L +SR+  +GI++EVNE+IL SC +LM AI+VL+  SKD+Q++I+  G+G  S+ +FY K+ +WTEGLISA+KAVG GAT L +AAD ++   GKFEELM+CS EI AST QLV +S+VKA   S N   L QAS+GV+ AT  V+A+ K+    +E+  + +FS +TLTQ KR EMD+QV VLELE  L+KER RLGELRKKHY+LAG
Sbjct:   15 IPKVLSRRAGGANSLEVEKENFERNQAVSINKAINTQEVAVKEKHARNILLK-----GAHTFWLAVNRLPLSSNAVLCWKFCHVFHKLLRDGHPNVIKDSMRHKADLNDMSRMWGHLSEGYGKLCSIYLKLLITKMEFHIKNPRFPGNLQMSNRQLDEAGENDVNNFFQLTVEMFDYLECELNLF-LGVFSSLDMSRSVSVTAAGQCRLAPLIQVILDSSHLYDYTVKLLFKLHSCLPADTLQGHRDRFQEQFKKLKSLFYRSSNLQYFKRLIQIPQLPENPPNFLRASALSEHISPVVVIPAEASSPESEHVVETEDLVDTDIPPLTGT---------GDSKFDDLFGTSAATDPFNFNSQNGMRKDDKDRLIEQLTAELQALKEELESFRLESGRLCQALRGRVNELEAELAEQTHLKQQALGESEFLRAELDDLRRVKEDTEKEQRSLSEIERKAQANEQRYTKLKEKYTELVQSHADLLRKNAEVTRQMTVARAAQDEVENVKKEMQDR-LKVAQDSASQQEKAQLEQ-LQALQAELMSSRTELETLKSTVTSSQQSNEQLGTQLSALVAEKAGL-VETVSRKEVE---LSGLGAELER----LQSSLTNERESG--VKAAEALQNQLNEKESREQALESELVSLRWASLRAALEEAGKIVQDSLNQLEDPAHISCTSSADYLVSRCQVALDCVERLRS--SRDGFVSDNTDVS-GLVRAVTQFAHLVGDVIVQGSATSHMVPVEQADALADSVKACGAEALTLLCQLKEQESMGAADCSRLRTALDSVKALGEKLRPRGLELQQGELGDLVEQEMAATSAAVESAAARIEEMLNKSRAVDTGIKMEVNERILASCTDLMQAIRVLVLSSKDLQRDIVESGRGAASMKEFYAKNSRWTEGLISASKAVGWGATMLVDAADQVVQGKGKFEELMVCSHEIAASTAQLVAASKVKAEKGSSNLSRLQQASKGVTQATAGVVASTKSGKSQIEDTETMDFSAMTLTQIKRQEMDAQVLVLELETRLQKERERLGELRKKHYELAG 1030          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Zebrafish
Match: hip1rb (huntingtin interacting protein 1 related b [Source:ZFIN;Acc:ZDB-GENE-070209-59])

HSP 1 Score: 477.248 bits (1227), Expect = 1.565e-150
Identity = 343/1037 (33.08%), Postives = 576/1037 (55.54%), Query Frame = 3
Query:   30 MTSIQKVFQQRKKTPTE----LENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKT--GYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQ--LGKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQ-KALVV--NVAEEPDVDLNNCDSPTDRNSTL-IDFNQIDNNDRFDQIFGEM-ETFPFNNDERNELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEV--------KGLV---QMKDQYEERLR---EYESHRHDSVDAEK--------FNKIKDAYSKLREEHVKKLREQGIDRQQIETNKKELESLQKQLEDRNIELAKLEKE-NLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQM---ENARLSQIEKE--LNDSKYDLDKSLSKINELGLIIKRMEEQLKSENESKSKM----SYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILNNDSGNLY-DQINESYYNVYNQSKSFLENIENNDDV-NLSSTRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAGETVDQ 2999
            M SI++V  + K   TE     E E FEK Q + ISKAINS E   KEKH R +ILGT    G+  F+ +     L  + I+ WK+ + +HKI+RDGH   L D +++  +I   G  W + +   GY  ++S  +KLL  K +FH K+ ++P +L + +DE+ +   G +++++F+L +++ DY++  +   ++V+  L+ S + S    GQC+L PLIQVIQD + LY  +V++LFKLH+ L  D L GHR+RF   F S++ F   A+ + YFK L+Q+P LP++PPNF+  S L    K +VV  +  E  + + +  +   D +  L +  +Q   +D FDQ FG   + F   + +   LK+EIE L+A +E++K E +  +  L A+I  LE E+        + LV   Q++ + E   R   E+ES + + V+ EK        +NK+K+ +++L   H + LR+     + +   ++  E +++  +    E+ ++++E ++ +   +  +D+   EL EA+A   +  RS  +        E   V +   + ALQ E D+  Q    ++A LS ++KE  L +S    ++  + I EL  +  +++E+L  E + + K+      L +  +  A    Q A+ K +  +      SC +S D +    +  L  ++ +       + S +       ++  F    +DT+  G    + +   + D++ E   +   QS  +L+++++   +     T +   + ++  + + +R   L+ G     D+ D+E+  T  AI+ AV R   ++ Q+R + +G+QLEVNE+IL SC +LM AI++L+  S D+QKEI+  G+G  SV +FY ++ +WTEGLISA+KAVG GAT + ++AD ++   GK+EEL++CS EI AST QLV +S+VKA+  S    NL QASR V++   KV+A+ K     +E++ + +FS L+L + K+ EM+SQVKVLELE  LE ER RLGELRKKHY++AG  ++Q
Sbjct:    1 MNSIRQVPSRVKSRRTESVLGAEREHFEKQQLSSISKAINSTETPLKEKHARRIILGTHREKGAYTFWSYAVGLPLPSSAILSWKFCHVLHKILRDGHRNTLQDCMRHYSDIAETGLLWTNTRDRHGYALLVSLHAKLLCTKIEFHTKHSEIPASLEV-TDELLERTAGTDINNVFQLTVEVFDYMDAELRLAEAVLHQLNMSIAISTLTSGQCKLAPLIQVIQDCSHLYHYTVKLLFKLHACLPADTLQGHRERFHDQFHSLKTFLNKARDMLYFKRLIQIPRLPDSPPNFLRASALAEHVKPMVVIPDEEELEEQEEDEPEPLIDVSEALPVAASQPLQSDIFDQAFGPPKDGFDDRDLQIERLKREIELLQAELEKIKGEAQRYITQLKAQINSLEGELEEQRMQKQRTLVENEQLRMELEATHRRNTEHESMQTNFVETEKRAQATELRYNKLKEKHAELVANHAELLRKSADTVKMLSATQQTQEEIERTKQQLAFEVDRVKQESDMKFDEQKFEMDKLKREL-EAKAAEIQKVRSSLQ------TSEMTGVHMNSSMAALQAEKDRLTQSISKKDAELSSLKKESQLKESSLQQERDRT-IRELEELQGKLKEKLSREEQLQQKLLDEQFTLLQATVTEAENIIQDAVAKLDDPIHI----SCSSSPDYLISRAEATLGSVEKVQAGHSEYVKSMKDAGGLVRALTMFSHLAADTIINGSATAHMAPTDHADRLTEQCKSCATQSLQYLKSLKSKASLRGADPTAIQAAVQKILRIGKDLRPKGLDVGKDELGDMVDKEMAATSAAIEEAVRRIDEMMSQTRKDATGVQLEVNERILNSCTDLMQAIRLLVLASTDLQKEIVEGGRGAASVREFYARNSRWTEGLISASKAVGWGATQMVDSADKVVLHTGKYEELIVCSHEIAASTAQLVAASKVKADRGSKRLGNLQQASRHVNEMAAKVVASTKTGQDQVEDKDTMDFSGLSLIKLKKEEMESQVKVLELETMLENERLRLGELRKKHYEIAGVPLEQ 1024          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Zebrafish
Match: hip1 (huntingtin interacting protein 1 [Source:ZFIN;Acc:ZDB-GENE-010328-15])

HSP 1 Score: 475.707 bits (1223), Expect = 3.094e-150
Identity = 336/976 (34.43%), Postives = 534/976 (54.71%), Query Frame = 3
Query:  243 LHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGKN-VDSLFELGLDILDYLE-ELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEE---PDV-------DLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFG-EMETFPFNNDERNELKK------------EIEYLKALIERMKIEHREKVNSLLARIRVLEEEVKGLVQMKDQY---EERLRE-------------------YESHRHDSVDAEKFNKIKDAYSKLREEHVKKLREQG-IDRQQI--ETNKKELESLQKQLEDRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSKYDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQS-----EDLS--SCRASSDIIRVTIDDALAEIDNINNLAIRD---LDSSEVRIQFADSIYKFGAKLSDTLYQGKILNNDSG-NLYDQINESYYNVYNQSKSFLENIENNDDVNLS-STRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAG 2984
            L  N ++CWK+ +  HK++RDGH   + D ++++ ++  +   WGHL  GYG + S + KLL+ K +FH K  + PGNL + + ++ + G+N V++ F+L +++ DYLE EL +F   V  SLD S+S S+T  GQCRL PLIQVI D + LYD +V++LFKLHS L  D L GHR RF + F+ ++  F  +  LQYFK L+Q+P LPENPPNF+  S L    + VV +  E   P+        DL + D P    +          + +FD +FG    T PFN + +N ++K            E++ LK  +E  ++E      +L  R+  LE E+     +K Q     E LR                     E  R    + +++ K+K+ Y++L + H   LR+   + RQ       + E+E+++K+++DR +++A+        A +E+ +     EL  ++ +L+  + +   +   N+ L ++   L+ +   L +E+   K++E   LS +  EL      L  SL+   E G  +K  E      NE +S+   L   ++     + + A+E+  K +Q      ED +  SC +S+D +      AL  ++ + +   RD    D+++V      ++ +F   + D + QG   ++       D + +S      ++ + L  ++  + +  +  +RL   L+ +K L E +R   LE       DL ++E+  T  A++ A  R + +L +SR+  +GI++EVNE+IL SC +LM AI+VL+  SKD+Q++I+  G+G  S+ +FY K+ +WTEGLISA+KAVG GAT L +AAD ++   GKFEELM+CS EI AST QLV +S+VKA   S N   L QAS+GV+ AT  V+A+ K+    +E+  + +FS +TLTQ KR EMD+QV VLELE  L+KER RLGELRKKHY+LAG
Sbjct:   63 LSSNAVLCWKFCHVFHKLLRDGHPNVIKDSMRHKADLNDMSRMWGHLSEGYGKLCSIYLKLLITKMEFHIKNPRFPGNLQMSNRQLDEAGENDVNNFFQLTVEMFDYLECELNLF-LGVFSSLDMSRSVSVTAAGQCRLAPLIQVILDSSHLYDYTVKLLFKLHSCLPADTLQGHRDRFQEQFKKLKSLFYRSSNLQYFKRLIQIPQLPENPPNFLRASALSEHISPVVVIPAEASSPESEHVVETEDLVDTDIPPLTGT---------GDSKFDDLFGTSAATDPFNFNSQNGMRKDDKDRLIEQLTAELQALKEELESFRLESGRLCQALRGRVNELEAELAEQTHLKQQALGESEFLRAELDDLRRVKEDTEKEQRSLSEIERKAQANEQRYTKLKEKYTELVQSHADLLRKNAEVTRQMTVARAAQDEVENVKKEMQDR-LKVAQDSASQQEKAQLEQ-LQALQAELMSSRTELETLKSTVTSSQQSNEQLGTQLSALVAEKAGL-VETVSRKEVE---LSGLGAELER----LQSSLTNERESG--VKAAEALQNQLNEKESREQALESELVSLRWASLRAALEEAGKIVQDSLNQLEDPAHISCTSSADYLVSRCQVALDCVERLRS--SRDGFVSDNTDVS-GLVRAVTQFAHLVGDVIVQGSATSHMVPVEQADALADSVKACGAEALTLLCQLKEQESMGAADCSRLRTALDSVKALGEKLRPRGLELQQGELGDLVEQEMAATSAAVESAAARIEEMLNKSRAVDTGIKMEVNERILASCTDLMQAIRVLVLSSKDLQRDIVESGRGAASMKEFYAKNSRWTEGLISASKAVGWGATMLVDAADQVVQGKGKFEELMVCSHEIAASTAQLVAASKVKAEKGSSNLSRLQQASKGVTQATAGVVASTKSGKSQIEDTETMDFSAMTLTQIKRQEMDAQVLVLELETRLQKERERLGELRKKHYELAG 1013          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Xenopus
Match: hip1r (huntingtin interacting protein 1 related [Source:NCBI gene;Acc:100144673])

HSP 1 Score: 487.263 bits (1253), Expect = 3.903e-154
Identity = 338/1027 (32.91%), Postives = 565/1027 (55.01%), Query Frame = 3
Query:   45 KVFQQRKKTPTELENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQ--LGKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEEPDVDLNNCDSPTDRNST-LIDFNQIDNNDRFDQIFGEMETFPFNNDERN----ELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEV--------KGLV---QMKDQYEE-RLREYESHRHDSV--DAEK--------FNKIKDAYSKLREEHVKKLREQGIDRQQI---ETNKKELESLQKQLE------DRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSK-------YDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILNN-DSGNLYDQINESYYNVYNQSKSFLENIENNDDV-NLSSTRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAG 2984
            +V  +R     E E EQF++NQ   ISKAIN+ E   KEKH R +ILGT H  G+  F+ +     L  + I+ WK+ + +HK++RDGH   L D  +    I+  GE WGH+   YG +++ ++KLLL K  FH K+ + P  L + +D++ +   G +V+++F+L +++ DY++  +   ++V   L+ S + S    GQC+L PLIQVIQD + LY  +V+++FKLHS L  D L GHR RF + F S+++FFK A  + YFK L+Q+P LP+ PPNF+  S L      VV +  E   D    +S  + ++   ++  Q+   D F Q FG         D+R+     L+KEIE L+A +E++K+E ++ +  L  +I  LE E+        K LV   Q++D+ E+ + ++ E+ +   V  +AEK        + K+K+ +++L   H   LR+     +Q+   + N++E+  ++++LE       R  +L KLE ++     ++  I+    EL   Q  L   E SK +              L   + +L++E D  K +   + S++    N ++        + +K  S+I +L    +++ ++   E +   KM     N+I+   + ++  I+     L       C +S D +      AL  I ++ N   + + +         ++ +F    +DT+  G   ++    +  D++N+S     NQS  +L +++N   + N     + ++L ++ +L + +R  +L+       D+ D+E+ +T  AI+ AV R + ++ Q+R + SG++LEVNE+IL SC +LM AI++L+  S D+QKEI+  G+G  +  +FY K+ +WTEGLISA+KAVG GAT L E+AD ++   GK+EEL++ S EI AST QLV +S+VKA+  S N   L Q SR V++    V+A+ K+    +E++ + +FS ++L + K+ EM+SQVKVLELEN L+ ER RLGELR++HY LAG
Sbjct:   10 RVLSRRTGHGLEAEREQFDRNQAISISKAINTQEAPVKEKHARRIILGTHHEKGAFTFWSYAIGLPLPSSSILSWKFCHVLHKVLRDGHPNVLSDCQRYRSNIRETGELWGHMHDRYGQLVNIYTKLLLNKISFHVKHPEFPPGLEV-TDDVLEKSAGTDVNNIFQLTVEMFDYMDCELKLAEAVFRQLNSSIAVSQMAAGQCKLAPLIQVIQDCSHLYHYTVKLMFKLHSCLPPDTLQGHRDRFHEQFHSLKNFFKRASDMLYFKRLIQIPRLPDGPPNFLRASALAEHVKPVVVIPNETPEDEEPAESLIEISAAQPVEQEQV-VEDLFQQTFGAPNGL--MKDDRDLQIENLQKEIELLRAELEKIKLEAQKYILQLKGQINTLEAELEEQRKQKQKALVDNEQLRDELEKLKKQKLENEKTQGVLLEAEKKIQATELRYTKLKEKHNELINTHAGLLRKNADTAKQLTVSQQNQEEVARIKEELEFQMDQVKRESDL-KLEDQSFQTEQLKSEIEAKKKELLLIQQSLSSTEESKSQ--------------LNSTLMSLEVEKDTLKSLLTTKESELSSAQNLARDTETLFNQEQEKKASEIRDLH---EKLNKKTTDEQKLYQKMLEDQFNIIQGTVREAENIIQDAVAKLDDPLHIRCTSSPDYLVCRAQAALDSIPHLENGHAKYIQNMTDASDLVGALAQFAHLTADTIVNGSATSHLAPPDHADRLNDSCKECGNQSLDYLSSLKNKHSLKNADLAEVNRSLKRIFDLGQELRPKSLDIKQEELGDMVDKEMASTSAAIEAAVRRIEEMMNQARKDSSGVKLEVNERILNSCTDLMKAIRLLVITSTDLQKEIVESGRGAATTQEFYAKNSRWTEGLISASKAVGWGATQLVESADKVVLHKGKYEELIVGSHEIAASTAQLVAASKVKADKNSKNLPKLQQCSRHVNEMAANVVASTKSGQEQIEDKDTMDFSGMSLIKLKKEEMESQVKVLELENMLQNERMRLGELRRQHYALAG 1014          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Xenopus
Match: hip1r (huntingtin interacting protein 1 related [Source:NCBI gene;Acc:100144673])

HSP 1 Score: 456.062 bits (1172), Expect = 1.199e-142
Identity = 328/1026 (31.97%), Postives = 547/1026 (53.31%), Query Frame = 3
Query:   45 KVFQQRKKTPTELENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQ--LGKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEEPDVDLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFGEMETFPFNNDERN----ELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEV--------KGLV---QMKDQYEE-RLREYESHRHDSV--DAEK--------FNKIKDAYSKLREEHVKKLREQGIDRQQI---ETNKKELESLQKQLE------DRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSK-------YDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILNN-DSGNLYDQINESYYNVYNQSKSFLENIENNDDV-NLSSTRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAG 2984
            +V  +R     E E EQF++NQ   ISKAIN+ E   KEKH R +ILGT H  G+  F+ +     L  + I+ WK+ + +HK++RDGH   L D  +    I+  GE WGH+   YG +++ ++KLLL K  FH K+ + P  L + +D++ +   G +V+++F+L +++ DY++  +   ++V   L+ S + S    GQC+L PLIQVIQD + LY  +V+++FKLHS L  D L GHR RF + F S+++FFK A  + YFK L+Q+P LP+ PPNF+  S L      VV +  E   D    +S  + ++      +    D F Q FG         D+R+     L+KEIE L+A +E++K+E ++ +  L  +I  LE E+        K LV   Q++D+ E+ + ++ E+ +   V  +AEK        + K+K+ +++L   H   LR+     +Q+   + N++E+  ++++LE       R  +L KLE ++     ++  I+    EL   Q  L   E SK +              L   + +L++E D  K +   + S++    N ++        + +K  S+I +L    +++ ++   E +   KM     N+I+   + ++  I+     L       C +S D +      AL  I ++ N   + + +         ++ +F    +DT+  G   ++    +  D++N+S     NQS  +L +++N   + N     + ++L ++ +L + +R  +L+       D+ D+E+ +T  AI+ AV R + ++ Q+R + SG++LEVNE+IL SC +LM                     KG  +  +FY K+ +WTEGLISA+KAVG GAT L E+AD ++   GK+EEL++ S EI AST QLV +S+VKA+  S N   L Q SR V++    V+A+ K+    +E++ + +FS ++L + K+ EM+SQVKVLELEN L+ ER RLGELR++HY LAG
Sbjct:   10 RVLSRRTGHGLEAEREQFDRNQAISISKAINTQEAPVKEKHARRIILGTHHEKGAFTFWSYAIGLPLPSSSILSWKFCHVLHKVLRDGHPNVLSDCQRYRSNIRETGELWGHMHDRYGQLVNIYTKLLLNKISFHVKHPEFPPGLEV-TDDVLEKSAGTDVNNIFQLTVEMFDYMDCELKLAEAVFRQLNSSIAVSQMAAGQCKLAPLIQVIQDCSHLYHYTVKLMFKLHSCLPPDTLQGHRDRFHEQFHSLKNFFKRASDMLYFKRLIQIPRLPDGPPNFLRASALAEHVKPVVVIPNETPEDEEPAESLIEISAAQPVEQEQVVEDLFQQTFGAPNGL--MKDDRDLQIENLQKEIELLRAELEKIKLEAQKYILQLKGQINTLEAELEEQRKQKQKALVDNEQLRDELEKLKKQKLENEKTQGVLLEAEKKIQATELRYTKLKEKHNELINTHAGLLRKNADTAKQLTVSQQNQEEVARIKEELEFQMDQVKRESDL-KLEDQSFQTEQLKSEIEAKKKELLLIQQSLSSTEESKSQ--------------LNSTLMSLEVEKDTLKSLLTTKESELSSAQNLARDTETLFNQEQEKKASEIRDLH---EKLNKKTTDEQKLYQKMLEDQFNIIQGTVREAENIIQDAVAKLDDPLHIRCTSSPDYLVCRAQAALDSIPHLENGHAKYIQNMTDASDLVGALAQFAHLTADTIVNGSATSHLAPPDHADRLNDSCKECGNQSLDYLSSLKNKHSLKNADLAEVNRSLKRIFDLGQELRPKSLDIKQEELGDMVDKEMASTSAAIEAAVRRIEEMMNQARKDSSGVKLEVNERILNSCTDLM---------------------KGAATTQEFYAKNSRWTEGLISASKAVGWGATQLVESADKVVLHKGKYEELIVGSHEIAASTAQLVAASKVKADKNSKNLPKLQQCSRHVNEMAANVVASTKSGQEQIEDKDTMDFSGMSLIKLKKEEMESQVKVLELENMLQNERMRLGELRRQHYALAG 993          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Xenopus
Match: hip1r (huntingtin interacting protein 1 related [Source:NCBI gene;Acc:100144673])

HSP 1 Score: 422.935 bits (1086), Expect = 6.552e-131
Identity = 304/1002 (30.34%), Postives = 524/1002 (52.30%), Query Frame = 3
Query:   45 KVFQQRKKTPTELENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQ--LGKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEEPDVDLNNCDSPTDRNST-LIDFNQIDNNDRFDQIFGEMETFPFNNDERN----ELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEV--------KGLV---QMKDQYEE-RLREYESHRHDSV--DAEK--------FNKIKDAYSKLREEHVKKLREQGIDRQQI---ETNKKELESLQKQLE------DRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSK-------YDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILNN-DSGNLYDQINESYYNVYNQSKSFLENIENNDDV-NLSSTRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVL 2909
            +V  +R     E E EQF++NQ   ISKAIN+ E   KEKH R +ILGT H  G+  F+ +     L  + I+ WK+ + +HK++RDGH   L D  +    I+  GE WGH+   YG +++ ++KLLL K  FH K+ + P  L + +D++ +   G +V+++F+L +++ DY++  +   ++V   L+ S + S    GQC+L PLIQVIQD + LY  +V+++FKLHS L  D L GHR RF + F S+++FFK A  + YFK L+Q+P LP+ PPNF+  S L      VV +  E   D    +S  + ++   ++  Q+   D F Q FG         D+R+     L+KEIE L+A +E++K+E ++ +  L  +I  LE E+        K LV   Q++D+ E+ + ++ E+ +   V  +AEK        + K+K+ +++L   H   LR+     +Q+   + N++E+  ++++LE       R  +L KLE ++     ++  I+    EL   Q  L   E SK +              L   + +L++E D  K +   + S++    N ++        + +K  S+I +L    +++ ++   E +   KM     N+I+   + ++  I+     L       C +S D +      AL  I ++ N   + + +         ++ +F    +DT+  G   ++    +  D++N+S     NQS  +L +++N   + N     + ++L ++ +L + +R  +L+       D+ D+E+ +T  AI+ AV R + ++ Q+R + SG++LEVNE+    C  +M+  +V                    +  +FY K+ +WTEGLISA+KAVG GAT L E+AD ++   GK+EEL++ S EI AST QLV +S+VKA+  S N   L Q SR V++    V+A+ K+    +E++ + +FS ++L + K+ EM+SQV V 
Sbjct:   10 RVLSRRTGHGLEAEREQFDRNQAISISKAINTQEAPVKEKHARRIILGTHHEKGAFTFWSYAIGLPLPSSSILSWKFCHVLHKVLRDGHPNVLSDCQRYRSNIRETGELWGHMHDRYGQLVNIYTKLLLNKISFHVKHPEFPPGLEV-TDDVLEKSAGTDVNNIFQLTVEMFDYMDCELKLAEAVFRQLNSSIAVSQMAAGQCKLAPLIQVIQDCSHLYHYTVKLMFKLHSCLPPDTLQGHRDRFHEQFHSLKNFFKRASDMLYFKRLIQIPRLPDGPPNFLRASALAEHVKPVVVIPNETPEDEEPAESLIEISAAQPVEQEQV-VEDLFQQTFGAPNG--LMKDDRDLQIENLQKEIELLRAELEKIKLEAQKYILQLKGQINTLEAELEEQRKQKQKALVDNEQLRDELEKLKKQKLENEKTQGVLLEAEKKIQATELRYTKLKEKHNELINTHAGLLRKNADTAKQLTVSQQNQEEVARIKEELEFQMDQVKRESDL-KLEDQSFQTEQLKSEIEAKKKELLLIQQSLSSTEESKSQ--------------LNSTLMSLEVEKDTLKSLLTTKESELSSAQNLARDTETLFNQEQEKKASEIRDLH---EKLNKKTTDEQKLYQKMLEDQFNIIQGTVREAENIIQDAVAKLDDPLHIRCTSSPDYLVCRAQAALDSIPHLENGHAKYIQNMTDASDLVGALAQFAHLTADTIVNGSATSHLAPPDHADRLNDSCKECGNQSLDYLSSLKNKHSLKNADLAEVNRSLKRIFDLGQELRPKSLDIKQEELGDMVDKEMASTSAAIEAAVRRIEEMMNQARKDSSGVKLEVNER----C--VMFLGRV-----------------SCATTQEFYAKNSRWTEGLISASKAVGWGATQLVESADKVVLHKGKYEELIVGSHEIAASTAQLVAASKVKADKNSKNLPKLQQCSRHVNEMAANVVASTKSGQEQIEDKDTMDFSGMSLIKLKKEEMESQVSVF 966          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Xenopus
Match: hip1r (huntingtin interacting protein 1 related [Source:NCBI gene;Acc:100144673])

HSP 1 Score: 424.091 bits (1089), Expect = 9.839e-131
Identity = 319/1027 (31.06%), Postives = 535/1027 (52.09%), Query Frame = 3
Query:   45 KVFQQRKKTPTELENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQ--LGKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEEPDVDLNNCDSPTDRNST-LIDFNQIDNNDRFDQIFGEMETFPFNNDERN----ELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEV--------KGLV---QMKDQYEE-RLREYESHRHDSV--DAEK--------FNKIKDAYSKLREEHVKKLREQGIDRQQI---ETNKKELESLQKQLE------DRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSK-------YDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILNN-DSGNLYDQINESYYNVYNQSKSFLENIENNDDV-NLSSTRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAG 2984
            +V  +R     E E EQF++NQ   ISKAIN+ E   KEKH R +ILGT H  G+  F+ +     L  + I+ WK+ + +HK++RDGH   L D  +    I+  GE WGH+   YG +++ ++KLLL K  FH K+ + P  L + +D++ +   G +V+++F+L +++ DY++  +   ++V   L+ S + S    GQC+L PLIQVIQD + LY  +V+++FKLHS L  D L GHR RF + F S+++FFK A  + YFK L+Q+P LP+ PPNF+  S L      VV +  E   D    +S  + ++   ++  Q+   D F Q FG         D+R+     L+KEIE L+A +E++K+E ++ +  L  +I  LE E+        K LV   Q++D+ E+ + ++ E+ +   V  +AEK        + K+K+ +++L   H   LR+     +Q+   + N++E+  ++++LE       R  +L KLE ++     ++  I+    EL   Q  L   E SK +              L   + +L++E D  K +   + S++    N ++        + +K  S+I +L    +++ ++   E +   KM     N+I+   + ++  I+     L       C +S D +      AL  I ++ N   + + +         ++ +F    +DT+  G   ++    +  D++N+S     NQS  +L +++N   + N     + ++L ++ +L + +R  +L+       D+ D+E+ +T  AI+ AV R +            +    N K                       KEI+  G+G  +  +FY K+ +WTEGLISA+KAVG GAT L E+AD ++   GK+EEL++ S EI AST QLV +S+VKA+  S N   L Q SR V++    V+A+ K+    +E++ + +FS ++L + K+ EM+SQVKVLELEN L+ ER RLGELR++HY LAG
Sbjct:   10 RVLSRRTGHGLEAEREQFDRNQAISISKAINTQEAPVKEKHARRIILGTHHEKGAFTFWSYAIGLPLPSSSILSWKFCHVLHKVLRDGHPNVLSDCQRYRSNIRETGELWGHMHDRYGQLVNIYTKLLLNKISFHVKHPEFPPGLEV-TDDVLEKSAGTDVNNIFQLTVEMFDYMDCELKLAEAVFRQLNSSIAVSQMAAGQCKLAPLIQVIQDCSHLYHYTVKLMFKLHSCLPPDTLQGHRDRFHEQFHSLKNFFKRASDMLYFKRLIQIPRLPDGPPNFLRASALAEHVKPVVVIPNETPEDEEPAESLIEISAAQPVEQEQV-VEDLFQQTFGAPNG--LMKDDRDLQIENLQKEIELLRAELEKIKLEAQKYILQLKGQINTLEAELEEQRKQKQKALVDNEQLRDELEKLKKQKLENEKTQGVLLEAEKKIQATELRYTKLKEKHNELINTHAGLLRKNADTAKQLTVSQQNQEEVARIKEELEFQMDQVKRESDL-KLEDQSFQTEQLKSEIEAKKKELLLIQQSLSSTEESKSQ--------------LNSTLMSLEVEKDTLKSLLTTKESELSSAQNLARDTETLFNQEQEKKASEIRDLH---EKLNKKTTDEQKLYQKMLEDQFNIIQGTVREAENIIQDAVAKLDDPLHIRCTSSPDYLVCRAQAALDSIPHLENGHAKYIQNMTDASDLVGALAQFAHLTADTIVNGSATSHLAPPDHADRLNDSCKECGNQSLDYLSSLKNKHSLKNADLAEVNRSLKRIFDLGQELRPKSLDIKQEELGDMVDKEMASTSAAIEAAVRRIE------------VSFWYNNK-----------------------KEIVESGRGAATTQEFYAKNSRWTEGLISASKAVGWGATQLVESADKVVLHKGKYEELIVGSHEIAASTAQLVAASKVKADKNSKNLPKLQQCSRHVNEMAANVVASTKSGQEQIEDKDTMDFSGMSLIKLKKEEMESQVKVLELENMLQNERMRLGELRRQHYALAG 979          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Xenopus
Match: hip1r (huntingtin interacting protein 1 related [Source:NCBI gene;Acc:100144673])

HSP 1 Score: 417.157 bits (1071), Expect = 2.359e-128
Identity = 316/1022 (30.92%), Postives = 528/1022 (51.66%), Query Frame = 3
Query:   45 KVFQQRKKTPTELENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQ--LGKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEEPDVDLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFGEMETFPFNNDERNELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEV--------KGLV---QMKDQYEE-RLREYESHRHDSV--DAEK--------FNKIKDAYSKLREEHVKKLREQGIDRQQI---ETNKKELESLQKQLE------DRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSK-------YDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILNN-DSGNLYDQINESYYNVYNQSKSFLENIENNDDV-NLSSTRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAG 2984
            +V  +R     E E EQF++NQ   ISKAIN+ E   KEKH R +ILGT H  G+  F+ +     L  + I+ WK+ + +HK++RDGH   L D  +    I+  GE WGH+   YG +++ ++KLLL K  FH K+ + P  L + +D++ +   G +V+++F+L +++ DY++  +   ++V   L+ S + S    GQC+L PLIQVIQD + LY  +V+++FKLHS L  D L GHR RF + F S+++FFK A  + YFK L+Q+P LP+ PPNF+  S L      VV +  E   D    + P +   +LI+ +             E E     N     L+KEIE L+A +E++K+E ++ +  L  +I  LE E+        K LV   Q++D+ E+ + ++ E+ +   V  +AEK        + K+K+ +++L   H   LR+     +Q+   + N++E+  ++++LE       R  +L KLE ++     ++  I+    EL   Q  L   E SK +              L   + +L++E D  K +   + S++    N ++        + +K  S+I +L    +++ ++   E +   KM     N+I+   + ++  I+     L       C +S D +      AL  I ++ N   + + +         ++ +F    +DT+  G   ++    +  D++N+S     NQS  +L +++N   + N     + ++L ++ +L + +R  +L+       D+ D+E+ +T  AI+ AV R +            +    N K                       KEI+  G+G  +  +FY K+ +WTEGLISA+KAVG GAT L E+AD ++   GK+EEL++ S EI AST QLV +S+VKA+  S N   L Q SR V++    V+A+ K+    +E++ + +FS ++L + K+ EM+SQVKVLELEN L+ ER RLGELR++HY LAG
Sbjct:   10 RVLSRRTGHGLEAEREQFDRNQAISISKAINTQEAPVKEKHARRIILGTHHEKGAFTFWSYAIGLPLPSSSILSWKFCHVLHKVLRDGHPNVLSDCQRYRSNIRETGELWGHMHDRYGQLVNIYTKLLLNKISFHVKHPEFPPGLEV-TDDVLEKSAGTDVNNIFQLTVEMFDYMDCELKLAEAVFRQLNSSIAVSQMAAGQCKLAPLIQVIQDCSHLYHYTVKLMFKLHSCLPPDTLQGHRDRFHEQFHSLKNFFKRASDMLYFKRLIQIPRLPDGPPNFLRASALAEHVKPVVVIPNETPED----EEPAE---SLIEISAAQP--------VEQEDLQIEN-----LQKEIELLRAELEKIKLEAQKYILQLKGQINTLEAELEEQRKQKQKALVDNEQLRDELEKLKKQKLENEKTQGVLLEAEKKIQATELRYTKLKEKHNELINTHAGLLRKNADTAKQLTVSQQNQEEVARIKEELEFQMDQVKRESDL-KLEDQSFQTEQLKSEIEAKKKELLLIQQSLSSTEESKSQ--------------LNSTLMSLEVEKDTLKSLLTTKESELSSAQNLARDTETLFNQEQEKKASEIRDLH---EKLNKKTTDEQKLYQKMLEDQFNIIQGTVREAENIIQDAVAKLDDPLHIRCTSSPDYLVCRAQAALDSIPHLENGHAKYIQNMTDASDLVGALAQFAHLTADTIVNGSATSHLAPPDHADRLNDSCKECGNQSLDYLSSLKNKHSLKNADLAEVNRSLKRIFDLGQELRPKSLDIKQEELGDMVDKEMASTSAAIEAAVRRIE------------VSFWYNNK-----------------------KEIVESGRGAATTQEFYAKNSRWTEGLISASKAVGWGATQLVESADKVVLHKGKYEELIVGSHEIAASTAQLVAASKVKADKNSKNLPKLQQCSRHVNEMAANVVASTKSGQEQIEDKDTMDFSGMSLIKLKKEEMESQVKVLELENMLQNERMRLGELRRQHYALAG 957          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Mouse
Match: Hip1 (huntingtin interacting protein 1 [Source:MGI Symbol;Acc:MGI:1099804])

HSP 1 Score: 523.857 bits (1348), Expect = 1.299e-168
Identity = 373/1015 (36.75%), Postives = 562/1015 (55.37%), Query Frame = 3
Query:   84 ENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGK-NVDSLFELGLDILDYLE-ELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEE---PDVDLNNCDSPTDRNSTLIDFN---QIDNNDRFDQIFGEM---ETFPFNN------DERN----ELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEVK-----GLVQMKDQ--YEERLREYESHRHDSVDAEK---------------FNKIKDAYSKLREEHVKKLREQGIDRQQIETNKK---ELESLQKQLEDRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSKYDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILN-NDSGNLYDQINESYYNVYNQSKSFLENIENNDDV-NLSSTRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAG 2984
            E E FE+ Q   ++KAIN+ E A KEKH R  ILGT H  G+  F+   +   L  N ++CWK+ +  HK++RDGH   L D ++ + E+  +   WGHL  GYG + S + KLL  + ++H K  + PGNL +   ++ + G+ +V++ F+L +++ DYLE EL +F+ +V +SLD S+S S+T  GQCRL PLIQVI D + LYD +V++LFKLHS L  D L GHR RF++ F  ++D F+ +  LQYFK L+Q+P LPENPPNF+  S L    + VV +  E   PD +      P      L+D +   Q   +++FD +FG     + F FNN      DE++     L +EI  L   ++ MKIE +  +  L  R+  LE E+      G   M D       L E +  R D+  A++               ++K+K+ YS+L + H   LR+     +Q+   ++   +LE  +K+L D     A+ +++  V       ++   HELA ++ +L+    S  E  A+++         L QI  L    +KE+       +Q E+EL+  +  L+ +  K   L    + M +Q+K + ++      L   + K A +  Q+A+ +    L+   L SC  S+D +   +    + ++ +     + L   E   +   SI        DT+ QG   +        D + E+      ++ ++L ++E    + N   T L   L+++K L E +    L+       DL D+E+  T  AI+ A  R + IL +SR+  +G++LEVNE+IL SC  LM AIKVL+  SKD+QKEI+  G+GT S  +FY K+ +WTEGLISA+KAVG GAT + +AAD ++   GKFEELM+CSREI AST QLV +S+VKAN  S+N   L QASRGV+ AT  V+A+  +    +EE  S +FS++TLTQ KR EMDSQV+VLELENDL+KER++LGELRKKHY+LAG
Sbjct:   32 ERESFERTQTVSVNKAINTQEVAVKEKHARTCILGTHHEKGAQTFWSVVNRLPLSSNAMLCWKFCHVFHKLLRDGHPNVLKDSLRYKNELSDMSRMWGHLSEGYGQLCSIYLKLLRTRMEYHTKNPRFPGNLQMSDRQLDEAGESDVNNFFQLTVEMFDYLECELNLFQ-TVFNSLDMSRSVSVTTAGQCRLAPLIQVILDCSHLYDYTVKLLFKLHSCLPADTLQGHRDRFMEQFTKLKDLFQRSSNLQYFKRLIQIPQLPENPPNFLRASALSEHISPVVVIPAEVSSPDSE------PVLEKDDLMDMDASQQTLFDNKFDDVFGSSLSSDPFNFNNQNGVNKDEKDHLIERLYREISGLTGQLDNMKIESQRAMLQLKGRVSELEAELAEQQHLGRQAMDDCEFLRTELDELKRQREDTEKAQRSLTEIERKAQANEQRYSKLKEKYSELVQNHADLLRKNAEVTKQVSVARQAQVDLEREKKELAD---SFARTQEQQDV-------LENLKHELATSRQELQVL-HSNLETSAQSE------AKWLTQIAEL----EKEQGSLATVAAQREEELSALRDQLESTQIK---LAGAQESMCQQVKDQRKT------LLAGIRKAAEREIQEALSQ----LEEPTLISCAGSTDHLLSKVSSVSSCLEQLEKNGSQYLACPEDISELLHSITLLAHLTGDTIIQGSATSLRAPPEPADSLTEACRQYGRETLAYLSSLEEEGTMENADVTALRNCLSRVKTLGEELLPRGLDIKQEELGDLVDKEMAATSAAIEAATTRIEEILSKSRAGDTGVKLEVNERILGSCTSLMQAIKVLVVASKDLQKEIVESGRGTASPKEFYAKNSRWTEGLISASKAVGWGATIMVDAADLVVQGKGKFEELMVCSREIAASTAQLVAASKVKANKGSLNLTQLQQASRGVNQATAAVVASTISGKSQIEETDSMDFSSMTLTQIKRQEMDSQVRVLELENDLQKERQKLGELRKKHYELAG 1005          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Mouse
Match: Hip1r (huntingtin interacting protein 1 related [Source:MGI Symbol;Acc:MGI:1352504])

HSP 1 Score: 470.315 bits (1209), Expect = 7.162e-148
Identity = 336/1029 (32.65%), Postives = 551/1029 (53.55%), Query Frame = 3
Query:   45 KVFQQRKKTPTELENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQ--LGKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEEPDVDLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFGEMETFPFNN---DERN----ELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEV--------KGLV---------------QMKDQYEERLREYESHRHDSVDAEKFNKIKDAYSKLREEHVKKLREQGIDRQQIETNKKELESLQKQLEDRNIELAKLEKENLVYASMEKNIDQYNH----------ELAEAQAKLKEYERSKFEALAKNKNLESKNVDL---LKQIEALQIESDKEKQMENARLSQIEKELNDSKYDLDKSLSK--INELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILNN-DSGNLYDQINESYYNVYNQSKSFLENIENNDDVNLSSTRLIKT-LNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAG 2984
            +V  +R     E E EQF+K Q   ISKAINS E   KEKH R +ILGT H  G+  F+ +     L  + I+ WK+ + +HK++RDGH   L D  +    I+ +G+ WGHL+  YG +++ ++KLLL K  FH K+ + P  L + +DE+ +   G +V+++F+L +++ DY++  +   +SV   L+ + + S    GQCRL PLIQVIQD + LY  +V+++FKLHS L  D L GHR RF + F S+++FF+ A  + YFK L+Q+P LPE PPNF+  S L      VV V  E   +    ++  + +S       +   D FDQ FG     P N    D+R+     LK+E+E L+A +E++K+E +  ++ L  ++  LE E+        K LV               Q++    + LRE E+ R  S    +++K+K+ +S+L   H + LR+     +Q+   ++  E + +  E    ++ + ++E+ +   ME+  DQ             ELA AQ  L   E+S  E  ++   L ++   L   ++Q EA  + +    + +   LSQ ++  +  K +L   L++    E GL  K ++EQL     + ++   +            Q A+ K +  L       C +S D +      AL  +  +     + L SSE       ++ +F    +DT+  G   ++    +  D++ ++      ++   +  +++   +  +   L++  L  +  L + ++  +L+        + D+E+  T  AI+ AV R + ++ Q+R   SG++LEVNE+IL SC +LM AI++L+  S  +QKEI+  G+G  +  +FY K+ +WTEGLISA+KAVG GAT L E+AD ++   GK+EEL++CS EI AST QLV +S+VKAN  S +   L + SR V++    V+A+ K+    +E++ + +FS L+L + K+ EM++QV+VLELE  LE ER RLGELRK+HY LAG
Sbjct:   10 RVLSRRPGHSLEAEREQFDKTQAISISKAINSQEAPVKEKHARRIILGTHHEKGAFTFWSYAIGLPLSSSSILSWKFCHVLHKVLRDGHPNVLHDYQRYRSNIREIGDLWGHLRDQYGHLVNIYTKLLLTKISFHLKHPQFPAGLEV-TDEVLEKAAGTDVNNIFQLTVEMFDYMDCELKLSESVFRQLNTAIAVSQMSSGQCRLAPLIQVIQDCSHLYHYTVKLMFKLHSCLPADTLQGHRDRFHEQFHSLKNFFRRASDMLYFKRLIQIPRLPEGPPNFLRASALAEHIKPVV-VIPEEAPEEEEPENLIEISSAPPAGEPVVVADLFDQTFG-----PPNGSMKDDRDLQIENLKREVETLRAELEKIKMEAQRYISQLKGQVNGLEAELEEQRKQKQKALVDNEQLRHELAQLKALQLEGARNQGLRE-EAERKASATEARYSKLKEKHSELINTHAELLRKNADTAKQLTVTQQSQEEVARVKEQLAFQMEQAKRESEM--KMEEQSDQLEKLKRELAARAGELARAQEALSRTEQSGSELSSRLDTLNAEKEALSGVVRQREAELLAAQSLVREKEEALSQEQQRSSQEKGELRGQLAEKESQEQGLRQKLLDEQLAVLRSAAAEAEAIL-----------QDAVSKLDDPLHLR----CTSSPDYLVSRAQAALDSVSGLEQGHTQYLASSEDASALVAALTRFSHLAADTIVNGAATSHLAPTDPADRLMDTCRECGARALELVGQLQDQTVLPRAQPSLMRAPLQGILQLGQDLKPKSLDVRQEELGAMVDKEMAATSAAIEDAVRRIEDMMSQARHESSGVKLEVNERILNSCTDLMKAIRLLVMTSTSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVESADKVVLHMGKYEELIVCSHEIAASTAQLVAASKVKANKNSPHLSRLQECSRTVNERAANVVASTKSGQEQIEDRDTMDFSGLSLIKLKKQEMETQVRVLELEKTLEAERVRLGELRKQHYVLAG 1013          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Mouse
Match: Hip1 (huntingtin interacting protein 1 [Source:MGI Symbol;Acc:MGI:1099804])

HSP 1 Score: 258.84 bits (660), Expect = 1.409e-76
Identity = 146/371 (39.35%), Postives = 218/371 (58.76%), Query Frame = 3
Query:  120 ISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGK-NVDSLFELGLDILDYLE-ELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEE---PDVDLNNCDSPTDRNSTLIDFN---QIDNNDRFDQIFG-EMETFPFNNDERN------------ELKKEIEYLKALIERMKIEHREKVNSLLA 1169
            ++KAIN+ E A KEKH R  ILGT H  G+  F+   +   L  N ++CWK+ +  HK++RDGH   L D ++ + E+  +   WGHL  GYG + S + KLL  + ++H K  + PGNL +   ++ + G+ +V++ F+L +++ DYLE EL +F+ +V +SLD S+S S+T  GQCRL PLIQVI D + LYD +V++LFKLHS L  D L GHR RF++ F  ++D F+ +  LQYFK L+Q+P LPENPPNF+  S L    + VV +  E   PD +      P      L+D +   Q   +++FD +FG  + + PFN + +N             L +EI  L   ++ MKIE   +V+  L 
Sbjct:   19 VNKAINTQEVAVKEKHARTCILGTHHEKGAQTFWSVVNRLPLSSNAMLCWKFCHVFHKLLRDGHPNVLKDSLRYKNELSDMSRMWGHLSEGYGQLCSIYLKLLRTRMEYHTKNPRFPGNLQMSDRQLDEAGESDVNNFFQLTVEMFDYLECELNLFQ-TVFNSLDMSRSVSVTTAGQCRLAPLIQVILDCSHLYDYTVKLLFKLHSCLPADTLQGHRDRFMEQFTKLKDLFQRSSNLQYFKRLIQIPQLPENPPNFLRASALSEHISPVVVIPAEVSSPDSE------PVLEKDDLMDMDASQQTLFDNKFDDVFGSSLSSDPFNFNNQNGVNKDEKDHLIERLYREISGLTGQLDNMKIEVHSRVHVRLG 382          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Mouse
Match: Hip1 (huntingtin interacting protein 1 [Source:MGI Symbol;Acc:MGI:1099804])

HSP 1 Score: 256.529 bits (654), Expect = 2.334e-73
Identity = 211/584 (36.13%), Postives = 325/584 (55.65%), Query Frame = 3
Query: 1248 ESHRHDSVDAEKFNKIKDAYSKLREEHVKKLREQGIDRQQIETNKK---ELESLQKQLEDRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSKYDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILN-NDSGNLYDQINESYYNVYNQSKSFLENIENNDDV-NLSSTRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAG 2984
            E  R    + ++++K+K+ YS+L + H   LR+     +Q+   ++   +LE  +K+L D     A+ +++  V       ++   HELA ++ +L+    S  E  A+++         L QI  L    +KE+       +Q E+EL+  +  L+ +  K   L    + M +Q+K + ++      L   + K A +  Q+A+ +    L+   L SC  S+D +   +    + ++ +     + L   E   +   SI        DT+ QG   +        D + E+      ++ ++L ++E    + N   T L   L+++K L E +    L+       DL D+E+  T  AI+ A  R + IL +SR+  +G++LEVNE+IL SC  LM AIKVL+  SKD+QKEI+  G+GT S  +FY K+ +WTEGLISA+KAVG GAT + +AAD ++   GKFEELM+CSREI AST QLV +S+VKAN  S+N   L QASRGV+ AT  V+A+  +    +EE  S +FS++TLTQ KR EMDSQV+VLELENDL+KER++LGELRKKHY+LAG
Sbjct:   45 EIERKAQANEQRYSKLKEKYSELVQNHADLLRKNAEVTKQVSVARQAQVDLEREKKELAD---SFARTQEQQDV-------LENLKHELATSRQELQVL-HSNLETSAQSE------AKWLTQIAEL----EKEQGSLATVAAQREEELSALRDQLESTQIK---LAGAQESMCQQVKDQRKT------LLAGIRKAAEREIQEALSQ----LEEPTLISCAGSTDHLLSKVSSVSSCLEQLEKNGSQYLACPEDISELLHSITLLAHLTGDTIIQGSATSLRAPPEPADSLTEACRQYGRETLAYLSSLEEEGTMENADVTALRNCLSRVKTLGEELLPRGLDIKQEELGDLVDKEMAATSAAIEAATTRIEEILSKSRAGDTGVKLEVNERILGSCTSLMQAIKVLVVASKDLQKEIVESGRGTASPKEFYAKNSRWTEGLISASKAVGWGATIMVDAADLVVQGKGKFEELMVCSREIAASTAQLVAASKVKANKGSLNLTQLQQASRGVNQATAAVVASTISGKSQIEETDSMDFSSMTLTQIKRQEMDSQVRVLELENDLQKERQKLGELRKKHYELAG 594          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Mouse
Match: Hip1 (huntingtin interacting protein 1 [Source:MGI Symbol;Acc:MGI:1099804])

HSP 1 Score: 149.828 bits (377), Expect = 8.959e-41
Identity = 76/184 (41.30%), Postives = 117/184 (63.59%), Query Frame = 3
Query:  120 ISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGK-NVDSLFELGLDILDYLE-ELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLI 665
            ++KAIN+ E A KEKH R  ILGT H  G+  F+   +   L  N ++CWK+ +  HK++RDGH   L D ++ + E+  +   WGHL  GYG + S + KLL  + ++H K  + PGNL +   ++ + G+ +V++ F+L +++ DYLE EL +F+ +V +SLD S+S S+T  GQCRL PLI
Sbjct:   10 VNKAINTQEVAVKEKHARTCILGTHHEKGAQTFWSVVNRLPLSSNAMLCWKFCHVFHKLLRDGHPNVLKDSLRYKNELSDMSRMWGHLSEGYGQLCSIYLKLLRTRMEYHTKNPRFPGNLQMSDRQLDEAGESDVNNFFQLTVEMFDYLECELNLFQ-TVFNSLDMSRSVSVTTAGQCRLAPLI 192          
BLAST of Huntingtin-interacting protein 1 vs. UniProt/SwissProt
Match: sp|O00291|HIP1_HUMAN (Huntingtin-interacting protein 1 OS=Homo sapiens OX=9606 GN=HIP1 PE=1 SV=5)

HSP 1 Score: 526.939 bits (1356), Expect = 6.307e-169
Identity = 360/1015 (35.47%), Postives = 551/1015 (54.29%), Query Frame = 3
Query:   84 ENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGK-NVDSLFELGLDILDYLE-ELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEE---PDVDLNNCDSPTDRNSTLIDFNQIDNN---DRFDQIFGE-METFPFNNDERN------------ELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEVKGLVQMKDQYEE-------RLREYESHRHDSVDAEK---------------FNKIKDAYSKLREEHVKKLREQGIDRQQIETNKK---ELESLQKQLEDRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSKYDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILN-NDSGNLYDQINESYYNVYNQSKSFLENIENNDDV-NLSSTRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAG 2984
            E E FE+ Q   I+KAIN+ E A KEKH R  ILGT H  G+  F+   +   L  N ++CWK+ +  HK++RDGH   L D ++   E+  +   WGHL  GYG + S + KLL  K ++H K  + PGNL +   ++ + G+ +V++ F+L +++ DYLE EL +F+ +V +SLD S+S S+T  GQCRL PLIQVI D + LYD +V++LFKLHS L  D L GHR RF++ F  ++D F  +  LQYFK L+Q+P LPENPPNF+  S L    + VV +  E   PD +      P      L+D +    N   ++FD IFG    + PFN + +N             L +EI  LKA +E MK E +  V  L   +  LE ++     ++ Q  +        L E    R D+  A++               ++K+K+ YS+L + H   LR+     +Q+   ++   +LE  +K+LED ++E    + +      +E  ++    ELA +Q +L+  + S   +     N  ++  +L K+ ++L +     ++ E   LS + KEL D++  L  +   + +L    ++M                    ++  + + ++Q I+     L+   L SC  S+D +  T+    + I+ +     + L   E       SI       SD +  G            D + E+      ++ ++L ++E    + N  ST +   L+++K + E +    L+       DL D+E+  T  AI+ A  R + +L +SR+  +G++LEVNE+IL  C  LM AI+VLI  SKD+Q+EI+  G+GT S  +FY K+ +WTEGLISA+KAVG GAT + +AAD ++   GKFEELM+CS EI AST QLV +S+VKA+  S N   L QASRGV+ AT  V+A+  +    +EE  + +FS++TLTQ KR EMDSQV+VLELEN+L+KER++LGELRKKHY+LAG
Sbjct:   32 ERESFERTQTVSINKAINTQEVAVKEKHARTCILGTHHEKGAQTFWSVVNRLPLSSNAVLCWKFCHVFHKLLRDGHPNVLKDSLRYRNELSDMSRMWGHLSEGYGQLCSIYLKLLRTKMEYHTKNPRFPGNLQMSDRQLDEAGESDVNNFFQLTVEMFDYLECELNLFQ-TVFNSLDMSRSVSVTAAGQCRLAPLIQVILDCSHLYDYTVKLLFKLHSCLPADTLQGHRDRFMEQFTKLKDLFYRSSNLQYFKRLIQIPQLPENPPNFLRASALSEHISPVVVIPAEASSPDSE------PVLEKDDLMDMDASQQNLFDNKFDDIFGSSFSSDPFNFNSQNGVNKDEKDHLIERLYREISGLKAQLENMKTESQRVVLQLKGHVSELEADLAEQQHLRQQAADDCEFLRAELDELRRQREDTEKAQRSLSEIERKAQANEQRYSKLKEKYSELVQNHADLLRKNAEVTKQVSMARQAQVDLEREKKELED-SLERISDQGQRKTQEQLEV-LESLKQELATSQRELQVLQGSLETSAQSEANWAAEFAELEKERDSL-VSGAAHREEE---LSALRKELQDTQLKLASTEESMCQLAKDQRKM--------------------LLVGSRKAAEQVIQDALNQLEEPPLISCAGSADHLLSTVTSISSCIEQLEKSWSQYLACPEDISGLLHSITLLAHLTSDAIAHGATTCLRAPPEPADSLTEACKQYGRETLAYLASLEEEGSLENADSTAMRNCLSKIKAIGEELLPRGLDIKQEELGDLVDKEMAATSAAIETATARIEEMLSKSRAGDTGVKLEVNERILGCCTSLMQAIQVLIVASKDLQREIVESGRGTASPKEFYAKNSRWTEGLISASKAVGWGATVMVDAADLVVQGRGKFEELMVCSHEIAASTAQLVAASKVKADKDSPNLAQLQQASRGVNQATAGVVASTISGKSQIEETDNMDFSSMTLTQIKRQEMDSQVRVLELENELQKERQKLGELRKKHYELAG 1013          
BLAST of Huntingtin-interacting protein 1 vs. UniProt/SwissProt
Match: sp|Q8VD75|HIP1_MOUSE (Huntingtin-interacting protein 1 OS=Mus musculus OX=10090 GN=Hip1 PE=1 SV=2)

HSP 1 Score: 523.857 bits (1348), Expect = 9.087e-168
Identity = 373/1015 (36.75%), Postives = 562/1015 (55.37%), Query Frame = 3
Query:   84 ENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGK-NVDSLFELGLDILDYLE-ELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEE---PDVDLNNCDSPTDRNSTLIDFN---QIDNNDRFDQIFGEM---ETFPFNN------DERN----ELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEVK-----GLVQMKDQ--YEERLREYESHRHDSVDAEK---------------FNKIKDAYSKLREEHVKKLREQGIDRQQIETNKK---ELESLQKQLEDRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSKYDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILN-NDSGNLYDQINESYYNVYNQSKSFLENIENNDDV-NLSSTRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAG 2984
            E E FE+ Q   ++KAIN+ E A KEKH R  ILGT H  G+  F+   +   L  N ++CWK+ +  HK++RDGH   L D ++ + E+  +   WGHL  GYG + S + KLL  + ++H K  + PGNL +   ++ + G+ +V++ F+L +++ DYLE EL +F+ +V +SLD S+S S+T  GQCRL PLIQVI D + LYD +V++LFKLHS L  D L GHR RF++ F  ++D F+ +  LQYFK L+Q+P LPENPPNF+  S L    + VV +  E   PD +      P      L+D +   Q   +++FD +FG     + F FNN      DE++     L +EI  L   ++ MKIE +  +  L  R+  LE E+      G   M D       L E +  R D+  A++               ++K+K+ YS+L + H   LR+     +Q+   ++   +LE  +K+L D     A+ +++  V       ++   HELA ++ +L+    S  E  A+++         L QI  L    +KE+       +Q E+EL+  +  L+ +  K   L    + M +Q+K + ++      L   + K A +  Q+A+ +    L+   L SC  S+D +   +    + ++ +     + L   E   +   SI        DT+ QG   +        D + E+      ++ ++L ++E    + N   T L   L+++K L E +    L+       DL D+E+  T  AI+ A  R + IL +SR+  +G++LEVNE+IL SC  LM AIKVL+  SKD+QKEI+  G+GT S  +FY K+ +WTEGLISA+KAVG GAT + +AAD ++   GKFEELM+CSREI AST QLV +S+VKAN  S+N   L QASRGV+ AT  V+A+  +    +EE  S +FS++TLTQ KR EMDSQV+VLELENDL+KER++LGELRKKHY+LAG
Sbjct:   32 ERESFERTQTVSVNKAINTQEVAVKEKHARTCILGTHHEKGAQTFWSVVNRLPLSSNAMLCWKFCHVFHKLLRDGHPNVLKDSLRYKNELSDMSRMWGHLSEGYGQLCSIYLKLLRTRMEYHTKNPRFPGNLQMSDRQLDEAGESDVNNFFQLTVEMFDYLECELNLFQ-TVFNSLDMSRSVSVTTAGQCRLAPLIQVILDCSHLYDYTVKLLFKLHSCLPADTLQGHRDRFMEQFTKLKDLFQRSSNLQYFKRLIQIPQLPENPPNFLRASALSEHISPVVVIPAEVSSPDSE------PVLEKDDLMDMDASQQTLFDNKFDDVFGSSLSSDPFNFNNQNGVNKDEKDHLIERLYREISGLTGQLDNMKIESQRAMLQLKGRVSELEAELAEQQHLGRQAMDDCEFLRTELDELKRQREDTEKAQRSLTEIERKAQANEQRYSKLKEKYSELVQNHADLLRKNAEVTKQVSVARQAQVDLEREKKELAD---SFARTQEQQDV-------LENLKHELATSRQELQVL-HSNLETSAQSE------AKWLTQIAEL----EKEQGSLATVAAQREEELSALRDQLESTQIK---LAGAQESMCQQVKDQRKT------LLAGIRKAAEREIQEALSQ----LEEPTLISCAGSTDHLLSKVSSVSSCLEQLEKNGSQYLACPEDISELLHSITLLAHLTGDTIIQGSATSLRAPPEPADSLTEACRQYGRETLAYLSSLEEEGTMENADVTALRNCLSRVKTLGEELLPRGLDIKQEELGDLVDKEMAATSAAIEAATTRIEEILSKSRAGDTGVKLEVNERILGSCTSLMQAIKVLVVASKDLQKEIVESGRGTASPKEFYAKNSRWTEGLISASKAVGWGATIMVDAADLVVQGKGKFEELMVCSREIAASTAQLVAASKVKANKGSLNLTQLQQASRGVNQATAAVVASTISGKSQIEETDSMDFSSMTLTQIKRQEMDSQVRVLELENDLQKERQKLGELRKKHYELAG 1005          
BLAST of Huntingtin-interacting protein 1 vs. UniProt/SwissProt
Match: sp|O75146|HIP1R_HUMAN (Huntingtin-interacting protein 1-related protein OS=Homo sapiens OX=9606 GN=HIP1R PE=1 SV=2)

HSP 1 Score: 481.1 bits (1237), Expect = 3.992e-151
Identity = 340/1043 (32.60%), Postives = 553/1043 (53.02%), Query Frame = 3
Query:   45 KVFQQRKKTPTELENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQ--LGKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEEPDVDLNNCDSPTDRNSTLIDFN-------QIDNNDRFDQIFGEMETFPFNN---DERN----ELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEV--------KGLV---------------QMKDQYEERLREYESHRHDSVDAEKFNKIKDAYSKLREEHVKKLREQGIDRQQI---ETNKKELESLQKQLE------DRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLES-----------KNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSKYDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILNN-DSGNLYDQINESYYNVYNQSKSFLENIENNDDVNLSSTRLIKT-LNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAGET 2990
            +V  +R     E E EQF+K Q   ISKAIN+ E   KEKH R +ILGT H  G+  F+ +     L  + I+ WK+ + +HK++RDGH   L D  +    I+ +G+ WGHL   YG +++ ++KLLL K  FH K+ + P  L + +DE+ +   G +V+++F+L +++ DY++  +   +SV   L+ + + S    GQCRL PLIQVIQD + LY  +V++LFKLHS L  D L GHR RF + F S+R+FF+ A  + YFK L+Q+P LPE PPNF+  S      AL  ++  +P V +       +    LI+ +        +   D FDQ FG     P N    D+R+     LK+E+E L++ +E++K+E +  +  L +++  LE E+        K LV               Q++ +  + LRE E+ R  S    ++NK+K+ +S+L   H + LR+     +Q+   + +++E+  +++QL        R  EL KLE+++     +++ ++    ELA AQ  L   E+SK E  ++   L +           +  DLL   ++L  E++     E  R SQ + EL     + +       E GL  + ++EQ             +       A    Q A+ K +  L       C +S D +     +AL  +  +     + L S         ++ +F    +DT+  G   ++    +  D++ ++      ++   +  +++   +      L++T L  +  L + ++  +L+        + D+E+  T  AI+ AV R + ++ Q+R   SG++LEVNE+IL SC +LM AI++L+  S  +QKEI+  G+G  +  +FY K+ +WTEGLISA+KAVG GAT L EAAD ++   GK+EEL++CS EI AST QLV +S+VKAN  S +   L + SR V++    V+A+ K+    +E++ + +FS L+L + K+ EM++QV+VLELE  LE ER RLGELRK+HY LAG +
Sbjct:   10 RVLSRRPGHSLEAEREQFDKTQAISISKAINTQEAPVKEKHARRIILGTHHEKGAFTFWSYAIGLPLPSSSILSWKFCHVLHKVLRDGHPNVLHDCQRYRSNIREIGDLWGHLHDRYGQLVNVYTKLLLTKISFHLKHPQFPAGLEV-TDEVLEKAAGTDVNNIFQLTVEMFDYMDCELKLSESVFRQLNTAIAVSQMSSGQCRLAPLIQVIQDCSHLYHYTVKLLFKLHSCLPADTLQGHRDRFHEQFHSLRNFFRRASDMLYFKRLIQIPRLPEGPPNFLRAS------ALAEHI--KPVVVIPEEAPEDEEPENLIEISTGPPAGEPVVVADLFDQTFG-----PPNGSVKDDRDLQIESLKREVEMLRSELEKIKLEAQRYIAQLKSQVNALEGELEEQRKQKQKALVDNEQLRHELAQLRAAQLEGERSQGLRE-EAERKASATEARYNKLKEKHSELVHVHAELLRKNADTAKQLTVTQQSQEEVARVKEQLAFQVEQVKRESEL-KLEEKSDQLEKLKRELEAKAGELARAQEALSHTEQSKSELSSRLDTLSAEKDALSGAVRQREADLLA-AQSLVRETEAALSREQQRSSQEQGELQGRLAERES-----QEQGLRQRLLDEQFA-----------VLRGAAAEAAGILQDAVSKLDDPLHLR----CTSSPDYLVSRAQEALDAVSTLEEGHAQYLTSLADASALVAALTRFSHLAADTIINGGATSHLAPTDPADRLIDTCRECGARALELMGQLQDQQALRHMQASLVRTPLQGILQLGQELKPKSLDVRQEELGAVVDKEMAATSAAIEDAVRRIEDMMNQARHASSGVKLEVNERILNSCTDLMKAIRLLVTTSTSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVEAADKVVLHTGKYEELIVCSHEIAASTAQLVAASKVKANKHSPHLSRLQECSRTVNERAANVVASTKSGQEQIEDRDTMDFSGLSLIKLKKQEMETQVRVLELEKTLEAERMRLGELRKQHYVLAGAS 1015          
BLAST of Huntingtin-interacting protein 1 vs. UniProt/SwissProt
Match: sp|Q9JKY5|HIP1R_MOUSE (Huntingtin-interacting protein 1-related protein OS=Mus musculus OX=10090 GN=Hip1r PE=1 SV=2)

HSP 1 Score: 470.315 bits (1209), Expect = 5.010e-147
Identity = 336/1029 (32.65%), Postives = 551/1029 (53.55%), Query Frame = 3
Query:   45 KVFQQRKKTPTELENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQ--LGKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEEPDVDLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFGEMETFPFNN---DERN----ELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEV--------KGLV---------------QMKDQYEERLREYESHRHDSVDAEKFNKIKDAYSKLREEHVKKLREQGIDRQQIETNKKELESLQKQLEDRNIELAKLEKENLVYASMEKNIDQYNH----------ELAEAQAKLKEYERSKFEALAKNKNLESKNVDL---LKQIEALQIESDKEKQMENARLSQIEKELNDSKYDLDKSLSK--INELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILNN-DSGNLYDQINESYYNVYNQSKSFLENIENNDDVNLSSTRLIKT-LNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAG 2984
            +V  +R     E E EQF+K Q   ISKAINS E   KEKH R +ILGT H  G+  F+ +     L  + I+ WK+ + +HK++RDGH   L D  +    I+ +G+ WGHL+  YG +++ ++KLLL K  FH K+ + P  L + +DE+ +   G +V+++F+L +++ DY++  +   +SV   L+ + + S    GQCRL PLIQVIQD + LY  +V+++FKLHS L  D L GHR RF + F S+++FF+ A  + YFK L+Q+P LPE PPNF+  S L      VV V  E   +    ++  + +S       +   D FDQ FG     P N    D+R+     LK+E+E L+A +E++K+E +  ++ L  ++  LE E+        K LV               Q++    + LRE E+ R  S    +++K+K+ +S+L   H + LR+     +Q+   ++  E + +  E    ++ + ++E+ +   ME+  DQ             ELA AQ  L   E+S  E  ++   L ++   L   ++Q EA  + +    + +   LSQ ++  +  K +L   L++    E GL  K ++EQL     + ++   +            Q A+ K +  L       C +S D +      AL  +  +     + L SSE       ++ +F    +DT+  G   ++    +  D++ ++      ++   +  +++   +  +   L++  L  +  L + ++  +L+        + D+E+  T  AI+ AV R + ++ Q+R   SG++LEVNE+IL SC +LM AI++L+  S  +QKEI+  G+G  +  +FY K+ +WTEGLISA+KAVG GAT L E+AD ++   GK+EEL++CS EI AST QLV +S+VKAN  S +   L + SR V++    V+A+ K+    +E++ + +FS L+L + K+ EM++QV+VLELE  LE ER RLGELRK+HY LAG
Sbjct:   10 RVLSRRPGHSLEAEREQFDKTQAISISKAINSQEAPVKEKHARRIILGTHHEKGAFTFWSYAIGLPLSSSSILSWKFCHVLHKVLRDGHPNVLHDYQRYRSNIREIGDLWGHLRDQYGHLVNIYTKLLLTKISFHLKHPQFPAGLEV-TDEVLEKAAGTDVNNIFQLTVEMFDYMDCELKLSESVFRQLNTAIAVSQMSSGQCRLAPLIQVIQDCSHLYHYTVKLMFKLHSCLPADTLQGHRDRFHEQFHSLKNFFRRASDMLYFKRLIQIPRLPEGPPNFLRASALAEHIKPVV-VIPEEAPEEEEPENLIEISSAPPAGEPVVVADLFDQTFG-----PPNGSMKDDRDLQIENLKREVETLRAELEKIKMEAQRYISQLKGQVNGLEAELEEQRKQKQKALVDNEQLRHELAQLKALQLEGARNQGLRE-EAERKASATEARYSKLKEKHSELINTHAELLRKNADTAKQLTVTQQSQEEVARVKEQLAFQMEQAKRESEM--KMEEQSDQLEKLKRELAARAGELARAQEALSRTEQSGSELSSRLDTLNAEKEALSGVVRQREAELLAAQSLVREKEEALSQEQQRSSQEKGELRGQLAEKESQEQGLRQKLLDEQLAVLRSAAAEAEAIL-----------QDAVSKLDDPLHLR----CTSSPDYLVSRAQAALDSVSGLEQGHTQYLASSEDASALVAALTRFSHLAADTIVNGAATSHLAPTDPADRLMDTCRECGARALELVGQLQDQTVLPRAQPSLMRAPLQGILQLGQDLKPKSLDVRQEELGAMVDKEMAATSAAIEDAVRRIEDMMSQARHESSGVKLEVNERILNSCTDLMKAIRLLVMTSTSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVESADKVVLHMGKYEELIVCSHEIAASTAQLVAASKVKANKNSPHLSRLQECSRTVNERAANVVASTKSGQEQIEDRDTMDFSGLSLIKLKKQEMETQVRVLELEKTLEAERVRLGELRKQHYVLAG 1013          
BLAST of Huntingtin-interacting protein 1 vs. UniProt/SwissProt
Match: sp|Q02328|SLAP2_CAEEL (Huntington interacting protein related 1 OS=Caenorhabditis elegans OX=6239 GN=hipr-1 PE=3 SV=3)

HSP 1 Score: 229.565 bits (584), Expect = 4.653e-61
Identity = 156/531 (29.38%), Postives = 260/531 (48.96%), Query Frame = 3
Query:   90 EQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKT-GYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQK---ALVVNVAEEPDVDLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFGEMETFPFNNDERNE----LKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEVKGLVQMKDQYEERLREYESHRHDS---------VDA---------------------EKFNKIKDAYSKLREEHVKKLREQGIDRQQIETNKK-------ELESLQKQLEDRNIELAKLEKENLVYASMEKN-IDQYNHELAEAQAKLKEYERS 1544
            E F + Q   + KAI   E   K KH R +I+GT     S IF+       L  +P++ WK+ + VHK++RDGH +   +  +       L + W HL T GYG  I  + KLL  +  FH KY  VPG L +   ++  L  ++D++FE+ +D+LD ++ L++ +  V + ++  + NS+ PQGQC L+PLI  I D +  YD  V+++FKLHS++  D L GHR RF  +F+  + F++ +  LQYFK LV +PTLP + PNF+ +SDL + +   A + +   E    LN  D        L++  + +          +  +     D R E    L + +E  K   ER+  E R ++     R          L+QM+ +++   RE + +R ++          DA                     E+FNK+K  Y K R EHV  L + G  ++Q+E ++K       E+ +L +++E+   E  +     L  A  +   +D+   +L +A  +++E +R+
Sbjct:    9 EVFVRAQLEAVQKAITKNEVPLKPKHARTIIVGTHKEKSSGIFWHTVGRIQLEKHPVLTWKFCHLVHKLLRDGHRKVPEETYRYVNRFTQLSQFWKHLNTSGYGPCIESYCKLLHDRVTFHNKYPVVPGKLDLNDSQLKTLEGDLDNMFEMTIDMLDQMDALLVLQDRVYEMMNSLRWNSLIPQGQCMLSPLIIAILDTSKFYDYLVKMIFKLHSQVPPDALEGHRSRFRTIFERTKKFYEESSNLQYFKYLVSIPTLPSHAPNFLQQSDLESYRTPHAYLHSEGSEDGTSLNGHD------GELLNLAEAE---------PQQASPSSQPDPREEQIVMLSRAVEDEKFAKERLIQEARSRIEQYENR----------LLQMQGEFDHAKREADENREEAQRLKNELALRDASRTQTDDARVKEAELKATAAEERFNKMKGVYEKFRSEHVLALTKLGDIQKQLEASEKSKFDKDEEITALNRKVEEAQREAGRA----LTKAEGDAGAVDEMRTQLVKADIEVEELKRT 510          

HSP 2 Score: 199.519 bits (506), Expect = 3.107e-51
Identity = 127/294 (43.20%), Postives = 180/294 (61.22%), Query Frame = 3
Query: 2115 ESYYNVYNQSKSFLE--NIENNDDVNLSSTRLIKTLNQLKNLSESVRINNLESGNANTDDL---FDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLA 2981
            ESY  V +Q K  L    +  +DD  LS    +K L Q      S+ I+     + + D +    ++E+    +AI  AV   + I  ++R +  GI+LEVNE IL +C  LM  I  L+  S+++Q EI+A GK  GS  +FYK++H+WTEGL+SAAKAVG  A  L E+AD ++T  GKFE L++ ++EI AST QL VSSRVKA+  S     LS A++ V+  T +V+A  KN    L ++GS +FS L+L  AK+ EM+SQVK+LELE  L +ER +L  LRK+HY +A
Sbjct:  621 ESYEGVNDQCKKVLAAAKVAFSDDSALSRADKMKLLRQDIQTLNSLMISLPLQTDIDKDVVGNELEQEMRRMDDAIRRAVQEIEAIQRRARESSDGIRLEVNESILANCQALMSVIMQLVIASRELQTEIVAAGKAGGSPAEFYKRNHQWTEGLLSAAKAVGVAARVLVESADGVVTGKGKFEHLIVAAQEIAASTAQLFVSSRVKADKDSSKLDALSVAAKAVNQNTAQVVAAVKNGQTTLNDEGSLDFSYLSLHAAKKEEMESQVKMLELEQSLNQERAKLAALRKQHYHMA 914          
BLAST of Huntingtin-interacting protein 1 vs. TrEMBL
Match: A0A1S3J5V2 (huntingtin-interacting protein 1 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106170383 PE=4 SV=1)

HSP 1 Score: 611.298 bits (1575), Expect = 0.000e+0
Identity = 392/1017 (38.54%), Postives = 600/1017 (59.00%), Query Frame = 3
Query:   60 RKKTPTELENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQL-GKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEEPDVDLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFGE-METFPFNN----------DERNELKK----EIEYLKALIERMKIEHREKVNSLLARIRVLEE---EVKGLVQ--------MKDQYEERLREY-------ESHRHDSVDAEKFNKIKDAYSKLREEHVKKLREQGIDRQQIETNKKELESLQKQLEDRNIELAKLEKENLVYA-SMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSKYDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRI-QFADSIYKFGAKLSDTLYQGKILNNDSGNL--YDQINESYYNVYNQSKSFLENIENN--DDVNLSSTRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAGET 2990
            R +   E+E EQ EK+Q   I KAINS E   KEKH R ++LGT+H  G+ +++   +   L GN IICWK+ + +HKI+RDGH+ A++D +K    +  LG+ WGHLK GYG +I  ++KLL+QK  FH+K   +PGNL++   ++ ++ G++ +  FEL +D+LDY++E++  + +V +SLD S+SNSMT  GQCRL PLIQ IQD   LYD  V++LFKLH+ +  D L+GHR RFLK +  ++ F+  +  LQYFKTL+QVP LPENPPNF++ SDL +     V +  EP+++    ++ T   + L+D   +  +D+FD++FG  +  F F+           DER++L +    EIE LK    R+K    E +  L  RI  LEE   E+K  VQ        MK Q E   ++        E  +H     EKF K+KD Y KLREEHV  +R      +Q++ +K  +E  ++  +    EL +++ E  V++ S++K+ D  + +LA A A L             N  LE +   L +Q+E+L    DK K    + LSQ++ +L   +  LD++ +             ++  ++N+ K  +  + + M+  A    +  ++       S   +S   +++ +    +  L  +      +I+   + +  + +    I      L +T+ QGK  +N + N+   D++  +      +    LE ++    DD +    ++ +++ ++  L E++     +    +  DL D+E+ +T +AI+ A  +F+ ILEQSR   SGIQLEVNEK+L+SC  L+ AIK+L++++KD+Q+EI+++G+GT S  +FYKKHH+WTEGLISAAKAVG GA  L E AD ++  +GKFEELM+CS+EI AST QLVV+S+VKA   S     +S A++GVS+ATG V+A AKNA  ++EEQ + +FS +TL QAKRLEMDSQV+VLELE+ LEKER +L ELRKKHYQLAGE+
Sbjct:    7 RPRGTLEVEREQHEKSQVTSIHKAINSNEVPVKEKHARTIVLGTYHEKGAGMYWGTVNKLPLQGNHIICWKFCHILHKILRDGHKMAIVDSLKYMTHLTDLGKLWGHLKEGYGKLIGAYTKLLVQKLAFHKKNPNIPGNLVLTDQQLDEMAGRDPNGYFELSVDMLDYMDEILSLQAAVFNSLDMSRSNSMTNTGQCRLAPLIQCIQDSCALYDYIVKLLFKLHAVIPPDTLSGHRSRFLKQYGLLKTFYLSSGNLQYFKTLIQVPVLPENPPNFLIASDLASHVTPKVVLPPEPEIETPEVETVT---ADLVD-TTVQQSDKFDEVFGTNLGDFNFSGQNGTPSPPVPDERDQLIQQLMAEIERLKQENARLKERAEEAIGILKQRIADLEERLEEMKKQVQEAEQEKENMKSQLEASAKDTAAVAKLEEMEKHAKASDEKFKKMKDIYGKLREEHVTLIRSFAEVEKQVKADKTVIEEKEQSRKALEQELEQVKMEQQVFSESLQKSADDVSSQLA-ATAAL-------------NTKLEQEKQSLEEQMESL----DKTKSSLESSLSQLQSDLASLQEQLDQAKA-------------DKETTQNQHKITLGEMEQKMLDRAITEGEAILQDAIDQFDSSAHNSVMGTAEYLLSRAEPVLPLLAEFKQ-SIKGYGTDKALLDKLIHGILTCSHGLGETIVQGKSTSNSASNVEQGDELINACRGAGEEGLQVLELLKKGALDDASSQLDKVTESVQKIMQLGETLLPKVEDVKTEDIGDLVDQEMQSTADAIEQATKKFQEILEQSRKTHSGIQLEVNEKMLDSCTSLIMAIKILVEKAKDLQREIVSQGRGTSSAKEFYKKHHRWTEGLISAAKAVGWGANVLVEGADKVVRGEGKFEELMVCSQEIAASTAQLVVASKVKAERGSQALAQMSHAAKGVSEATGNVVATAKNAAAMVEEQDTLDFSKITLHQAKRLEMDSQVRVLELESLLEKERVKLSELRKKHYQLAGES 987          
BLAST of Huntingtin-interacting protein 1 vs. TrEMBL
Match: A0A1S3H739 (huntingtin-interacting protein 1 isoform X3 OS=Lingula unguis OX=7574 GN=LOC106152316 PE=4 SV=1)

HSP 1 Score: 609.757 bits (1571), Expect = 0.000e+0
Identity = 390/1017 (38.35%), Postives = 599/1017 (58.90%), Query Frame = 3
Query:   60 RKKTPTELENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQL-GKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEEPDVDLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFGE-METFPFNN----------DERNELKK----EIEYLKALIERMKIEHREKVNSLLARIRVLEE---EVKGLVQMKDQYEERLREY---------------ESHRHDSVDAEKFNKIKDAYSKLREEHVKKLREQGIDRQQIETNKKELESLQKQLEDRNIELAKLEKENLVYA-SMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSKYDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRI-QFADSIYKFGAKLSDTLYQGKILNNDSGNL--YDQINESYYNVYNQSKSFLENIENN--DDVNLSSTRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAGET 2990
            R +   E+E EQ EK+Q   I KAINS E   KEKH R ++LGT+H  G+ +++   +   L GN IICWK+ + +HKI+RDGH+ A++D +K    +  LG+ WGHLK GYG +I  ++KLL+QK  FH+K   +PGNL++   ++ ++ G++ +  FEL +D+LDY++E++  + +V +SLD S+SNSMT  GQCRL PLIQ IQD   LYD  V++LFKLH+ +  D L+GHR RFLK +  ++ F+  +  LQYFKTL+QVP LPENPPNF++ SDL +     V +  EP+++    ++ T   + L+D   +  +D+FD++FG  +  F F+           DER++L +    EIE LK    R+K    E +  L  RI  LEE   E+K   Q  +Q +E L+                 E  +H     EKF K+KD Y KLREEHV  +R      +Q++ +K  +E  ++  +    EL +++ E  V++ S++K+ D  + +LA A A L             N  LE +   L +Q+E+L    DK K    + LSQ++ +L   +  LD++ +             ++  ++N+ K  +  + + M+  A    +  ++       S   +S   +++ +    +  L  +      +I+   + +  + +    I      L +T+ QGK  +N + N+   D++  +      +    LE ++    DD +    ++ +++ ++  L E++     +    +  DL D+E+ +T +AI+ A  +F+ ILEQSR   SGIQLEVNEK+L+SC  L+ AIK+L++++KD+Q+EI+++G+GT S  +FYKKHH+WTEGLISAAKAVG GA  L E AD ++  +GKFEELM+CS+EI AST QLVV+S+VKA   S     +S A++GVS+ATG V+A AKNA  ++EEQ + +FS +TL QAKRLEMDSQV+VLELE+ LEKER +L ELRKKHYQLAGE+
Sbjct:    7 RPRGTLEVEREQHEKSQVTSIHKAINSNEVPVKEKHARTIVLGTYHEKGAGMYWGTVNKLPLQGNHIICWKFCHILHKILRDGHKMAIVDSLKYMTHLTDLGKLWGHLKEGYGKLIGAYTKLLVQKLAFHKKNPNIPGNLVLTDQQLDEMAGRDPNGYFELSVDMLDYMDEILSLQAAVFNSLDMSRSNSMTNTGQCRLAPLIQCIQDSCALYDYIVKLLFKLHAVIPPDTLSGHRSRFLKQYGLLKTFYLSSGNLQYFKTLIQVPVLPENPPNFLIASDLASHVTPKVVLPPEPEIETPEVETVT---ADLVD-TTVQQSDKFDEVFGTNLGDFNFSGQNGTPSPPVPDERDQLIQQLMAEIERLKQENARLKERAEEAIGILKQRIADLEERLEEMKKQAQEAEQEKENLKSQLEASAKDTAAVAKLEEMEKHAKASDEKFKKMKDIYGKLREEHVTLIRSFAEVEKQVKADKTVIEEKEQTRKALEQELEQVKMEQQVFSESLQKSADDVSSQLA-ATAAL-------------NTKLEQEKQSLEEQMESL----DKTKSSLESSLSQLQSDLASLQEQLDQAKA-------------DKETTQNQHKITLGDMEQKMLDRAITEGEAILQDAIDQFDSSAHNSVMGTAEYLLSRAEPVLPLLAEFKQ-SIKGYGADKALLDKLIHGILTCSHGLGETIVQGKSTSNSASNVEQGDELINACRGAGEEGLQVLELLKKGALDDASSQLDKVTESVQKIMQLGETLLPKVEDVKTEDIGDLVDQEMQSTADAIEQATKKFQEILEQSRKTHSGIQLEVNEKMLDSCTSLIMAIKILVEKAKDLQREIVSQGRGTSSAKEFYKKHHRWTEGLISAAKAVGWGANVLVEGADKVVRGEGKFEELMVCSQEIAASTAQLVVASKVKAERGSQALAQMSHAAKGVSEATGNVVATAKNAAAMVEEQDTLDFSKITLHQAKRLEMDSQVRVLELESLLEKERVKLSELRKKHYQLAGES 987          
BLAST of Huntingtin-interacting protein 1 vs. TrEMBL
Match: A0A1S3J610 (huntingtin-interacting protein 1 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106170383 PE=4 SV=1)

HSP 1 Score: 601.668 bits (1550), Expect = 0.000e+0
Identity = 385/1009 (38.16%), Postives = 584/1009 (57.88%), Query Frame = 3
Query:   60 RKKTPTELENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQL-GKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEEPDVDLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFGEMETFPFNNDERNELKKEIEYLKALIERMKIEH-------REKVNSLLARIRVLEE---EVKGLVQ--------MKDQYEERLREY-------ESHRHDSVDAEKFNKIKDAYSKLREEHVKKLREQGIDRQQIETNKKELESLQKQLEDRNIELAKLEKENLVYA-SMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSKYDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRI-QFADSIYKFGAKLSDTLYQGKILNNDSGNL--YDQINESYYNVYNQSKSFLENIENN--DDVNLSSTRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAGET 2990
            R +   E+E EQ EK+Q   I KAINS E   KEKH R ++LGT+H  G+ +++   +   L GN IICWK+ + +HKI+RDGH+ A++D +K    +  LG+ WGHLK GYG +I  ++KLL+QK  FH+K   +PGNL++   ++ ++ G++ +  FEL +D+LDY++E++  + +V +SLD S+SNSMT  GQCRL PLIQ IQD   LYD  V++LFKLH+ +  D L+GHR RFLK +  ++ F+  +  LQYFKTL+QVP LPENPPNF++ SDL +           P V L             +  + +D   + +         P   DER++L   I+ L A IER+K E+        E +  L  RI  LEE   E+K  VQ        MK Q E   ++        E  +H     EKF K+KD Y KLREEHV  +R      +Q++ +K  +E  ++  +    EL +++ E  V++ S++K+ D  + +LA A A L             N  LE +   L +Q+E+L    DK K    + LSQ++ +L   +  LD++ +             ++  ++N+ K  +  + + M+  A    +  ++       S   +S   +++ +    +  L  +      +I+   + +  + +    I      L +T+ QGK  +N + N+   D++  +      +    LE ++    DD +    ++ +++ ++  L E++     +    +  DL D+E+ +T +AI+ A  +F+ ILEQSR   SGIQLEVNEK+L+SC  L+ AIK+L++++KD+Q+EI+++G+GT S  +FYKKHH+WTEGLISAAKAVG GA  L E AD ++  +GKFEELM+CS+EI AST QLVV+S+VKA   S     +S A++GVS+ATG V+A AKNA  ++EEQ + +FS +TL QAKRLEMDSQV+VLELE+ LEKER +L ELRKKHYQLAGE+
Sbjct:    7 RPRGTLEVEREQHEKSQVTSIHKAINSNEVPVKEKHARTIVLGTYHEKGAGMYWGTVNKLPLQGNHIICWKFCHILHKILRDGHKMAIVDSLKYMTHLTDLGKLWGHLKEGYGKLIGAYTKLLVQKLAFHKKNPNIPGNLVLTDQQLDEMAGRDPNGYFELSVDMLDYMDEILSLQAAVFNSLDMSRSNSMTNTGQCRLAPLIQCIQDSCALYDYIVKLLFKLHAVIPPDTLSGHRSRFLKQYGLLKTFYLSSGNLQYFKTLIQVPVLPENPPNFLIASDLASHVT--------PKVVLPPEPEIETPEVETVTADLVDTTVQQNGT-----PSPPVPDERDQL---IQQLMAEIERLKQENARLKERAEEAIGILKQRIADLEERLEEMKKQVQEAEQEKENMKSQLEASAKDTAAVAKLEEMEKHAKASDEKFKKMKDIYGKLREEHVTLIRSFAEVEKQVKADKTVIEEKEQSRKALEQELEQVKMEQQVFSESLQKSADDVSSQLA-ATAAL-------------NTKLEQEKQSLEEQMESL----DKTKSSLESSLSQLQSDLASLQEQLDQAKA-------------DKETTQNQHKITLGEMEQKMLDRAITEGEAILQDAIDQFDSSAHNSVMGTAEYLLSRAEPVLPLLAEFKQ-SIKGYGTDKALLDKLIHGILTCSHGLGETIVQGKSTSNSASNVEQGDELINACRGAGEEGLQVLELLKKGALDDASSQLDKVTESVQKIMQLGETLLPKVEDVKTEDIGDLVDQEMQSTADAIEQATKKFQEILEQSRKTHSGIQLEVNEKMLDSCTSLIMAIKILVEKAKDLQREIVSQGRGTSSAKEFYKKHHRWTEGLISAAKAVGWGANVLVEGADKVVRGEGKFEELMVCSQEIAASTAQLVVASKVKAERGSQALAQMSHAAKGVSEATGNVVATAKNAAAMVEEQDTLDFSKITLHQAKRLEMDSQVRVLELESLLEKERVKLSELRKKHYQLAGES 967          
BLAST of Huntingtin-interacting protein 1 vs. TrEMBL
Match: A0A1S3H844 (huntingtin-interacting protein 1 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106152316 PE=4 SV=1)

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 383/1003 (38.19%), Postives = 590/1003 (58.82%), Query Frame = 3
Query:  102 KNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQL-GKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEEPDVDLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFGE-METFPFNN----------DERNELKK----EIEYLKALIERMKIEHREKVNSLLARIRVLEE---EVKGLVQMKDQYEERLREY---------------ESHRHDSVDAEKFNKIKDAYSKLREEHVKKLREQGIDRQQIETNKKELESLQKQLEDRNIELAKLEKENLVYA-SMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSKYDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRI-QFADSIYKFGAKLSDTLYQGKILNNDSGNL--YDQINESYYNVYNQSKSFLENIENN--DDVNLSSTRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAGET 2990
            K +   I KAINS E   KEKH R ++LGT+H  G+ +++   +   L GN IICWK+ + +HKI+RDGH+ A++D +K    +  LG+ WGHLK GYG +I  ++KLL+QK  FH+K   +PGNL++   ++ ++ G++ +  FEL +D+LDY++E++  + +V +SLD S+SNSMT  GQCRL PLIQ IQD   LYD  V++LFKLH+ +  D L+GHR RFLK +  ++ F+  +  LQYFKTL+QVP LPENPPNF++ SDL +     V +  EP+++    ++ T   + L+D   +  +D+FD++FG  +  F F+           DER++L +    EIE LK    R+K    E +  L  RI  LEE   E+K   Q  +Q +E L+                 E  +H     EKF K+KD Y KLREEHV  +R      +Q++ +K  +E  ++  +    EL +++ E  V++ S++K+ D  + +LA A A L             N  LE +   L +Q+E+L    DK K    + LSQ++ +L   +  LD++ +             ++  ++N+ K  +  + + M+  A    +  ++       S   +S   +++ +    +  L  +      +I+   + +  + +    I      L +T+ QGK  +N + N+   D++  +      +    LE ++    DD +    ++ +++ ++  L E++     +    +  DL D+E+ +T +AI+ A  +F+ ILEQSR   SGIQLEVNEK+L+SC  L+ AIK+L++++KD+Q+EI+++G+GT S  +FYKKHH+WTEGLISAAKAVG GA  L E AD ++  +GKFEELM+CS+EI AST QLVV+S+VKA   S     +S A++GVS+ATG V+A AKNA  ++EEQ + +FS +TL QAKRLEMDSQV+VLELE+ LEKER +L ELRKKHYQLAGE+
Sbjct:   44 KPKVTSIHKAINSNEVPVKEKHARTIVLGTYHEKGAGMYWGTVNKLPLQGNHIICWKFCHILHKILRDGHKMAIVDSLKYMTHLTDLGKLWGHLKEGYGKLIGAYTKLLVQKLAFHKKNPNIPGNLVLTDQQLDEMAGRDPNGYFELSVDMLDYMDEILSLQAAVFNSLDMSRSNSMTNTGQCRLAPLIQCIQDSCALYDYIVKLLFKLHAVIPPDTLSGHRSRFLKQYGLLKTFYLSSGNLQYFKTLIQVPVLPENPPNFLIASDLASHVTPKVVLPPEPEIETPEVETVT---ADLVD-TTVQQSDKFDEVFGTNLGDFNFSGQNGTPSPPVPDERDQLIQQLMAEIERLKQENARLKERAEEAIGILKQRIADLEERLEEMKKQAQEAEQEKENLKSQLEASAKDTAAVAKLEEMEKHAKASDEKFKKMKDIYGKLREEHVTLIRSFAEVEKQVKADKTVIEEKEQTRKALEQELEQVKMEQQVFSESLQKSADDVSSQLA-ATAAL-------------NTKLEQEKQSLEEQMESL----DKTKSSLESSLSQLQSDLASLQEQLDQAKA-------------DKETTQNQHKITLGDMEQKMLDRAITEGEAILQDAIDQFDSSAHNSVMGTAEYLLSRAEPVLPLLAEFKQ-SIKGYGADKALLDKLIHGILTCSHGLGETIVQGKSTSNSASNVEQGDELINACRGAGEEGLQVLELLKKGALDDASSQLDKVTESVQKIMQLGETLLPKVEDVKTEDIGDLVDQEMQSTADAIEQATKKFQEILEQSRKTHSGIQLEVNEKMLDSCTSLIMAIKILVEKAKDLQREIVSQGRGTSSAKEFYKKHHRWTEGLISAAKAVGWGANVLVEGADKVVRGEGKFEELMVCSQEIAASTAQLVVASKVKAERGSQALAQMSHAAKGVSEATGNVVATAKNAAAMVEEQDTLDFSKITLHQAKRLEMDSQVRVLELESLLEKERVKLSELRKKHYQLAGES 1010          
BLAST of Huntingtin-interacting protein 1 vs. TrEMBL
Match: K1QW15 (Huntingtin-interacting protein 1 OS=Crassostrea gigas OX=29159 GN=CGI_10024892 PE=4 SV=1)

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 388/1069 (36.30%), Postives = 624/1069 (58.37%), Query Frame = 3
Query:   39 IQKVFQQRKKTPTELENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQL-GKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDL---VAQKALVVNVAEEPDVDLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFGEMETF-PFNNDERN----ELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEVKGLVQMKDQY-------EERLREY-----------ESHRHDSVDAEKFNKIKDAYSKLREEHVKKLREQGIDRQQIETNKKELESLQKQLEDRNIELAKLEKEN-LVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEAL-----QIESDKEKQMENAR--LSQIEKELNDS-----------KYDLDKSLS-KINELGLIIKRMEE------QLKSENESKSK-----MSYLYENMIKTACQTSQQAIEKTNKTLQSEDLS--SCRASSDIIRVTIDDALAEIDNINNLAIR------DLDSSEVRIQFADSIYKFGAKLSDTLYQGKILNNDSGNL--YDQINESYYNVYNQSKSFLENIENNDDVNLSSTRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAGETVDQELLDDSMNIEINDE 3041
            I +V   R K+ T++E E FEKNQ   I+KAIN+ E   KEKH+R  ILGTF   G+ +F+   +   + GNPI+CWK+ + +HKI+++GH  +++D  K    +  LG+ WGHLK GYG +I  + +LL+QK +FH+K  ++PGNL +  D+  ++ G +V++ FE+ +D+LDY++E++  ++SV  SLD S+SNSMT  GQCRL PLI  IQD   LYD  V+ LF+LHS L  D L+GHR RF+  ++ ++ F+  +  LQYFK LVQVP LP+ PPNF++ SD    V  +A+V     E + D       TD  + LID ++    D+FD  FG    F P   DER+     L++EI++LK+ IER+K E +  +++    I  LE+ +  L    D+        ++RL E            E+ +H   + EKF K+K+ Y+KLREEHV  +R+     +++E  K+ ++  ++ +++   ++ +LE E  ++  S++++ DQ+       + ++K  E +K   +++ +  E +   L  ++EAL     Q E   + Q++NA+  L+ ++ E+  +           K  L+ +LS K+ +     K +E+      QL S+ E+  K     ++ L+ ++I +A +  +Q I   +  LQ E+ +    + +++ + +  +  L+ ++N+N           DL+S         +I  F   + D +  G I  + S  L   +++  +           L ++E    +     +  + + QL  L+E +    ++       DL + E+ +T +AI++A  + + +L Q+R ++SG++L VNE IL+SC  LM AIKVL+ +S+D+QKEI+ +G+GT SV +FYKK+H+WTEGL+SAAKAVG GAT L EAAD ++  +GKFEEL++CS EI AST QLVV+S+VKA+  S     LS+ASRGV+  TGKV+ +A+ A +++EEQ   +F++L+L QAK+ EM SQV+VLELE +LE ER +LG++RK+HYQLAGE    E      NIE N E
Sbjct:    7 IPRVIGSRGKSSTDIERENFEKNQTVAINKAINNQETPVKEKHVRITILGTFTDNGAGMFWHIANRLPVQGNPIVCWKFCHVLHKILQEGHPHSIVDSYKYCSHLNDLGKLWGHLKEGYGKLIENYCRLLIQKLRFHKKNMEIPGNLKMSDDQFAKICGSDVNNYFEIAVDMLDYMDEILTLQQSVFSSLDMSRSNSMTSSGQCRLAPLILCIQDSCQLYDYIVKSLFRLHSSLPPDTLSGHRDRFVAAYKKLKQFYLSSSNLQYFKHLVQVPYLPDEPPNFLIASDFSKHVKPEAVVPEPEPENEPD-------TDSVADLIDTSE----DKFDAAFGN--GFGPPEPDERDMLIERLQREIQFLKSEIERIKFEDQRIISAQREEIAKLEKILSELRLSADKALKENESTKKRLEEATANAGAVAKLAEAEKHAKANEEKFKKMKEIYNKLREEHVALIRKNADTTKKLEAEKRLVQEREQSIQESKSQMERLENERKVIQESLQQSADQH------LENQVKTLEETKSSLMSQLQGSEEECESLQVRLEALEQDKHQSEESLQLQIKNAQDQLASLKDEITTTEMRRKNEIDSLKSQLEDALSEKVAKDEQFKKEIEDLQSRLSQLDSDKEASEKRQREDLAQLHRDLIASAVKEGRQFI--NDAMLQVENPTHIPVKCTAEFLLLRAEPVLSALENLNTSQTEYSQNQTDLES------LLKTITSFSHHMGDCVIHG-IATSHSAQLEAAEELASACQTAGESGLEVLSSLEKGGSIKSEVEKSAEKIRQLIKLAEDLVPKMVDVKEKEIGDLLENEMHSTSSAIELAAKKIEEMLHQTRKDMSGVELTVNESILDSCTGLMQAIKVLLVKSQDLQKEIVLQGRGTASVKEFYKKNHRWTEGLLSAAKAVGMGATSLLEAADKVVKGEGKFEELIVCSNEIAASTAQLVVASKVKADRKSKKLSELSEASRGVTSCTGKVVGSAREASQIIEEQNLMDFTSLSLMQAKKEEMQSQVRVLELEKELEMERYKLGQVRKRHYQLAGENGGWE-----ENIEGNTE 1042          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Cavefish
Match: hip1 (huntingtin interacting protein 1 [Source:NCBI gene;Acc:103022424])

HSP 1 Score: 524.242 bits (1349), Expect = 1.031e-168
Identity = 370/1046 (35.37%), Postives = 574/1046 (54.88%), Query Frame = 3
Query:   39 IQKVFQQRKKTPT--ELENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGKN-VDSLFELGLDILDYLE-ELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEE---PDV-------DLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFG-EMETFPFNNDERNELKK------------EIEYLKALIERMKIEHREKVNSLLARIRVLEEEVKGLVQMKDQYE-------------ERLRE---------YESHRHDSVDAEKFNKIKDAYSKLREEHVKKLREQG-IDRQQ--IETNKKELESLQKQLEDRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEAL-AKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSKYDLDK---SLSKINELGLIIKRMEEQLKSE-NESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQS-----EDLS--SCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILNNDSG-NLYDQINESYYNVYNQSKSFLENIENNDDVNLSSTRLIKT-LNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQL 2978
            I KV  +R       ELE E FE++Q   I+KAIN+ E A KEKH R  ILGT H  G+  F+   +   L  N ++CWK+ +  HK++RDGH   + D ++N+ ++  +   WGHL  GYG + S + KLL+ K +FH K  + PGNL + + ++ + G+N V++ F+L +++ DYLE EL +F   V  SLD S+S S+T  GQCRL PLIQVI D + LYD +V++LFKLHS L  D L GHR RF + F+ ++  F  +  LQYFK L+Q+P LPENPPNF+  S L    + VV +  E   P+        DL + D P    +            RFD +FG    T PFN + +N ++K            E++ LK  +E  ++E      +L  R+  LE E+     +K Q                R++E          E  +    + +++ K+K+ Y++L + H   LR+   + RQ   +   + E+E++++++    +E  K  +EN   AS ++ I     +L   QA L    R++ E L A   + +    +L  Q+ AL++E  K   +E  R++Q + EL     +L++   SL+   E G+   +  E L+++ NE +S+   L   +      T + A+E+  K +Q      ED +  SC +S+D +      A+  +D + +     + ++    +   ++ +F   + DT+ QG    +    +  D +  S     +++   L  +++   +    +  +KT L  +   +E +R   LE       DL ++E+  T  A++ A  R + +L +SR+  +GI++EVNE+IL SC ELM AIKVL+  SKD+QK+I+  G+G  ++ +FY K+ +WTEGLISA+KAVG GAT + +AAD ++   GKFEELM+CS EI AST QLV +S+VKA+  S N   L QASRGV+ AT  V+A+ K+    +EE  + +FS++TLTQ KR EMDSQV+VLELE  L+KER RLGELRKKHY+L
Sbjct:   15 IPKVLSRRAGGANSLELEKENFERSQAVSINKAINTQEVAVKEKHARTCILGTHHEKGAHTFWAAVNRLPLSSNAVLCWKFCHVFHKLLRDGHPNVIKDSVRNKADLTDMSRMWGHLSEGYGKLCSIYLKLLITKMEFHIKNPRFPGNLQMSNRQLEEAGENDVNNFFQLTVEMFDYLECELNLF-LGVFSSLDMSRSVSVTAAGQCRLAPLIQVILDSSHLYDYTVKLLFKLHSCLPADTLQGHRDRFQEQFKKLKSLFYRSSNLQYFKRLIQIPQLPENPPNFLRASALSEHISPVVVIPAEASSPESEHVVETDDLVDTDIPPLATAV---------ESRFDDLFGTSAATDPFNFNSQNGMRKDDKDRLIEQLTAELQALKEELESFRLESGRLCQALRGRVSELEAELAEQTHLKQQALGECEFLKAELDDLRRVKEDTEKEQRSLTEIEKKAQANEQRYTKLKEKYTELVQSHADLLRKNAEVTRQMTVVRAAQDEVETVKREM----LEKVKAAQEN---ASQQEKIQ--TEQLQALQADLT-ASRTELETLKASMASSQKSGEELSTQVAALEME--KAGLVE--RVAQKDTELAGLGEELERLQSSLTSERESGV---KAAETLQNQLNEKESREQALESELEALRWTTLRAAVEEGEKIVQDCLAQLEDPTHISCTSSADYLISRCQAAVESVDRLQSAGDGFVSNNTDVSELVRAVAQFAHLVGDTIVQGSATAHMVPVDQADALTSSVKACGSEALVLLGGLKDQGSLGTVESSGLKTALEGVLATAEKLRPRGLELQQGELGDLVEQEMAATSAAVESAAARIEEMLNKSRAVDTGIKMEVNERILASCTELMQAIKVLVLSSKDLQKDIVEGGRGAATIKEFYAKNSRWTEGLISASKAVGWGATMMVDAADLVVQGKGKFEELMVCSHEIAASTAQLVAASKVKADKDSGNLARLQQASRGVTQATAGVVASTKSGKSQIEETDTMDFSSMTLTQIKRQEMDSQVRVLELETWLQKERERLGELRKKHYEL 1033          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Cavefish
Match: hip1 (huntingtin interacting protein 1 [Source:NCBI gene;Acc:103022424])

HSP 1 Score: 510.375 bits (1313), Expect = 7.423e-164
Identity = 355/1015 (34.98%), Postives = 559/1015 (55.07%), Query Frame = 3
Query:  120 ISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGKN-VDSLFELGLDILDYLE-ELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEE---PDV-------DLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFG-EMETFPFNNDERNELKK------------EIEYLKALIERMKIEHREKVNSLLARIRVLEEEVKGLVQMKDQYE-------------ERLRE---------YESHRHDSVDAEKFNKIKDAYSKLREEHVKKLREQG-IDRQQ--IETNKKELESLQKQLEDRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEAL-AKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSKYDLDK---SLSKINELGL-IIKRMEEQLKSENESK-----SKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILNNDSG-NLYDQINESYYNVYNQSKSFLENIENNDDVNLSSTRLIKT-LNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQL 2978
            I+KAIN+ E A KEKH R  ILGT H  G+  F+   +   L  N ++CWK+ +  HK++RDGH   + D ++N+ ++  +   WGHL  GYG + S + KLL+ K +FH K  + PGNL + + ++ + G+N V++ F+L +++ DYLE EL +F   V  SLD S+S S+T  GQCRL PLIQVI D + LYD +V++LFKLHS L  D L GHR RF + F+ ++  F  +  LQYFK L+Q+P LPENPPNF+  S L    + VV +  E   P+        DL + D P    +            RFD +FG    T PFN + +N ++K            E++ LK  +E  ++E      +L  R+  LE E+     +K Q                R++E          E  +    + +++ K+K+ Y++L + H   LR+   + RQ   +   + E+E++++++    +E  K  +EN   AS ++ I     +L   QA L    R++ E L A   + +    +L  Q+ AL++E  K   +E  R++Q + EL     +L++   SL+   E G+   + ++ QL +E ES+     S++  L    ++ A +  ++ ++     L+     SC +S+D +      A+  +D + +     + ++    +   ++ +F   + DT+ QG    +    +  D +  S     +++   L  +++   +    +  +KT L  +   +E +R   LE       DL ++E+  T  A++ A  R + +L +SR+  +GI++EVNE+IL SC ELM AIKVL+  SKD+QK+I+  G+G  ++ +FY K+ +WTEGLISA+KAVG GAT + +AAD ++   GKFEELM+CS EI AST QLV +S+VKA+  S N   L QASRGV+ AT  V+A+ K+    +EE  + +FS++TLTQ KR EMDSQV+VLELE  L+KER RLGELRKKHY+L
Sbjct:   10 INKAINTQEVAVKEKHARTCILGTHHEKGAHTFWAAVNRLPLSSNAVLCWKFCHVFHKLLRDGHPNVIKDSVRNKADLTDMSRMWGHLSEGYGKLCSIYLKLLITKMEFHIKNPRFPGNLQMSNRQLEEAGENDVNNFFQLTVEMFDYLECELNLF-LGVFSSLDMSRSVSVTAAGQCRLAPLIQVILDSSHLYDYTVKLLFKLHSCLPADTLQGHRDRFQEQFKKLKSLFYRSSNLQYFKRLIQIPQLPENPPNFLRASALSEHISPVVVIPAEASSPESEHVVETDDLVDTDIPPLATAV---------ESRFDDLFGTSAATDPFNFNSQNGMRKDDKDRLIEQLTAELQALKEELESFRLESGRLCQALRGRVSELEAELAEQTHLKQQALGECEFLKAELDDLRRVKEDTEKEQRSLTEIEKKAQANEQRYTKLKEKYTELVQSHADLLRKNAEVTRQMTVVRAAQDEVETVKREM----LEKVKAAQEN---ASQQEKIQ--TEQLQALQADLT-ASRTELETLKASMASSQKSGEELSTQVAALEME--KAGLVE--RVAQKDTELAGLGEELERLQSSLTSERESGVKAAETLQNQL-NEKESREQALESELEALRWTTLRAAVEEGEKIVQDCLAQLEDPTHISCTSSADYLISRCQAAVESVDRLQSAGDGFVSNNTDVSELVRAVAQFAHLVGDTIVQGSATAHMVPVDQADALTSSVKACGSEALVLLGGLKDQGSLGTVESSGLKTALEGVLATAEKLRPRGLELQQGELGDLVEQEMAATSAAVESAAARIEEMLNKSRAVDTGIKMEVNERILASCTELMQAIKVLVLSSKDLQKDIVEGGRGAATIKEFYAKNSRWTEGLISASKAVGWGATMMVDAADLVVQGKGKFEELMVCSHEIAASTAQLVAASKVKADKDSGNLARLQQASRGVTQATAGVVASTKSGKSQIEETDTMDFSSMTLTQIKRQEMDSQVRVLELETWLQKERERLGELRKKHYEL 999          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Cavefish
Match: hip1rb (huntingtin-interacting protein 1-related protein-like [Source:NCBI gene;Acc:103035699])

HSP 1 Score: 479.559 bits (1233), Expect = 1.450e-151
Identity = 333/1055 (31.56%), Postives = 577/1055 (54.69%), Query Frame = 3
Query:   30 MTSIQKVFQQRKKTPTEL----ENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKT--GYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQ--LGKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQ-KALVVNVAEEPD-----------VDLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFGEMETFPFNN--DERN----ELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEV--------KGLV---QMKDQYEERLR---EYESHRHDSVDAEK--------FNKIKDAYSKLREEHVKKLREQGIDRQQIETNKKELESLQKQLEDRNIEL--------AKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSKYDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILNN-DSGNLYDQINESYYNVYNQSKSFLENIENNDDVNLSSTRLIKTLNQ-LKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAGETVDQELLDDSM 3020
            M SI++V  + K   TE     E E F+K Q + ISKAIN+ E   KEKH R +ILGT    G+  F+ +     L  + I+ WK+ + +HK++RDGH  +L D +++   I  +G+ WG+++   GYG ++++++KLL  K +FH K+ ++  NL   SDE+ +   G +++++F+L +++ DY++  +   +SV+  L+ S + S    GQC+L PLIQVIQD + LY  +V++LFKLH+ L  D L GHR+RF   F S++ FF  A+ + YFK L+Q+P LP++PPNF+  S L    K +VV   EE             +D++   S +  +   +D         FDQ FG     P N+  D+R+     LK+EIE L+  +E++K E +  +  L ++I  LE E+        + LV   Q++ + E   R   E+ES +   V+A+K        +NK+K+ +++L   H + LR+     + +   ++  E +++  +    E+         KLE++      + +++++   E+   +  L+  E++  +  +   +L+ +   L++ +   + E    +Q    + S +++E   S  +L +  SK+ E     K++++++  E  +      L +  +  A    Q A+ K +  L       C +S D +    +  +  ID + +     L +         ++ +F    +DT+  G    +    +  D++ E+      QS  FL+ +++ D +  +    I+ + Q +  +++ +R   ++ G     D+ D+E+  T  AI+ AV R   ++ Q+R +  G++LEVNE+IL SC +LM AI++L+  S D+QKEI+  G+G  +V +FY ++ +WTEGLISAAKAVG GAT + ++AD ++   GK+EEL++CS EI AST QLV +S+VKA+  S    +L QASR V++    V+A+ K     +E++ + +FS ++L + K+ EM+SQVKVLELE+ LE ER RLGELRKKHY++AG  ++Q   D+ +
Sbjct:    1 MNSIRQVPSRVKSKRTETNLGAEREHFDKQQLSSISKAINTSETPVKEKHARRIILGTHREKGAYTFWSYAIGLPLSSSAILSWKFCHVLHKVLRDGHTNSLQDCMRHHSNISEIGQLWGNIRDRYGYGQLVAQYAKLLCSKMEFHNKHPEIRANLEA-SDEVLERTAGTDINNVFQLTVEVFDYMDVELRLAESVLRQLNTSIAISTLTAGQCKLAPLIQVIQDCSHLYHYTVKLLFKLHACLPPDTLQGHRERFHDQFHSLKTFFNKARDMMYFKRLIQIPRLPDSPPNFLRASALAEHVKPMVVIPDEEEPEEQEEDEPEPLIDVSEAPSASMTSQPQVDI--------FDQAFG-----PPNDGFDDRDLQIESLKREIEALRTELEKIKAEAQRYITQLKSQINSLEAELEEQRVQKQRALVENEQLRMELEATRRRNAEHESIQSTFVEADKRAQATELRYNKLKEKHAELVANHAELLRKSADTVKMLSATQQTQEEVERTKQQLAFEVERAKQESDMKLEEQKFEMDKLRRDLEEKILEIQRMKGTLQTCEKASDQINSSMTSLQVEKERLMRCVSEKEAELSSLRQATQLKQSSLDQERERSSKELHELQSKLKEKQSHEKQLQQRMLEEQFA------LLQGTVSEAEMIIQDAVAKLDDPLHIR----CTSSPDYLVSRAEATMGSIDKVQSGHAHYLKNMGNAGALLRALTQFSHLAADTIINGSATAHMAPTDNADRLTENCRGCATQSLHFLQELKSKDSLKGADPSSIRVMVQKILRIAQDLRPKGMDVGKEELGDMVDKEMAATSAAIEEAVRRIDEMMNQARRDTEGVKLEVNERILNSCTDLMKAIRLLVLASTDLQKEIVESGRGAATVREFYARNSRWTEGLISAAKAVGWGATQMVDSADKVVLHTGKYEELIVCSHEIAASTAQLVAASKVKADRGSKKLSSLQQASRHVNEMAANVVASTKTGQEQIEDKDTMDFSGMSLIKLKKEEMESQVKVLELESMLENERLRLGELRKKHYEIAGVPLEQIAQDNGL 1031          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Cavefish
Match: hip1rb (huntingtin-interacting protein 1-related protein-like [Source:NCBI gene;Acc:103035699])

HSP 1 Score: 479.559 bits (1233), Expect = 2.193e-151
Identity = 333/1055 (31.56%), Postives = 577/1055 (54.69%), Query Frame = 3
Query:   30 MTSIQKVFQQRKKTPTEL----ENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKT--GYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQ--LGKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQ-KALVVNVAEEPD-----------VDLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFGEMETFPFNN--DERN----ELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEV--------KGLV---QMKDQYEERLR---EYESHRHDSVDAEK--------FNKIKDAYSKLREEHVKKLREQGIDRQQIETNKKELESLQKQLEDRNIEL--------AKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSKYDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILNN-DSGNLYDQINESYYNVYNQSKSFLENIENNDDVNLSSTRLIKTLNQ-LKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAGETVDQELLDDSM 3020
            M SI++V  + K   TE     E E F+K Q + ISKAIN+ E   KEKH R +ILGT    G+  F+ +     L  + I+ WK+ + +HK++RDGH  +L D +++   I  +G+ WG+++   GYG ++++++KLL  K +FH K+ ++  NL   SDE+ +   G +++++F+L +++ DY++  +   +SV+  L+ S + S    GQC+L PLIQVIQD + LY  +V++LFKLH+ L  D L GHR+RF   F S++ FF  A+ + YFK L+Q+P LP++PPNF+  S L    K +VV   EE             +D++   S +  +   +D         FDQ FG     P N+  D+R+     LK+EIE L+  +E++K E +  +  L ++I  LE E+        + LV   Q++ + E   R   E+ES +   V+A+K        +NK+K+ +++L   H + LR+     + +   ++  E +++  +    E+         KLE++      + +++++   E+   +  L+  E++  +  +   +L+ +   L++ +   + E    +Q    + S +++E   S  +L +  SK+ E     K++++++  E  +      L +  +  A    Q A+ K +  L       C +S D +    +  +  ID + +     L +         ++ +F    +DT+  G    +    +  D++ E+      QS  FL+ +++ D +  +    I+ + Q +  +++ +R   ++ G     D+ D+E+  T  AI+ AV R   ++ Q+R +  G++LEVNE+IL SC +LM AI++L+  S D+QKEI+  G+G  +V +FY ++ +WTEGLISAAKAVG GAT + ++AD ++   GK+EEL++CS EI AST QLV +S+VKA+  S    +L QASR V++    V+A+ K     +E++ + +FS ++L + K+ EM+SQVKVLELE+ LE ER RLGELRKKHY++AG  ++Q   D+ +
Sbjct:    1 MNSIRQVPSRVKSKRTETNLGAEREHFDKQQLSSISKAINTSETPVKEKHARRIILGTHREKGAYTFWSYAIGLPLSSSAILSWKFCHVLHKVLRDGHTNSLQDCMRHHSNISEIGQLWGNIRDRYGYGQLVAQYAKLLCSKMEFHNKHPEIRANLEA-SDEVLERTAGTDINNVFQLTVEVFDYMDVELRLAESVLRQLNTSIAISTLTAGQCKLAPLIQVIQDCSHLYHYTVKLLFKLHACLPPDTLQGHRERFHDQFHSLKTFFNKARDMMYFKRLIQIPRLPDSPPNFLRASALAEHVKPMVVIPDEEEPEEQEEDEPEPLIDVSEAPSASMTSQPQVDI--------FDQAFG-----PPNDGFDDRDLQIESLKREIEALRTELEKIKAEAQRYITQLKSQINSLEAELEEQRVQKQRALVENEQLRMELEATRRRNAEHESIQSTFVEADKRAQATELRYNKLKEKHAELVANHAELLRKSADTVKMLSATQQTQEEVERTKQQLAFEVERAKQESDMKLEEQKFEMDKLRRDLEEKILEIQRMKGTLQTCEKASDQINSSMTSLQVEKERLMRCVSEKEAELSSLRQATQLKQSSLDQERERSSKELHELQSKLKEKQSHEKQLQQRMLEEQFA------LLQGTVSEAEMIIQDAVAKLDDPLHIR----CTSSPDYLVSRAEATMGSIDKVQSGHAHYLKNMGNAGALLRALTQFSHLAADTIINGSATAHMAPTDNADRLTENCRGCATQSLHFLQELKSKDSLKGADPSSIRVMVQKILRIAQDLRPKGMDVGKEELGDMVDKEMAATSAAIEEAVRRIDEMMNQARRDTEGVKLEVNERILNSCTDLMKAIRLLVLASTDLQKEIVESGRGAATVREFYARNSRWTEGLISAAKAVGWGATQMVDSADKVVLHTGKYEELIVCSHEIAASTAQLVAASKVKADRGSKKLSSLQQASRHVNEMAANVVASTKTGQEQIEDKDTMDFSGMSLIKLKKEEMESQVKVLELESMLENERLRLGELRKKHYEIAGVPLEQIAQDNGL 1031          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Cavefish
Match: hip1rb (huntingtin-interacting protein 1-related protein-like [Source:NCBI gene;Acc:103035699])

HSP 1 Score: 412.149 bits (1058), Expect = 1.401e-126
Identity = 311/1055 (29.48%), Postives = 546/1055 (51.75%), Query Frame = 3
Query:   30 MTSIQKVFQQRKKTPTEL----ENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKT--GYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQ--LGKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQ-KALVVNVAEEPD-----------VDLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFGEMETFPFNN--DERN----ELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEV--------KGLV---QMKDQYEERLR---EYESHRHDSVDAEK--------FNKIKDAYSKLREEHVKKLREQGIDRQQIETNKKELESLQKQLEDRNIEL--------AKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSKYDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILNN-DSGNLYDQINESYYNVYNQSKSFLENIENNDDVNLSSTRLIKTLNQ-LKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAGETVDQELLDDSM 3020
            M SI++V  + K   TE     E E F+K Q + ISKAIN+ E   KEKH R +ILGT    G+  F+ +     L  + I+ WK+ + +HK++RDGH  +L D +++   I  +G+ WG+++   GYG ++++++KLL  K +FH K+ ++  NL   SDE+ +   G +++++F+L +++ DY+                                            D+ +R+     S L  D L GHR+RF   F S++ FF  A+ + YFK L+Q+P LP++PPNF+  S L    K +VV   EE             +D++   S +  +   +D         FDQ FG     P N+  D+R+     LK+EIE L+  +E++K E +  +  L ++I  LE E+        + LV   Q++ + E   R   E+ES +   V+A+K        +NK+K+ +++L   H + LR+     + +   ++  E +++  +    E+         KLE++      + +++++   E+   +  L+  E++  +  +   +L+ +   L++ +   + E    +Q    + S +++E   S  +L +  SK+ E     K++++++  E  +      L +  +  A    Q A+ K +  L       C +S D +    +  +  ID + +     L +         ++ +F    +DT+  G    +    +  D++ E+      QS  FL+ +++ D +  +    I+ + Q +  +++ +R   ++ G     D+ D+E+  T  AI+ AV R   ++ Q+R +  G++LEVNE+IL SC +LM AI++L+  S D+QKEI+  G+G  +V +FY ++ +WTEGLISAAKAVG GAT + ++AD ++   GK+EEL++CS EI AST QLV +S+VKA+  S    +L QASR V++    V+A+ K     +E++ + +FS ++L + K+ EM+SQVKVLELE+ LE ER RLGELRKKHY++AG  ++Q   D+ +
Sbjct:    1 MNSIRQVPSRVKSKRTETNLGAEREHFDKQQLSSISKAINTSETPVKEKHARRIILGTHREKGAYTFWSYAIGLPLSSSAILSWKFCHVLHKVLRDGHTNSLQDCMRHHSNISEIGQLWGNIRDRYGYGQLVAQYAKLLCSKMEFHNKHPEIRANLEA-SDEVLERTAGTDINNVFQLTVEVFDYM--------------------------------------------DVELRLA---ESGLPPDTLQGHRERFHDQFHSLKTFFNKARDMMYFKRLIQIPRLPDSPPNFLRASALAEHVKPMVVIPDEEEPEEQEEDEPEPLIDVSEAPSASMTSQPQVDI--------FDQAFG-----PPNDGFDDRDLQIESLKREIEALRTELEKIKAEAQRYITQLKSQINSLEAELEEQRVQKQRALVENEQLRMELEATRRRNAEHESIQSTFVEADKRAQATELRYNKLKEKHAELVANHAELLRKSADTVKMLSATQQTQEEVERTKQQLAFEVERAKQESDMKLEEQKFEMDKLRRDLEEKILEIQRMKGTLQTCEKASDQINSSMTSLQVEKERLMRCVSEKEAELSSLRQATQLKQSSLDQERERSSKELHELQSKLKEKQSHEKQLQQRMLEEQFA------LLQGTVSEAEMIIQDAVAKLDDPLHIR----CTSSPDYLVSRAEATMGSIDKVQSGHAHYLKNMGNAGALLRALTQFSHLAADTIINGSATAHMAPTDNADRLTENCRGCATQSLHFLQELKSKDSLKGADPSSIRVMVQKILRIAQDLRPKGMDVGKEELGDMVDKEMAATSAAIEEAVRRIDEMMNQARRDTEGVKLEVNERILNSCTDLMKAIRLLVLASTDLQKEIVESGRGAATVREFYARNSRWTEGLISAAKAVGWGATQMVDSADKVVLHTGKYEELIVCSHEIAASTAQLVAASKVKADRGSKKLSSLQQASRHVNEMAANVVASTKTGQEQIEDKDTMDFSGMSLIKLKKEEMESQVKVLELESMLENERLRLGELRKKHYEIAGVPLEQIAQDNGL 984          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Sea Lamprey
Match: hip1 (huntingtin interacting protein 1 [Source:ZFIN;Acc:ZDB-GENE-010328-15])

HSP 1 Score: 435.647 bits (1119), Expect = 3.220e-137
Identity = 320/942 (33.97%), Postives = 517/942 (54.88%), Query Frame = 3
Query:  321 LIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGKN-VDSLFELGLDILDYLE-ELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEE---PDV-------DLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFGEMETFPFNNDERN----ELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEVKGLVQMKDQY---EERLR-EYESHRHDSVDAEK------------------FNKIKDAYSKLREEHVKKLREQGIDRQQIET---NKKELESLQKQLEDRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNL-ESKNVDLLKQIEALQIESDKEKQMENARLS-------QIEKELNDSKYDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLA---IRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILNNDSG-NLYDQINESYYNVYNQSKSFLENIENNDDVN-LSSTRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAG 2984
            L D ++ + E+  +G  WGHL  GYG ++S + KLL+ K  FH K    PGNL++   ++   G+N V++ F+L +++ DYLE EL++F  +V  S+D S+  SMT  GQCRL PLI V+ D + LYD  V++LFKLHS L  D L GHR RFL+ F+ I ++   +  LQYFK L+Q+P LPE PPNF+  S L    + VV + EE   PD        DL + DS + + S +   + +     F+   G       + DER+    +L +EI  LK  ++  ++E     ++L +R+  LE E+     ++ Q     E LR E E  +  S D EK                  +NK+K+ Y+ L + H   LR+     +Q+ T    K+E E+ ++QL+           +++++ + E+ ++     +A  +  L+  +   F    +  N+ +S + +L  ++ AL+ E    +++   R S       ++++ L+ SK + ++S     EL  +  ++  +++ E   K+++    + ++  A   ++  ++   + L       C AS D +   I  A   +D+ + L     + L +S        S+  F   +SD + QG   ++ S  +  D++++   +   Q+ +FL +++++      S T   + L  +  +++ +R   L+       DL ++E+  T  AI+ A  R + +L ++R+   G++LEVNE+IL SC +LM  I+ LI  SKD+QKEI+ E +G  S  +FY K+ +WTEGLISA+KAVG  AT L +AAD +L  +GKFEELM+CSREI AST QLV +S+VKAN  S N Q L QASR V++AT  V+A+ K+    +EE+ + +FS++TLTQ KR EMDSQV+VLELE+ L+KER  LG LRKKHY+LAG
Sbjct:    2 LKDSLRYKSELNDMGRMWGHLNEGYGRMVSMYVKLLITKMDFHIKNPAFPGNLMMTDAQLEATGENDVNNFFQLTVEMFDYLECELILF-NAVFSSMDMSRPVSMTTAGQCRLAPLIPVVLDCSHLYDYIVKLLFKLHSCLPADTLQGHRDRFLEQFKKICEYLHRSSNLQYFKRLIQIPQLPEIPPNFLRASALSEHVSPVVVIPEESASPDSEAVLETDDLVDTDSTSTQISPVTLLSLVSQTS-FNSQNG------VSRDERDKLIEQLYREINALKEELDTQRLETERVASALRSRLGELEAELAEARHLRGQAWDETEFLRTELEDVKRRSEDTEKTQKSLTEIEKRAQANEQRYNKLKEKYTGLVQNHADLLRKNAEVARQLTTVRQAKEEAETARQQLQS--------SMQSIMHRA-EEQLETGRQAVASLKEALRSSQEXSFACATRPTNMRDSASSELSARLTALEAERADVERVSGERASAMQTLQSRLDETLSTSKAEAERS---EQELSALQSQLSHKVEQEGVLKAQLLADQKALLDCAMAEAEHMVQSALEQLDDPAHMGCTASPDYL---ISRAQCGVDSTDRLKEGHSQFLANSHDASGLLGSVAAFAHVVSDVIVQGTATSHASPIDQADKLSDLCRHCGTQALTFLGSLKDSASAEEASPTHTREALLAILAIAQELRPRGLDVKPGELGDLVEQEMAATAAAIEDAAARIEDMLSKARAEERGVKLEVNERILASCTDLMKTIRALILASKDLQKEIVDEDRGATSQKEFYAKNSRWTEGLISASKAVGWAATMLVDAADQVLKGNGKFEELMVCSREIAASTAQLVAASKVKANKGSTNLQRLQQASRTVNEATASVVASTKSGKAQIEEKETMDFSSMTLTQVKRQEMDSQVRVLELESLLQKEREHLGGLRKKHYELAG 920          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007764.1 (pep scaffold:Pmarinus_7.0:GL477581:34251:41399:-1 gene:ENSPMAG00000006995.1 transcript:ENSPMAT00000007764.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 222.246 bits (565), Expect = 2.068e-64
Identity = 122/289 (42.21%), Postives = 186/289 (64.36%), Query Frame = 3
Query: 2046 LSDTLYQGKILNN-DSGNLYDQINESYYNVYNQSKSFLENIENNDDVNLSSTRLIK-TLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSN--LTLTQAKRLEMDSQV 2900
            +SDT+ QG   ++   G+  D++ E+     + + +FL+ ++    +  ++   ++ TL +L  + E +R   ++       DL ++E+ +T  A++ A  R + +L +SR+  +GI+LEVNE+IL SC +LM AIK+LI  S ++Q+EI+  G+G  S  +FY K+ +WTEGLISA+KAVG GAT L EAAD ++  DGKFEEL++CS EI AST QLV +S+VKA   S     L  ASRGV++AT +V+A+ K  M  +EE G+ NF +  +TLTQAK  EM+ QV
Sbjct:   95 VSDTIVQGSATSHLVPGDQADRLTEACQQCGDGALAFLDKLKERSTLPGANPEALRATLERLVRIGEDLRPKGMDVRQEELGDLVEQEMASTSAAVEAAAARIEDMLNKSRAADTGIKLEVNERILASCTDLMQAIKILIVASSELQREIVESGRGAASPKEFYAKNSRWTEGLISASKAVGWGATMLVEAADKVVQGDGKFEELVVCSHEIAASTAQLVAASKVKAERNSGKLARLQHASRGVNEATARVVASTKTGMSQIEESGAMNFKDMTMTLTQAKLREMNCQV 383          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010194.1 (pep scaffold:Pmarinus_7.0:GL480176:295:15370:1 gene:ENSPMAG00000009228.1 transcript:ENSPMAT00000010194.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.781 bits (164), Expect = 1.072e-11
Identity = 50/175 (28.57%), Postives = 91/175 (52.00%), Query Frame = 3
Query: 2289 LFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNA 2813
            + + ELL    AI+ A  + + +  +++   +   L   E+ILE+   +  A   L+  +   Q+E++A+GK  G+         +W++GLISAA+ V    + LCEAA+  +      E+L+  ++++ AST QL+V+ +VKA   S   + L  A   V  A+  ++  A+ A
Sbjct:  615 IAEAELLGAAPAIEAAAKKLEQLKPRAKPRQADESLNFEEQILEAAKAIAAATSALVKSASAAQRELVAQGK-VGASPANAVDDGQWSQGLISAARMVAAATSNLCEAANAAVQGHASEEKLISSAKQVAASTAQLLVACKVKAAPDSEAMRRLQGAGNAVKRASENLVKAAQKA 788          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Yeast
Match: SLA2 (Adaptor protein that links actin to clathrin and endocytosis; involved in membrane cytoskeleton assembly and cell polarization; present in the actin cortical patch of the emerging bud tip; dimer in vivo [Source:SGD;Acc:S000005187])

HSP 1 Score: 97.4413 bits (241), Expect = 5.066e-21
Identity = 70/268 (26.12%), Postives = 131/268 (48.88%), Query Frame = 3
Query:  120 ISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLG--ESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQL--GKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKL---EVD-MLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDL 899
            + KA +  E APK KH+R  I+ T+ +  S   F       L  + +  +K L  +HKI+++GH  AL + I++   I+SLG   S G   + Y  +I ++ + L+ K  FH  +R    N   + +E   L    + D  +E  LD++   + L  F + +  S+   + N+     +C+++ LI +I +   +Y     +L  +H +L   E D  L   ++R+      + +F+    +++Y  TLV +P LP + P+  + +D+
Sbjct:   12 LKKACSVEETAPKRKHVRACIVYTWDHQSSKAVFTTLKTLPLANDEVQLFKMLIVLHKIIQEGHPSALAEAIRDRDWIRSLGRVHSGG---SSYSKLIREYVRYLVLKLDFHAHHRGF-NNGTFEYEEYVSLVSVSDPDEGYETILDLMSLQDSLDEFSQIIFASIQSERRNT-----ECKISALIPLIAESYGIYKFITSMLRAMHRQLNDAEGDAALQPLKERYELQHARLFEFYADCSSVKYLTTLVTIPKLPVDAPDVFLINDV 270          

HSP 2 Score: 81.2629 bits (199), Expect = 4.774e-16
Identity = 60/186 (32.26%), Postives = 98/186 (52.69%), Query Frame = 3
Query: 2388 IQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLT----KDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDAT----GKVIANAKNAMRVLEEQGSYNF-SNLTLTQAKRLEMDSQVKVLELE 2918
            ++++V + +L     ++ A+  L+  +   Q EI      +  +  FY K+ +WTEGLISAAKAV G    L   A  L+T    ++   E+ ++ S+E+ AST QLV +SRVK ++ S     L   S+ V+DA       V+   ++     ++Q   +F S  TL   K  EM+ QV++L+LE
Sbjct:  764 LRVDVPKPLLSLALMIIDAVVALVKAAIQCQNEIAT--TTSIPLNQFYLKNSRWTEGLISAAKAVAGATNVLITTASKLITSEDNENTSPEQFIVASKEVAASTIQLVAASRVKTSIHSKAQDKLEHCSKDVTDACRSLGNHVMGMIEDDHSTSQQQQPLDFTSEHTL---KTAEMEQQVEILKLE 944          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Nematostella
Match: EDO35194 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM91])

HSP 1 Score: 223.402 bits (568), Expect = 2.774e-66
Identity = 122/229 (53.28%), Postives = 166/229 (72.49%), Query Frame = 3
Query: 2292 FDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQL 2978
             D E+  T   +  A  R + +L ++R   +G+QLEVN +IL+SC  LM AIKVLI +SKD+Q+EI+  GKGT +  +FYK+HH+WTEGLISAAKAVG GA  L ++AD ++   GKFEEL++ S EITAST QLV +SRVKA+  S   Q L  AS+ V ++   V+A+AK    ++E++   ++S LTLTQAKRLEMDSQV++LELE++L KER +LG+LR+ HYQL
Sbjct:   20 VDNEINATAELVADAAARIEEMLNKTREKYTGVQLEVNGRILDSCTSLMQAIKVLILKSKDLQEEIVGVGKGTATAKEFYKRHHRWTEGLISAAKAVGWGAKVLVDSADKVVLGKGKFEELVVASNEITASTAQLVAASRVKAHRGSNKLQALHGASKDVVESAAGVVASAKTGAEMIEDKTVPDYSKLTLTQAKRLEMDSQVRLLELESNLTKEREKLGQLRRIHYQL 248          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Nematostella
Match: EDO35195 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM92])

HSP 1 Score: 198.749 bits (504), Expect = 3.778e-57
Identity = 101/275 (36.73%), Postives = 162/275 (58.91%), Query Frame = 3
Query:   63 KKTPTELENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGH-LKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNL-IIQSDEIFQLGKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNF 881
            KK   +LE E+ EK+Q   I+KA + +E A KEKHIR  I+GT+   G+SIF+       L    I+CWK ++ VHK++R+GH  AL +  K  + +K + + W H  K GYG +IS + K+L+ K  FH+K   +PG L      +I     + D  F+L +++ DY++ L+  EK +  +LD+ +SNS     QCR+ P   +IQ+ + LY +S+ ++ +LH+ L  ++L  HR+RF + ++ ++ F+  A  + Y K L  VP+L E PP F
Sbjct:   12 KKPTLQLEREKLEKDQAEAIAKATSPIETAVKEKHIRSAIIGTWQEKGASIFWACLGRMPLPSQVIMCWKAMFLVHKLLREGHPAALQESFKYRQLLKDMEQFWQHSPKGGYGVLISYYLKVLIAKIDFHQKNSFIPGTLKSTTGGDIQYPSTSNDDYFQLAVELFDYMDTLIDLEKKIFATLDRFRSNSQIQAVQCRICPFPVIIQECSGLYAISLDLMHRLHAGLPDELLAAHRERFYQQYKDLKTFYFDAGNMAYVKALCVVPSLSETPPVF 286          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Nematostella
Match: EDO47777 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL15])

HSP 1 Score: 73.9442 bits (180), Expect = 3.306e-13
Identity = 90/334 (26.95%), Postives = 153/334 (45.81%), Query Frame = 3
Query: 1830 ACQTSQQAIEKTNKTLQSEDLSSCRASS-DIIRVT------IDDALAEIDNINN---LAIRDLDSSEVRIQFADSIYKFGAKLSDT---LYQGKILNNDSGNLYDQINESYYNVYNQS----KSFLENIENNDDVNLSSTRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDA 2780
            A ++S +AI++    L S  L +  AS  D+IR T         A+A  ++ N    +A  ++    V      SI K  A  +DT    Y   +   D+   Y +++E   N+  +     K+ L  +     V     +L++T   LK  SE V   N E  N     + + ELL    +I+ A  +   +  + R   +   L   E+ILE+   +  A   L+  +   Q+E+IA GK   + TD  ++ ++W++GL+SAA+ V      LCEAA+  +  +   E L+  + ++ +ST QL+++ RVKA+  S   + L  A   V  A
Sbjct: 2165 AMESSNEAIKQAIMVLNSPTLPARDASPEDLIRSTKGVTLATAKAVAAGNSCNQDDVIAAANMGRKAVTEML--SICKAAAVKADTDEVKYATIVAGRDTAAAYGEVSELVINILQKPTPEKKARLMPLSKK--VAEGVGKLVRTAETLKG-SEWV---NPEDPNI----IAENELLGAAASIEAAARKLAELRPKPRPKEADDSLNFEEQILEAAKAITAATVALVKSASAAQRELIATGKIFSAGTD-AREDNQWSQGLVSAARTVAAATQTLCEAANAAVQGNASEERLVAGANQVASSTAQLLLACRVKADAHSATQRRLQVAGNAVKRA 2485          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Medaka
Match: hip1 (huntingtin interacting protein 1 [Source:NCBI gene;Acc:101174446])

HSP 1 Score: 523.087 bits (1346), Expect = 3.194e-168
Identity = 360/1025 (35.12%), Postives = 567/1025 (55.32%), Query Frame = 3
Query:   78 ELENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGKN-VDSLFELGLDILDYLE-ELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNV-AEEPDVDLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFGEMETF-PFNNDERN------------ELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEVKGLVQMKDQYE-------------ERLREY---------ESHRHDSVDAEKFNKIKDAYSKLREEHVKKLREQG-IDRQQI--ETNKKELESLQKQLEDRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLK-QIEALQIESDKEKQMENARLSQIEKELNDSKYDLDK---SLSKINELGLIIKRMEEQLKSE-NESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLS--------SCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILNNDSG-NLYDQINESYYNVYNQSKSFLENIENNDDVNLS-STRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAG 2984
            E E E FE+ Q   I+KAIN+ E A KEKH R  ILGT H  G+  F+       L  N ++CWK+ +  HK++RDGH   + D ++N+ ++  +   WGHL  GYG + S + KLL+ K +FH K  + PGNL + + ++ ++G+N V++ F+L +++ DYLE EL +F  +V  SLD S+S S+T  GQCRL PLIQVI D + LYD +V++LFKLHS L  D L GHR RF + F+ ++  F  +  LQYFK L+Q+P LPENPPNF+  S L    + VV + AE    +  +     D   T I         +FD +FG      PFN   +N            +L +EI+ LK  +E  ++E      +L  R+  LE E+     ++ Q                R+REY         E  +    + +++ K+K+ Y++L + H   LR+   + RQ       + E+E L+K+++         EK   V    ++   +   +L + Q +L    R + + L  +     ++ + L  Q+ AL  ES+K + +++  +S++E EL   + +L +   SL+   E G+   +  E L+++ NE +S+   L   ++     + + A+E+  K +Q + LS        SC +S+D +      +L  +D++N+     +D +   ++   ++ + G  + +T+ QG   ++       D + E+      +    L  ++  D +  + ST+L   L  +   +E +R   LE       DL ++E+  T  A++ A +R + +L +SR+  +G+++EVNE+IL SC ELM AIK L+  SKD+Q++I+  G+G  S+ +FY K+ +WTEGLISA+KAVG GAT L +AAD ++   GKFEELM+CS EI AST QLV +S+VKA+  S N Q L +ASRGV+ AT  V+A+ K+    +E+  + +FS++TLTQ KR EMD+QV VLELE  L+KER RLGELRKKHY+LAG
Sbjct:   29 ETERENFERVQAVSINKAINTQEVAVKEKHARTCILGTHHEKGAHTFWAVVHRLPLSSNAVLCWKFCHVFHKLLRDGHPNVIKDSMRNKADLTDMSRMWGHLSEGYGKLCSIYLKLLITKIEFHIKNPRFPGNLQMSNRQLDEVGENDVNNFFQLTVEMFDYLECELNLF-LAVFSSLDMSRSVSVTAAGQCRLAPLIQVILDCSHLYDYTVKLLFKLHSCLPADTLQGHRDRFQEQFKKLKSLFYRSSNLQYFKRLIQIPQLPENPPNFLRASALSEHISPVVVIPAESSSPESEHVVETDDLVDTDIPVLPAPAETKFDDLFGTSAAIDPFNFTSQNGMRKDDKDRLIEQLTREIQALKEELESFRLESGRLCQALRGRVSELEAELAEQSHLRMQAVGESEFLKAELDDVRRVREYTEKEQRSLTEIEKKAQANEQRYTKLKEKYTELVQSHADLLRKNAEVTRQMTVARAAQDEVEVLKKEMQ---------EKVKAVQDVADRQEREQQRQLEDIQKELV-CTREELDTLKSSVTSSQQSREALSSQMAAL--ESEKAELVQS--MSKVEAELEAQRQELQRAQSSLATERESGV---KAAEALQNQLNEKESREQALESQLVAARWSSLRGAVEEAEKIVQ-DSLSQIDDPAHISCTSSADYLASRCQASLDSLDHLNSSIKTFMDDNSAVLELVRAVTRSGHLVGETIVQGSATSHMVPVEKSDALLETVKTCGAEVLLMLGQMKQQDHLAAADSTKLRVALEAILATAEKLRPRGLELQQGELGDLVEQEMAATSAAVESAASRIEEMLNKSRAVDTGVKMEVNERILASCTELMEAIKALVLSSKDLQRDIVESGRGAASMKEFYAKNSRWTEGLISASKAVGWGATVLVDAADLVVQGKGKFEELMVCSHEIAASTAQLVAASKVKADKDSTNLQRLQRASRGVTQATAVVVASTKSGKSQIEDTETMDFSSMTLTQIKRQEMDAQVLVLELETRLQKERERLGELRKKHYELAG 1034          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Medaka
Match: hip1 (huntingtin interacting protein 1 [Source:NCBI gene;Acc:101174446])

HSP 1 Score: 522.702 bits (1345), Expect = 1.656e-167
Identity = 360/1024 (35.16%), Postives = 563/1024 (54.98%), Query Frame = 3
Query:   78 ELENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGKN-VDSLFELGLDILDYLE-ELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNV-AEEPDVDLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFGEMETF-PFNNDERN------------ELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEVKGLVQMKDQYE-------------ERLREY---------ESHRHDSVDAEKFNKIKDAYSKLREEHVKKLREQG-IDRQQI--ETNKKELESLQKQLEDRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLK-QIEALQIESDKEKQMENARLSQIEKELNDSKYDLDK---SLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLS--------SCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILNNDSG-NLYDQINESYYNVYNQSKSFLENIENNDDVNLS-STRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAG 2984
            E E E FE+ Q   I+KAIN+ E A KEKH R  ILGT H  G+  F+       L  N ++CWK+ +  HK++RDGH   + D ++N+ ++  +   WGHL  GYG + S + KLL+ K +FH K  + PGNL + + ++ ++G+N V++ F+L +++ DYLE EL +F  +V  SLD S+S S+T  GQCRL PLIQVI D + LYD +V++LFKLHS L  D L GHR RF + F+ ++  F  +  LQYFK L+Q+P LPENPPNF+  S L    + VV + AE    +  +     D   T I         +FD +FG      PFN   +N            +L +EI+ LK  +E  ++E      +L  R+  LE E+     ++ Q                R+REY         E  +    + +++ K+K+ Y++L + H   LR+   + RQ       + E+E L+K+++         EK   V    ++   +   +L + Q +L    R + + L  +     ++ + L  Q+ AL  ES+K + +++  +S++E EL   + +L +   SL+   E G  +K  E      NE +S+   L   ++     + + A+E+  K +Q + LS        SC +S+D +      +L  +D++N+     +D +   ++   ++ + G  + +T+ QG   ++       D + E+      +    L  ++  D +  + ST+L   L  +   +E +R   LE       DL ++E+  T  A++ A +R + +L +SR+  +G+++EVNE+IL SC ELM AIK L+  SKD+Q++I+  G+G  S+ +FY K+ +WTEGLISA+KAVG GAT L +AAD ++   GKFEELM+CS EI AST QLV +S+VKA+  S N Q L +ASRGV+ AT  V+A+ K+    +E+  + +FS++TLTQ KR EMD+QV VLELE  L+KER RLGELRKKHY+LAG
Sbjct:   29 ETERENFERVQAVSINKAINTQEVAVKEKHARTCILGTHHEKGAHTFWAVVHRLPLSSNAVLCWKFCHVFHKLLRDGHPNVIKDSMRNKADLTDMSRMWGHLSEGYGKLCSIYLKLLITKIEFHIKNPRFPGNLQMSNRQLDEVGENDVNNFFQLTVEMFDYLECELNLF-LAVFSSLDMSRSVSVTAAGQCRLAPLIQVILDCSHLYDYTVKLLFKLHSCLPADTLQGHRDRFQEQFKKLKSLFYRSSNLQYFKRLIQIPQLPENPPNFLRASALSEHISPVVVIPAESSSPESEHVVETDDLVDTDIPVLPAPAETKFDDLFGTSAAIDPFNFTSQNGMRKDDKDRLIEQLTREIQALKEELESFRLESGRLCQALRGRVSELEAELAEQSHLRMQAVGESEFLKAELDDVRRVREYTEKEQRSLTEIEKKAQANEQRYTKLKEKYTELVQSHADLLRKNAEVTRQMTVARAAQDEVEVLKKEMQ---------EKVKAVQDVADRQEREQQRQLEDIQKELV-CTREELDTLKSSVTSSQQSREALSSQMAAL--ESEKAELVQS--MSKVEAELEAQRQELQRAQSSLATERESG--VKAAEALQNQLNEKESREQALESQLVAARWSSLRGAVEEAEKIVQ-DSLSQIDDPAHISCTSSADYLASRCQASLDSLDHLNSSIKTFMDDNSAVLELVRAVTRSGHLVGETIVQGSATSHMVPVEKSDALLETVKTCGAEVLLMLGQMKQQDHLAAADSTKLRVALEAILATAEKLRPRGLELQQGELGDLVEQEMAATSAAVESAASRIEEMLNKSRAVDTGVKMEVNERILASCTELMEAIKALVLSSKDLQRDIVESGRGAASMKEFYAKNSRWTEGLISASKAVGWGATVLVDAADLVVQGKGKFEELMVCSHEIAASTAQLVAASKVKADKDSTNLQRLQRASRGVTQATAVVVASTKSGKSQIEDTETMDFSSMTLTQIKRQEMDAQVLVLELETRLQKERERLGELRKKHYELAG 1034          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Medaka
Match: hip1 (huntingtin interacting protein 1 [Source:NCBI gene;Acc:101174446])

HSP 1 Score: 514.227 bits (1323), Expect = 1.223e-164
Identity = 354/1010 (35.05%), Postives = 556/1010 (55.05%), Query Frame = 3
Query:  120 ISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGKN-VDSLFELGLDILDYLE-ELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNV-AEEPDVDLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFGEMETF-PFNNDERN------------ELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEVKGLVQMKDQYE-------------ERLREY---------ESHRHDSVDAEKFNKIKDAYSKLREEHVKKLREQG-IDRQQI--ETNKKELESLQKQLEDRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLK-QIEALQIESDKEKQMENARLSQIEKELNDSKYDLDK---SLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLS--------SCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILNNDSG-NLYDQINESYYNVYNQSKSFLENIENNDDVNLS-STRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAG 2984
            I+KAIN+ E A KEKH R  ILGT H  G+  F+       L  N ++CWK+ +  HK++RDGH   + D ++N+ ++  +   WGHL  GYG + S + KLL+ K +FH K  + PGNL + + ++ ++G+N V++ F+L +++ DYLE EL +F  +V  SLD S+S S+T  GQCRL PLIQVI D + LYD +V++LFKLHS L  D L GHR RF + F+ ++  F  +  LQYFK L+Q+P LPENPPNF+  S L    + VV + AE    +  +     D   T I         +FD +FG      PFN   +N            +L +EI+ LK  +E  ++E      +L  R+  LE E+     ++ Q                R+REY         E  +    + +++ K+K+ Y++L + H   LR+   + RQ       + E+E L+K+++         EK   V    ++   +   +L + Q +L    R + + L  +     ++ + L  Q+ AL  ES+K + +++  +S++E EL   + +L +   SL+   E G  +K  E      NE +S+   L   ++     + + A+E+  K +Q + LS        SC +S+D +      +L  +D++N+     +D +   ++   ++ + G  + +T+ QG   ++       D + E+      +    L  ++  D +  + ST+L   L  +   +E +R   LE       DL ++E+  T  A++ A +R + +L +SR+  +G+++EVNE+IL SC ELM AIK L+  SKD+Q++I+  G+G  S+ +FY K+ +WTEGLISA+KAVG GAT L +AAD ++   GKFEELM+CS EI AST QLV +S+VKA+  S N Q L +ASRGV+ AT  V+A+ K+    +E+  + +FS++TLTQ KR EMD+QV VLELE  L+KER RLGELRKKHY+LAG
Sbjct:   10 INKAINTQEVAVKEKHARTCILGTHHEKGAHTFWAVVHRLPLSSNAVLCWKFCHVFHKLLRDGHPNVIKDSMRNKADLTDMSRMWGHLSEGYGKLCSIYLKLLITKIEFHIKNPRFPGNLQMSNRQLDEVGENDVNNFFQLTVEMFDYLECELNLF-LAVFSSLDMSRSVSVTAAGQCRLAPLIQVILDCSHLYDYTVKLLFKLHSCLPADTLQGHRDRFQEQFKKLKSLFYRSSNLQYFKRLIQIPQLPENPPNFLRASALSEHISPVVVIPAESSSPESEHVVETDDLVDTDIPVLPAPAETKFDDLFGTSAAIDPFNFTSQNGMRKDDKDRLIEQLTREIQALKEELESFRLESGRLCQALRGRVSELEAELAEQSHLRMQAVGESEFLKAELDDVRRVREYTEKEQRSLTEIEKKAQANEQRYTKLKEKYTELVQSHADLLRKNAEVTRQMTVARAAQDEVEVLKKEMQ---------EKVKAVQDVADRQEREQQRQLEDIQKELV-CTREELDTLKSSVTSSQQSREALSSQMAAL--ESEKAELVQS--MSKVEAELEAQRQELQRAQSSLATERESG--VKAAEALQNQLNEKESREQALESQLVAARWSSLRGAVEEAEKIVQ-DSLSQIDDPAHISCTSSADYLASRCQASLDSLDHLNSSIKTFMDDNSAVLELVRAVTRSGHLVGETIVQGSATSHMVPVEKSDALLETVKTCGAEVLLMLGQMKQQDHLAAADSTKLRVALEAILATAEKLRPRGLELQQGELGDLVEQEMAATSAAVESAASRIEEMLNKSRAVDTGVKMEVNERILASCTELMEAIKALVLSSKDLQRDIVESGRGAASMKEFYAKNSRWTEGLISASKAVGWGATVLVDAADLVVQGKGKFEELMVCSHEIAASTAQLVAASKVKADKDSTNLQRLQRASRGVTQATAVVVASTKSGKSQIEDTETMDFSSMTLTQIKRQEMDAQVLVLELETRLQKERERLGELRKKHYELAG 1001          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Medaka
Match: hip1 (huntingtin interacting protein 1 [Source:NCBI gene;Acc:101174446])

HSP 1 Score: 273.092 bits (697), Expect = 1.559e-76
Identity = 168/491 (34.22%), Postives = 265/491 (53.97%), Query Frame = 3
Query:   78 ELENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYG---GSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGKN-VDSLFELGLDILDYLE-ELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEEPDVDLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFGEMETF-PFNNDERN------------ELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEVKGLVQMKDQY-------------EERLREY---------ESHRHDSVDAEKFNKIKDAYSKLREEHVKKLREQG-IDRQQI--ETNKKELESLQKQLEDR 1421
            E E E FE+ Q   I+KAIN+ E A KEKH R ++  ++ +    G+  F+       L  N ++CWK+ +  HK++RDGH   + D ++N+ ++  +   WGHL  GYG + S + KLL+ K +FH K  + PGNL + + ++ ++G+N V++ F+L +++ DYLE EL +F  +V  SLD S+S S+T  GQCRL PLIQVI D + LYD +V++LFKLHS L  D L GHR RF + F+ ++  F  +  LQYFK L+Q+P LPENPPNF+  S L    + VV +  E     +     TD    L+D +      +FD +FG      PFN   +N            +L +EI+ LK  +E  ++E      +L  R+  LE E+     ++ Q                R+REY         E  +    + +++ K+K+ Y++L + H   LR+   + RQ       + E+E L+K+++++
Sbjct:   29 ETERENFERVQAVSINKAINTQEVAVKEKHARNILPLSYVFTFTEGAHTFWAVVHRLPLSSNAVLCWKFCHVFHKLLRDGHPNVIKDSMRNKADLTDMSRMWGHLSEGYGKLCSIYLKLLITKIEFHIKNPRFPGNLQMSNRQLDEVGENDVNNFFQLTVEMFDYLECELNLF-LAVFSSLDMSRSVSVTAAGQCRLAPLIQVILDCSHLYDYTVKLLFKLHSCLPADTLQGHRDRFQEQFKKLKSLFYRSSNLQYFKRLIQIPQLPENPPNFLRASALSEHISPVVVIPAESSSPESEHVVETD---DLVDTDIPVLPTKFDDLFGTSAAIDPFNFTSQNGMRKDDKDRLIEQLTREIQALKEELESFRLESGRLCQALRGRVSELEAELAEQSHLRMQAVGESEFLKAELDDVRRVREYTEKEQRSLTEIEKKAQANEQRYTKLKEKYTELVQSHADLLRKNAEVTRQMTVARAAQDEVEVLKKEMQEK 515          

HSP 2 Score: 211.846 bits (538), Expect = 5.028e-56
Identity = 129/266 (48.50%), Postives = 175/266 (65.79%), Query Frame = 3
Query: 2193 STRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNE--KILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAG 2984
            ST+L   L  +   +E +R   LE       DL ++E+  T  A++ A +R + +       L+   L      +IL SC ELM AIK L+  SKD+Q++I+  G+G  S+ +FY K+ +WTEGLISA+KAVG GAT L +AAD ++   GKFEELM+CS EI AST QLV +S+VKA+  S N Q L +ASRGV+ AT  V+A+ K+    +E+  + +FS++TLTQ KR EMD+QV VLELE  L+KER RLGELRKKHY+LAG
Sbjct:  703 STKLRVALEAILATAEKLRPRGLELQQGELGDLVEQEMAATSAAVESAASRIEEMTGPPSLGLTLCILLFGAPCRILASCTELMEAIKALVLSSKDLQRDIVESGRGAASMKEFYAKNSRWTEGLISASKAVGWGATVLVDAADLVVQGKGKFEELMVCSHEIAASTAQLVAASKVKADKDSTNLQRLQRASRGVTQATAVVVASTKSGKSQIEDTETMDFSSMTLTQIKRQEMDAQVLVLELETRLQKERERLGELRKKHYELAG 968          
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Medaka
Match: ENSORLT00000026971.1 (pep primary_assembly:ASM223467v1:12:2550608:2558627:1 gene:ENSORLG00000021982.1 transcript:ENSORLT00000026971.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 195.282 bits (495), Expect = 7.663e-55
Identity = 109/232 (46.98%), Postives = 163/232 (70.26%), Query Frame = 3
Query: 2289 LFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAG 2984
            + D+E++ T  AI+ AV R   IL Q++ + +G++LEVN+ IL SC++LM A+ +L+  + D+QK+I+  G+G  S T+FY K+ +WTEGLISA+KAVG GAT L ++AD ++ + G +EEL+ CS EI  ST QLV +S+VKA+ ++     L QASR V+D    V+ + K+  + + + G  +FS ++L + KR EM++QVKVL+LEN LE+ER RLGELRK+HY L  
Sbjct:   16 MVDKEMVATSTAIEEAVLRMD-ILTQAKKDTTGLKLEVNQSILGSCSDLMKAVHILVTAATDLQKDIVEGGRGAASTTEFYAKNSRWTEGLISASKAVGWGATQLLDSADRVVCEKGTYEELIACSHEIAGSTAQLVAASKVKADRSNKKLNTLQQASRHVNDMAAVVVTSTKHGQKQISDHGIMDFSGMSLIKLKREEMEAQVKVLQLENQLEQERVRLGELRKRHYDLGA 246          
BLAST of Huntingtin-interacting protein 1 vs. Planmine SMEST
Match: SMESG000080380.1 (SMESG000080380.1)

HSP 1 Score: 2029.6 bits (5257), Expect = 0.000e+0
Identity = 1009/1011 (99.80%), Postives = 1011/1011 (100.00%), Query Frame = 3
Query:   30 MTSIQKVFQQRKKTPTELENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEEPDVDLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFGEMETFPFNNDERNELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEVKGLVQMKDQYEERLREYESHRHDSVDAEKFNKIKDAYSKLREEHVKKLREQGIDRQQIETNKKELESLQKQLEDRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSKYDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILNNDSGNLYDQINESYYNVYNQSKSFLENIENNDDVNLSSTRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAGETVDQELLDDSMNIEINDEISSEALS 3062
            MTSIQKVFQQRKKTPTELENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNS+HNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEEPDVDLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFGEMETFPFNNDERNELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEVKGLVQMKDQYEERLREYESHRHDSVDAEKFNKIKDAYSKLREEHVKKLREQGIDRQQIETNKKELESLQKQLEDRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSKYDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILNNDSGNLYDQINESYYNVYN+SKSFLENIENNDDVNLSSTRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDLEKERRRLGELRKKHYQLAGETVDQELLDDSMNIEINDEISSEALS
Sbjct:    1 MTSIQKVFQQRKKTPTELENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSLHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEEPDVDLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFGEMETFPFNNDERNELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEVKGLVQMKDQYEERLREYESHRHDSVDAEKFNKIKDAYSKLREEHVKKLREQGIDRQQIETNKKELESLQKQLEDRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSKYDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILNNDSGNLYDQINESYYNVYNESKSFLENIENNDDVNLSSTRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDLEKERRRLGELRKKHYQLAGETVDQELLDDSMNIEINDEISSEALS 1011          
BLAST of Huntingtin-interacting protein 1 vs. Planmine SMEST
Match: SMESG000080380.1 (SMESG000080380.1)

HSP 1 Score: 1991.08 bits (5157), Expect = 0.000e+0
Identity = 988/990 (99.80%), Postives = 990/990 (100.00%), Query Frame = 3
Query:   30 MTSIQKVFQQRKKTPTELENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEEPDVDLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFGEMETFPFNNDERNELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEVKGLVQMKDQYEERLREYESHRHDSVDAEKFNKIKDAYSKLREEHVKKLREQGIDRQQIETNKKELESLQKQLEDRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSKYDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILNNDSGNLYDQINESYYNVYNQSKSFLENIENNDDVNLSSTRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDXXXXXXXXXXXXXXHYQLAGETVDQ 2999
            MTSIQKVFQQRKKTPTELENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNS+HNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEEPDVDLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFGEMETFPFNNDERNELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEVKGLVQMKDQYEERLREYESHRHDSVDAEKFNKIKDAYSKLREEHVKKLREQGIDRQQIETNKKELESLQKQLEDRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSKYDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILNNDSGNLYDQINESYYNVYN+SKSFLENIENNDDVNLSSTRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDLEKERRRLGELRKKHYQLAGETVDQ
Sbjct:    1 MTSIQKVFQQRKKTPTELENEQFEKNQNNHISKAINSVEGAPKEKHIRGVILGTFHYGGSSIFFKHNSLHNLHGNPIICWKYLYAVHKIMRDGHEQALIDVIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNLIIQSDEIFQLGKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSMTPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLKLFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNVAEEPDVDLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFGEMETFPFNNDERNELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEVKGLVQMKDQYEERLREYESHRHDSVDAEKFNKIKDAYSKLREEHVKKLREQGIDRQQIETNKKELESLQKQLEDRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLKEYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEKELNDSKYDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKTACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAIRDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILNNDSGNLYDQINESYYNVYNESKSFLENIENNDDVNLSSTRLIKTLNQLKNLSESVRINNLESGNANTDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKRLEMDSQVKVLELENDLEKERRRLGELRKKHYQLAGETVDQ 990          
BLAST of Huntingtin-interacting protein 1 vs. Planmine SMEST
Match: SMESG000072542.1 (SMESG000072542.1)

HSP 1 Score: 55.8398 bits (133), Expect = 2.235e-7
Identity = 42/186 (22.58%), Postives = 89/186 (47.85%), Query Frame = 3
Query: 2301 ELLNTRNAIDMAVNRFKMILEQSRSNL---SGIQLEVNEKILESCNELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKAVGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLTSMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNF 2849
            ELL   + I+ A  +  ++  + R ++   +G +   + +I+ +C  ++ A   L+  +   Q+E++++G+   S     +   +W+ GLISAA+ V      L ++A  ++      + L+  S+++ A T  L+++ +VK++  S   Q L  A   V  AT  ++  A     V +    Y +
Sbjct: 2490 ELLEAASQIETAAKKIALL--KPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATEHRDVQDGSIPYTY 2673          
The following BLAST results are available for this feature:
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HIP11.313e-16935.47huntingtin interacting protein 1 [Source:HGNC Symb... [more]
HIP11.920e-16635.39huntingtin interacting protein 1 [Source:HGNC Symb... [more]
HIP1R8.314e-15232.60huntingtin interacting protein 1 related [Source:H... [more]
HIP12.069e-14132.91huntingtin interacting protein 1 [Source:HGNC Symb... [more]
HIP16.500e-2739.39huntingtin interacting protein 1 [Source:HGNC Symb... [more]
back to top
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hipr-13.237e-6228.35Huntington interacting protein related 1 [Source:... [more]
hipr-13.237e-6228.35Huntington interacting protein related 1 [Source:... [more]
hipr-13.237e-6228.35Huntington interacting protein related 1 [Source:... [more]
hipr-13.658e-6229.38Huntington interacting protein related 1 [Source:... [more]
hipr-13.658e-6229.38Huntington interacting protein related 1 [Source:... [more]
back to top
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hip11.978e-7330.02gene:FBgn0036309 transcript:FBtr0075948[more]
Hip15.456e-6730.31gene:FBgn0036309 transcript:FBtr0075949[more]
rhea5.092e-1031.29gene:FBgn0260442 transcript:FBtr0305210[more]
rhea5.092e-1031.29gene:FBgn0260442 transcript:FBtr0333105[more]
rhea5.092e-1031.29gene:FBgn0260442 transcript:FBtr0333106[more]
back to top
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hip17.357e-16734.99huntingtin interacting protein 1 [Source:ZFIN;Acc:... [more]
hip16.016e-16634.93huntingtin interacting protein 1 [Source:ZFIN;Acc:... [more]
hip18.933e-16234.61huntingtin interacting protein 1 [Source:ZFIN;Acc:... [more]
hip1rb1.565e-15033.08huntingtin interacting protein 1 related b [Source... [more]
hip13.094e-15034.43huntingtin interacting protein 1 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hip1r3.903e-15432.91huntingtin interacting protein 1 related [Source:N... [more]
hip1r1.199e-14231.97huntingtin interacting protein 1 related [Source:N... [more]
hip1r6.552e-13130.34huntingtin interacting protein 1 related [Source:N... [more]
hip1r9.839e-13131.06huntingtin interacting protein 1 related [Source:N... [more]
hip1r2.359e-12830.92huntingtin interacting protein 1 related [Source:N... [more]
back to top
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hip11.299e-16836.75huntingtin interacting protein 1 [Source:MGI Symbo... [more]
Hip1r7.162e-14832.65huntingtin interacting protein 1 related [Source:M... [more]
Hip11.409e-7639.35huntingtin interacting protein 1 [Source:MGI Symbo... [more]
Hip12.334e-7336.13huntingtin interacting protein 1 [Source:MGI Symbo... [more]
Hip18.959e-4141.30huntingtin interacting protein 1 [Source:MGI Symbo... [more]
back to top
BLAST of Huntingtin-interacting protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O00291|HIP1_HUMAN6.307e-16935.47Huntingtin-interacting protein 1 OS=Homo sapiens O... [more]
sp|Q8VD75|HIP1_MOUSE9.087e-16836.75Huntingtin-interacting protein 1 OS=Mus musculus O... [more]
sp|O75146|HIP1R_HUMAN3.992e-15132.60Huntingtin-interacting protein 1-related protein O... [more]
sp|Q9JKY5|HIP1R_MOUSE5.010e-14732.65Huntingtin-interacting protein 1-related protein O... [more]
sp|Q02328|SLAP2_CAEEL4.653e-6129.38Huntington interacting protein related 1 OS=Caenor... [more]
back to top
BLAST of Huntingtin-interacting protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3J5V20.000e+038.54huntingtin-interacting protein 1 isoform X1 OS=Lin... [more]
A0A1S3H7390.000e+038.35huntingtin-interacting protein 1 isoform X3 OS=Lin... [more]
A0A1S3J6100.000e+038.16huntingtin-interacting protein 1 isoform X2 OS=Lin... [more]
A0A1S3H8440.000e+038.19huntingtin-interacting protein 1 isoform X1 OS=Lin... [more]
K1QW150.000e+036.30Huntingtin-interacting protein 1 OS=Crassostrea gi... [more]
back to top
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hip11.031e-16835.37huntingtin interacting protein 1 [Source:NCBI gene... [more]
hip17.423e-16434.98huntingtin interacting protein 1 [Source:NCBI gene... [more]
hip1rb1.450e-15131.56huntingtin-interacting protein 1-related protein-l... [more]
hip1rb2.193e-15131.56huntingtin-interacting protein 1-related protein-l... [more]
hip1rb1.401e-12629.48huntingtin-interacting protein 1-related protein-l... [more]
back to top
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
hip13.220e-13733.97huntingtin interacting protein 1 [Source:ZFIN;Acc:... [more]
ENSPMAT00000007764.12.068e-6442.21pep scaffold:Pmarinus_7.0:GL477581:34251:41399:-1 ... [more]
ENSPMAT00000010194.11.072e-1128.57pep scaffold:Pmarinus_7.0:GL480176:295:15370:1 gen... [more]
back to top
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SLA25.066e-2126.12Adaptor protein that links actin to clathrin and e... [more]
back to top
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO351942.774e-6653.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO351953.778e-5736.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477773.306e-1326.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Huntingtin-interacting protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hip13.194e-16835.12huntingtin interacting protein 1 [Source:NCBI gene... [more]
hip11.656e-16735.16huntingtin interacting protein 1 [Source:NCBI gene... [more]
hip11.223e-16435.05huntingtin interacting protein 1 [Source:NCBI gene... [more]
hip11.559e-7634.22huntingtin interacting protein 1 [Source:NCBI gene... [more]
ENSORLT00000026971.17.663e-5546.98pep primary_assembly:ASM223467v1:12:2550608:255862... [more]
back to top
BLAST of Huntingtin-interacting protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000080380.10.000e+099.80SMESG000080380.1[more]
SMESG000080380.10.000e+099.80SMESG000080380.1[more]
SMESG000072542.12.235e-722.58SMESG000072542.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014010 ID=SMED30014010|Name=Huntingtin-interacting protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3178bp
CTAAGTAAATAAATTATATTTAAAGTTTTATGACATCAATTCAAAAAGTT
TTTCAACAACGAAAGAAAACTCCTACGGAGTTAGAAAATGAGCAATTTGA
AAAAAATCAAAACAATCACATTAGCAAAGCTATAAATTCAGTTGAAGGTG
CTCCGAAAGAAAAACATATAAGAGGTGTAATTCTTGGTACTTTTCATTAT
GGCGGGTCATCAATTTTTTTTAAACACAATAGTGTACATAATTTACATGG
TAATCCAATAATATGTTGGAAATACTTATATGCAGTTCATAAAATTATGC
GTGATGGTCATGAACAGGCATTAATCGATGTTATAAAAAACGAAAAAGAA
ATAAAGTCTTTGGGCGAATCATGGGGCCATCTGAAAACTGGTTATGGAAC
AATTATATCGAAATTCAGTAAATTATTATTACAGAAATGTAAATTCCATC
GAAAATATCGAAAAGTGCCCGGCAATCTGATTATTCAGAGTGATGAAATT
TTTCAATTAGGAAAAAATGTGGACAGTCTATTCGAGTTGGGGTTAGATAT
TTTGGATTATCTGGAGGAGCTGGTTATGTTTGAGAAATCGGTGATCGATT
CTCTGGACAAGTCGAAAAGCAATTCCATGACCCCCCAGGGCCAGTGCCGC
CTAACACCCTTGATACAGGTCATTCAGGACATGGCTACCTTATACGACAT
GAGTGTGCGCATACTTTTCAAATTACATTCGAAGTTGGAAGTTGACATGC
TGACTGGACATCGGCAGCGCTTTCTCAAATTATTCCAATCAATCAGGGAC
TTTTTTAAACATGCACAAACATTGCAGTATTTTAAAACTCTTGTTCAAGT
TCCCACACTTCCCGAGAATCCTCCAAATTTCATGGTTGAATCTGATTTAG
TTGCTCAAAAAGCTTTAGTTGTTAACGTGGCAGAAGAGCCTGATGTAGAT
TTGAATAATTGTGACTCGCCTACTGACCGAAATAGTACTCTCATCGATTT
CAATCAGATTGATAACAATGACAGGTTCGATCAGATCTTCGGTGAAATGG
AAACCTTTCCTTTTAATAATGACGAGAGAAATGAACTGAAAAAGGAAATC
GAATATTTAAAAGCATTAATCGAAAGAATGAAAATTGAGCACCGTGAAAA
GGTTAATTCTTTATTGGCCAGAATTAGAGTTCTCGAGGAAGAAGTTAAAG
GACTGGTTCAAATGAAGGATCAGTATGAAGAAAGATTGAGAGAGTATGAG
AGTCATAGGCATGATTCTGTTGATGCTGAGAAATTCAACAAAATCAAAGA
TGCCTATTCAAAATTACGAGAAGAGCACGTGAAAAAATTACGAGAACAAG
GAATTGACCGCCAACAAATCGAAACGAATAAGAAAGAATTGGAATCCTTA
CAAAAACAATTGGAAGACCGGAACATTGAATTGGCAAAACTTGAGAAAGA
AAACCTTGTCTATGCATCAATGGAAAAAAATATAGATCAGTATAATCACG
AGCTTGCAGAAGCCCAGGCCAAATTAAAGGAATATGAACGTTCAAAATTC
GAAGCTTTGGCTAAAAATAAAAATTTAGAATCAAAAAATGTTGATTTATT
AAAACAAATTGAGGCCTTACAAATCGAATCAGATAAAGAAAAACAAATGG
AAAATGCTAGACTTTCTCAAATTGAGAAGGAATTAAACGATTCAAAATAT
GATTTGGACAAAAGTTTATCAAAAATAAACGAGTTAGGACTTATCATTAA
AAGAATGGAAGAGCAACTCAAGTCAGAAAACGAATCCAAATCCAAAATGT
CATATCTTTATGAAAATATGATTAAAACGGCGTGTCAAACAAGTCAACAG
GCTATTGAGAAAACTAATAAAACACTTCAATCCGAAGATCTTTCCAGTTG
TCGTGCTTCTTCGGATATAATCAGGGTGACTATTGATGATGCCTTGGCAG
AAATTGATAATATCAATAATCTAGCAATCCGAGATCTCGATTCTTCCGAA
GTTCGAATACAATTTGCTGACTCCATTTACAAATTCGGTGCTAAATTATC
TGACACGCTGTATCAAGGAAAAATTCTCAACAATGACAGCGGCAATTTGT
ATGATCAAATCAACGAATCTTATTACAATGTCTATAATCAGTCGAAATCG
TTCCTGGAAAACATTGAAAACAATGATGACGTGAATTTGAGTTCGACGCG
TTTAATCAAGACATTAAATCAGTTGAAAAATCTATCTGAAAGTGTCAGAA
TAAATAATCTAGAATCTGGAAATGCAAATACTGACGATCTTTTCGATGAA
GAATTGCTTAATACTAGAAACGCAATAGATATGGCAGTAAATCGGTTCAA
AATGATTCTGGAGCAATCCAGATCCAATTTGTCTGGTATTCAGCTTGAAG
TCAATGAGAAAATATTAGAATCTTGTAATGAACTAATGTATGCTATCAAA
GTTCTTATTGACCGATCTAAAGACATGCAAAAAGAAATTATAGCCGAAGG
AAAGGGTACTGGCTCAGTTACTGACTTTTATAAAAAGCATCATAAATGGA
CTGAAGGCCTAATTTCTGCGGCTAAGGCTGTTGGAGGTGGTGCTACGTGG
TTATGTGAAGCAGCAGATAATTTATTAACTAAAGATGGTAAATTTGAAGA
GTTGATGATCTGTTCTCGTGAAATAACGGCCAGCACCACACAGCTTGTTG
TATCGAGTCGTGTCAAAGCCAATCTTACATCTATGAATTTCCAAAACCTT
TCACAGGCCAGTAGAGGAGTTTCTGATGCCACTGGTAAAGTTATAGCCAA
CGCCAAAAACGCTATGAGAGTTCTGGAAGAGCAAGGGTCTTATAATTTCT
CTAATTTAACTTTAACACAAGCTAAACGTTTGGAAATGGATTCTCAAGTA
AAAGTTTTAGAATTAGAAAATGATCTTGAAAAAGAAAGACGACGACTTGG
TGAATTGAGAAAGAAGCATTATCAATTGGCTGGAGAAACTGTTGATCAGG
AATTGCTAGATGATTCTATGAATATAGAAATTAACGACGAAATCTCCTCA
GAAGCGTTGTCATGACATGGTATATTAATGAACTGAATTTATTACTGTCT
GTCGATTAAATATTGTCACTTTCTAAGATAATGATTGTTTCTAGCAATTT
CATATGTTTAATGACCTCCAGAACCAGC
back to top

protein sequence of SMED30014010-orf-1

>SMED30014010-orf-1 ID=SMED30014010-orf-1|Name=SMED30014010-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1012bp
MTSIQKVFQQRKKTPTELENEQFEKNQNNHISKAINSVEGAPKEKHIRGV
ILGTFHYGGSSIFFKHNSVHNLHGNPIICWKYLYAVHKIMRDGHEQALID
VIKNEKEIKSLGESWGHLKTGYGTIISKFSKLLLQKCKFHRKYRKVPGNL
IIQSDEIFQLGKNVDSLFELGLDILDYLEELVMFEKSVIDSLDKSKSNSM
TPQGQCRLTPLIQVIQDMATLYDMSVRILFKLHSKLEVDMLTGHRQRFLK
LFQSIRDFFKHAQTLQYFKTLVQVPTLPENPPNFMVESDLVAQKALVVNV
AEEPDVDLNNCDSPTDRNSTLIDFNQIDNNDRFDQIFGEMETFPFNNDER
NELKKEIEYLKALIERMKIEHREKVNSLLARIRVLEEEVKGLVQMKDQYE
ERLREYESHRHDSVDAEKFNKIKDAYSKLREEHVKKLREQGIDRQQIETN
KKELESLQKQLEDRNIELAKLEKENLVYASMEKNIDQYNHELAEAQAKLK
EYERSKFEALAKNKNLESKNVDLLKQIEALQIESDKEKQMENARLSQIEK
ELNDSKYDLDKSLSKINELGLIIKRMEEQLKSENESKSKMSYLYENMIKT
ACQTSQQAIEKTNKTLQSEDLSSCRASSDIIRVTIDDALAEIDNINNLAI
RDLDSSEVRIQFADSIYKFGAKLSDTLYQGKILNNDSGNLYDQINESYYN
VYNQSKSFLENIENNDDVNLSSTRLIKTLNQLKNLSESVRINNLESGNAN
TDDLFDEELLNTRNAIDMAVNRFKMILEQSRSNLSGIQLEVNEKILESCN
ELMYAIKVLIDRSKDMQKEIIAEGKGTGSVTDFYKKHHKWTEGLISAAKA
VGGGATWLCEAADNLLTKDGKFEELMICSREITASTTQLVVSSRVKANLT
SMNFQNLSQASRGVSDATGKVIANAKNAMRVLEEQGSYNFSNLTLTQAKR
LEMDSQVKVLELENDLEKERRRLGELRKKHYQLAGETVDQELLDDSMNIE
INDEISSEALS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR030224Sla2_fam
IPR035964I/LWEQ_dom_sf
IPR013809ENTH
IPR002558ILWEQ_dom
IPR008942ENTH_VHS
IPR011417ANTH_dom
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
GO:0005543phospholipid binding
GO:0030276clathrin binding
Vocabulary: biological process
TermDefinition
GO:0006897endocytosis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 350..409
NoneNo IPR availableCOILSCoilCoilcoord: 959..979
NoneNo IPR availableCOILSCoilCoilcoord: 566..586
NoneNo IPR availableCOILSCoilCoilcoord: 444..540
NoneNo IPR availableGENE3DG3DSA:1.20.1410.10coord: 740..943
e-value: 2.2E-70
score: 238.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..20
NoneNo IPR availablePANTHERPTHR10407:SF15HUNTINGTIN INTERACTING PROTEIN 1coord: 18..984
NoneNo IPR availablePRODOMPD011820coord: 789..982
e-value: 2.0E-55
score: 553.0
NoneNo IPR availableCDDcd17006ANTH_N_HIP1_likecoord: 27..140
e-value: 1.29019E-43
score: 151.666
IPR013809ENTH domainSMARTSM00273enth_2coord: 25..147
e-value: 1.9E-16
score: 70.7
IPR013809ENTH domainPROSITEPS50942ENTHcoord: 19..147
score: 14.206
IPR002558I/LWEQ domainSMARTSM00307ILWEQ_1coord: 786..984
e-value: 5.6E-94
score: 328.2
IPR002558I/LWEQ domainPFAMPF01608I_LWEQcoord: 834..982
e-value: 3.5E-50
score: 170.2
IPR002558I/LWEQ domainPROSITEPS50945I_LWEQcoord: 743..984
score: 56.701
IPR011417AP180 N-terminal homology (ANTH) domainPFAMPF07651ANTHcoord: 28..291
e-value: 2.2E-50
score: 171.2
IPR008942ENTH/VHSGENE3DG3DSA:1.25.40.90coord: 4..145
e-value: 2.6E-10
score: 42.1
IPR008942ENTH/VHSSUPERFAMILYSSF48464ENTH/VHS domaincoord: 30..143
IPR030224Sla2 familyPANTHERPTHR10407HUNTINGTIN INTERACTING PROTEIN 1coord: 18..984
IPR035964I/LWEQ domain superfamilySUPERFAMILYSSF109885I/LWEQ domaincoord: 749..936