Fucolectin

Overview
NameFucolectin
Smed IDSMED30013992
Length (bp)622
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Fucolectin (SMED30013992) t-SNE clustered cells

Violin plots show distribution of expression levels for Fucolectin (SMED30013992) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013992

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30013992h1SMcG0019724 dd_Smed_v4_52492_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013992h1SMcG0019724 dd_Smed_v4_52492_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30013992h1SMcG0019724 dd_Smed_v4_52492_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Fucolectin vs. Ensembl Zebrafish
Match: si:ch73-359m17.2 (si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-90])

HSP 1 Score: 69.707 bits (169), Expect = 6.365e-14
Identity = 47/141 (33.33%), Postives = 69/141 (48.94%), Query Frame = 3
Query:  174 ISVGKAAYQSSDYL-DYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLITSSQVVSFLWCGGLTANKVRVRHER---------KEYMTLCEVQVFS 566
            I+ G AA QSS +  D  A  AVDG+T  + +   CSHTL E N +W +DL + +S+  ++I NR D   ER+ GA +          N+  L+ +   V  +  G     + +    R           Y+TLCEVQVF+
Sbjct:  168 IAAGAAAIQSSTWPHDGDAGNAVDGSTESEYQEGSCSHTLGETNPWWRVDLGRVFSIRRVSITNRGDCCEERLNGAEIRIGNSLENNGNSNHLVAT---VEHIPAGNTETFEFQPVQGRFLNIVLPGVNVYLTLCEVQVFT 305          

HSP 2 Score: 64.6994 bits (156), Expect = 4.071e-12
Identity = 51/150 (34.00%), Postives = 70/150 (46.67%), Query Frame = 3
Query:  147 LTDVNSEVLISVGKAAYQSS-DYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGL-------ITSSQVVSFLWCGGLTANKVRVRHERKEYMTLCEVQVFSKK 572
            +TDV +   +++G AA QSS    +  A +AVDGNT  D     C+HT  E N +W +DL    S+  + I NR D   ERI GA++          N   L       I  SQ   F    G   N     ++  E ++LCEV+VFS  
Sbjct:   18 VTDV-APANLALGAAAVQSSTGDPNGNAEHAVDGNTEADYRKGSCTHTSREFNPWWRVDLGGVSSVNKVTITNRGDCCEERIRGAQIRIGDSLENNGNNNQLAATLLDAIKGSQTFEFQPIQGRYLNVFLPGND--ETLSLCEVEVFSGP 164          
BLAST of Fucolectin vs. Ensembl Zebrafish
Match: si:ch73-359m17.2 (si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-90])

HSP 1 Score: 65.0846 bits (157), Expect = 5.831e-13
Identity = 51/148 (34.46%), Postives = 70/148 (47.30%), Query Frame = 3
Query:  147 LTDVNSEVLISVGKAAYQSS-DYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGL-------ITSSQVVSFLWCGGLTANKVRVRHERKEYMTLCEVQVFS 566
            +TDV +   +++G AA QSS    +  A +AVDGNT  D     C+HT  E N +W +DL    S+  + I NR D   ERI GA++          N   L       I  SQ   F    G   N     ++  E ++LCEV+VFS
Sbjct:   18 VTDV-APANLALGAAAVQSSTGDPNGNAEHAVDGNTEADYRKGSCTHTSREFNPWWRVDLGGVSSVNKVTITNRGDCCEERIRGAQIRIGDSLENNGNNNQLAATLLDAIKGSQTFEFQPIQGRYLNVFLPGND--ETLSLCEVEVFS 162          
BLAST of Fucolectin vs. Ensembl Zebrafish
Match: si:ch73-359m17.2 (si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-90])

HSP 1 Score: 64.3142 bits (155), Expect = 2.879e-12
Identity = 51/148 (34.46%), Postives = 70/148 (47.30%), Query Frame = 3
Query:  147 LTDVNSEVLISVGKAAYQSS-DYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGL-------ITSSQVVSFLWCGGLTANKVRVRHERKEYMTLCEVQVFS 566
            +TDV +   +++G AA QSS    +  A +AVDGNT  D     C+HT  E N +W +DL    S+  + I NR D   ERI GA++          N   L       I  SQ   F    G   N     ++  E ++LCEV+VFS
Sbjct:   18 VTDV-APANLALGAAAVQSSTGDPNGNAEHAVDGNTEADYRKGSCTHTSREFNPWWRVDLGGVSSVNKVTITNRGDCCEERIRGAQIRIGDSLENNGNNNQLAATLLDAIKGSQTFEFQPIQGRYLNVFLPGND--ETLSLCEVEVFS 162          

HSP 2 Score: 56.6102 bits (135), Expect = 1.934e-9
Identity = 28/65 (43.08%), Postives = 40/65 (61.54%), Query Frame = 3
Query:  174 ISVGKAAYQSSDYL-DYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNR 365
            I+ G AA QSS +  D  A  AVDG+T  + +   CSHTL E N +W +DL + +S+  ++I NR
Sbjct:  169 IAAGAAAIQSSTWPHDGDAGNAVDGSTESEYQEGSCSHTLGETNPWWRVDLGRVFSIRRVSITNR 233          
BLAST of Fucolectin vs. Ensembl Zebrafish
Match: zgc:171424 (zgc:171424 [Source:ZFIN;Acc:ZDB-GENE-080204-26])

HSP 1 Score: 60.077 bits (144), Expect = 1.317e-10
Identity = 45/157 (28.66%), Postives = 72/157 (45.86%), Query Frame = 3
Query:  120 IFLIFYISLLTDVNSEVLISVGKAAYQSSDYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVE---GYTPNAKKWNTCGLITS--SQVVSFLWCGGLTANKVR--VRHERKEYMTLCEVQVFSK 569
            +F++F  +L T          GK   QSS Y  +    A+D N G+      CS T  + + +W +DL   Y ++ + + NR +   ERI GA +        N      C +I+S  + V +   C  +    V   +R E K Y+TLCEV+V+ +
Sbjct:   44 VFVVFPDNLAT----------GKNVMQSSTYSSWIPEQAIDFNPGLSDPSIGCSSTNGQTDPWWRLDLGHIYQVSTVVVTNRLNCCPERINGAEIHIGNSLENNGNNNPICAVISSIPAGVSATFACNNMEGRYVSLLIRGEMK-YITLCEVEVYGQ 189          
BLAST of Fucolectin vs. Ensembl Zebrafish
Match: si:cabz01040626.2 (si:cabz01040626.2 [Source:ZFIN;Acc:ZDB-GENE-160113-147])

HSP 1 Score: 60.077 bits (144), Expect = 2.087e-10
Identity = 46/155 (29.68%), Postives = 77/155 (49.68%), Query Frame = 3
Query:  117 MIFLIFYISLLTDVNSEVLISVGKAAYQSSDYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVE-GYTPNAKKWNT-CGL---ITSSQVVSFLWCGGLTANKVRVR-HERKEYMTLCEVQVF 563
            ++F  F+   ++    EV I+    A QS+ Y D+   YA+DG        + C+HT  +   +W +DL++ YS+  ++I NR D  SERI GA +  G  P+    N  C +   I + +  S+  C G+    + V  +     +TLC+V V+
Sbjct:    8 LLFPGFFSVQMSVRGIEVNIAGWGTAIQSTMYYDWFPKYALDGIN------SSCTHTATQTLPWWRLDLQKSYSVNRVSITNRLDCCSERINGAEIRIGNVPSDVFSNPVCAVVSTIPAGETFSYS-CNGMQGRYLFVDINGASRILTLCDVGVY 155          

HSP 2 Score: 58.151 bits (139), Expect = 9.699e-10
Identity = 39/144 (27.08%), Postives = 69/144 (47.92%), Query Frame = 3
Query:  174 ISVGKAAYQSSDYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVE---GYTPNAKKWNTCGLITS--SQVVSFLWCGGLTANKVR--VRHERKEYMTLCEVQVFSKKVQLE 584
            ++ GK   QSS +  +    A+D N G+      CS T ++ + +W +DL   Y ++ + + NR D   ER+ GA +        N      C +I+S  + V +   C  +    V   +R + K ++TLCEV+V+ +   L+
Sbjct:  162 LATGKNVMQSSTFSSWIPEQAIDFNPGLSDPSIGCSSTNSQTDPWWRLDLGHIYQVSTVVVTNRLDCCPERMNGAEIHIGNSLENNGNNNPICAVISSIPAGVSATFACNNMEGRYVSLLIRGDTK-FLTLCEVEVYGQGPCLK 304          
BLAST of Fucolectin vs. Ensembl Xenopus
Match: insc (INSC, spindle orientation adaptor protein [Source:Xenbase;Acc:XB-GENE-995845])

HSP 1 Score: 84.3445 bits (207), Expect = 2.571e-20
Identity = 49/131 (37.40%), Postives = 70/131 (53.44%), Query Frame = 3
Query:  198 QSSDY-LDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLITS-SQVVSFLWCGGLTANKVRVR-HERKEYMTLCEVQVFSKKVQL 581
            QSSDY   Y A  AVDG    D+ ++ C+HT  +   +W +DLK+ Y +  + I NR D  SER++ A +            C  IT  SQ +  L CGG+    V V    R EY+TLCEV+V+ +K ++
Sbjct:   11 QSSDYEPQYGAETAVDGIIETDISIHPCTHTDEDYGPWWQVDLKKRYKVHTVVIVNRRDCCSERLLEAEIRVGDSEDNDNPICDTITDVSQAIISLSCGGMEGRYVGVVIPGRSEYLTLCEVEVYGEKAEV 141          
BLAST of Fucolectin vs. Ensembl Xenopus
Match: fucolectin (x-epilectin [Source:NCBI gene;Acc:100144955])

HSP 1 Score: 86.2705 bits (212), Expect = 2.338e-19
Identity = 51/134 (38.06%), Postives = 73/134 (54.48%), Query Frame = 3
Query:  198 QSSDY-LDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLIT-SSQVVSFLWCGGLTANKVRVR-HERKEYMTLCEVQVFSKKVQLESF 590
            QSS Y  +Y A  AVDGN   ++ L  CSHT ++N ++W +DLK+ Y +  + I NR D   ER+ GA V            CG IT +SQ    L C G+    V V    R EY+TLCEV+V+ ++ + ++ 
Sbjct:  122 QSSTYRPEYNAATAVDGNKNSNMMLGSCSHTNSDNPAWWQLDLKKRYQVEKVVIVNRGDCCGERLRGAEVRVGNSADNNNPVCGAITDASQATITLPCKGMKGRYVSVVIPGRNEYLTLCEVEVYGQEAKPDAV 255          

HSP 2 Score: 79.7221 bits (195), Expect = 5.134e-17
Identity = 46/138 (33.33%), Postives = 76/138 (55.07%), Query Frame = 3
Query:  171 LISVGKAAYQSSDYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVE-GYTPNAKKWNTCGLITS-SQVVSFLWCGGLTANKVRVR-HERKEYMTLCEVQVFSKKV 575
            L   G+A   S+   +Y A  A+DG+ G ++  + CSHT  +N ++W +DL ++Y++  + I NR D  SER+ GA +  G  P       C  +T  S+    L C G+    + V    R+EY+TLCEV+V+ +++
Sbjct:  258 LAKSGRARQSSTYRPEYNAAAAIDGDKGTNIFQHPCSHTNPDNPAWWQLDLTKKYNIESVVIVNRGDCCSERLRGAEIRVGIFPFINS-PVCDTVTDVSKPTITLNCNGMVGQYISVVIPGRQEYLTLCEVEVYGQEI 394          

HSP 3 Score: 62.003 bits (149), Expect = 7.466e-11
Identity = 36/106 (33.96%), Postives = 56/106 (52.83%), Query Frame = 3
Query:  267 LNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLI-TSSQVVSFLWCGGLTANKVRVR-HERKEYMTLCEVQVFSKKVQ 578
            ++ C+HT  +N ++W +DLK+ Y +  I I NR D  SER++GA +            C  I   SQ    L C GL    V V    R+E ++LCEV+V+ ++ +
Sbjct:    3 VHPCTHTDYDNPAWWQLDLKKRYKVDTIVIVNRGDCCSERLLGAEIRVGDSADNNNPVCDTIKVGSQGTITLCCEGLEGRYVSVVIPGREENLSLCEVEVYGQEAK 108          
BLAST of Fucolectin vs. Ensembl Xenopus
Match: ENSXETT00000034809.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:133072291:133075842:-1 gene:ENSXETG00000011701.1 transcript:ENSXETT00000034809.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.0333 bits (201), Expect = 2.764e-19
Identity = 48/130 (36.92%), Postives = 68/130 (52.31%), Query Frame = 3
Query:  189 AAYQSSDYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLITSS-QVVSFLWCGGLTANKVRVR-HERKEYMTLCEVQVFSKK 572
            AA QSSD+L + A+ A DG    D     CSHT  +N ++W +DLK  Y +  + I NR D  S+R+ GA +            CG I    Q  + L C G+    V V    R+EY++LCEV+VF ++
Sbjct:   25 AATQSSDWLSHGAHLATDGVKLTDHYEGSCSHTTNDNPAWWRLDLKVRYKVETVVIVNRMDGHSDRLFGAEIRIGDSADNNNPVCGTINDILQATTTLCCNGMEGRYVSVVIPGREEYLSLCEVEVFGEE 154          
BLAST of Fucolectin vs. Ensembl Xenopus
Match: fucolectin (x-epilectin [Source:NCBI gene;Acc:100144955])

HSP 1 Score: 83.5741 bits (205), Expect = 1.138e-18
Identity = 51/145 (35.17%), Postives = 78/145 (53.79%), Query Frame = 3
Query:  153 DVNSEVLISVGKAAYQSSDYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVE-GYTPNAKKWNTCGLITS-SQVVSFLWCGGLTANKVRVR-HERKEYMTLCEVQVFSKKVQ 578
            DVN   L  +G+A+  S+    Y A  A+DGN   ++    CSHT ++N ++W +DLK+ Y +  + I NR D   ER+ GA +  G +P+      C  +T  SQ+   L C G+    V V    R EY+ LCEV+V+ K+ +
Sbjct:  168 DVN---LARLGEASQSSTFSPKYNAAAAIDGNKDTNMMAGSCSHTNSDNPAWWQLDLKKRYQVEKVVIVNRGDCCGERLRGAEIRVGDSPDNNN-PVCATVTDVSQLTLTLSCKGIPGRYVSVVIPGRAEYLQLCEVEVYGKEAE 308          

HSP 2 Score: 80.1073 bits (196), Expect = 1.681e-17
Identity = 48/131 (36.64%), Postives = 74/131 (56.49%), Query Frame = 3
Query:  198 QSSDY-LDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVE-GYTPNAKKWNTCGLITSSQVVSF-LWCGGLTANKVRVR-HERKEYMTLCEVQVFSKKVQ 578
            QSS +   YTA  AVDGN   ++  N CSHT  +  S+W +DLK+ Y++  I I NR D  +ER++ A +  G +P+      C  IT    ++F + C G+    V V   +R EY+ LCEV+V+ ++ +
Sbjct:   36 QSSTFGAQYTAQKAVDGNKDTNMFQNSCSHTNNDKPSWWQLDLKKNYNIDTIVIANRGDCCAERLLRAEIRVGNSPDNNN-PVCATITDVSKLTFPVCCNGMEGRYVSVVISDRAEYLQLCEVEVYGQEAK 165          
BLAST of Fucolectin vs. Ensembl Xenopus
Match: fucolectin (x-epilectin [Source:NCBI gene;Acc:100144955])

HSP 1 Score: 83.5741 bits (205), Expect = 1.196e-18
Identity = 51/145 (35.17%), Postives = 78/145 (53.79%), Query Frame = 3
Query:  153 DVNSEVLISVGKAAYQSSDYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVE-GYTPNAKKWNTCGLITS-SQVVSFLWCGGLTANKVRVR-HERKEYMTLCEVQVFSKKVQ 578
            DVN   L  +G+A+  S+    Y A  A+DGN   ++    CSHT ++N ++W +DLK+ Y +  + I NR D   ER+ GA +  G +P+      C  +T  SQ+   L C G+    V V    R EY+ LCEV+V+ K+ +
Sbjct:  167 DVN---LARLGEASQSSTFSPKYNAAAAIDGNKDTNMMAGSCSHTNSDNPAWWQLDLKKRYQVEKVVIVNRGDCCGERLRGAEIRVGDSPDNNN-PVCATVTDVSQLTLTLSCKGIPGRYVSVVIPGRAEYLQLCEVEVYGKEAE 307          

HSP 2 Score: 80.8777 bits (198), Expect = 1.048e-17
Identity = 47/130 (36.15%), Postives = 70/130 (53.85%), Query Frame = 3
Query:  198 QSSDY-LDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLITSSQVVSF-LWCGGLTANKVRVR-HERKEYMTLCEVQVFSKKVQ 578
            QSS Y  +Y A  AVDGN   ++ L  CSHT ++N ++W +DLK+ Y +  + I NR D   ER+ GA V            C  IT    ++F + C G+    V V   +R EY+ LCEV+V+ ++ +
Sbjct:   35 QSSTYRPEYNAATAVDGNKNSNMMLGSCSHTNSDNPAWWQLDLKKRYQVEKVVIVNRGDCCGERLRGAEVRVGNSADNNNPVCATITDVSKLTFPVCCNGMEGRYVSVVISDRAEYLQLCEVEVYGQEAK 164          
BLAST of Fucolectin vs. UniProt/SwissProt
Match: sp|Q9I926|FUCL6_ANGJA (Fucolectin-6 OS=Anguilla japonica OX=7937 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 2.551e-15
Identity = 51/164 (31.10%), Postives = 79/164 (48.17%), Query Frame = 3
Query:  117 MIFLIFYISLLTDVNSEVL-------ISVGKAAYQSS------DYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARV---EGYTPNAKKWNTCGLITSSQVVSFLWCGGLTANKVRVRHERKEYMTLCEVQV 560
            ++F I  IS L  V++ +        ++V   A QS       D   + +N A+DGN         C+HT    N +W +DL QEY +T + I NR D   ERI GAR+   +    N  + +T G++T+ +  +F     +    V V   + EY+ LCEV+V
Sbjct:   17 LLFQILAISTLQSVSAYIPDRYIQENVAVRGKATQSDQLQGQWDAFSHASN-AIDGNQDSYFYHGSCTHTSGGANPWWRVDLLQEYKITSVTITNRGDCCGERITGARIIIGKNNGLNNPECSTVGIMTAGETKTFRCSHPMIGRYVTVYLPKTEYLHLCEVEV 179          
BLAST of Fucolectin vs. UniProt/SwissProt
Match: sp|Q9I927|FUCL5_ANGJA (Fucolectin-5 OS=Anguilla japonica OX=7937 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 2.572e-14
Identity = 50/169 (29.59%), Postives = 77/169 (45.56%), Query Frame = 3
Query:  117 MIFLIFYISLLTDVNSEVL----------ISVGKAAYQSS-----DYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARV------EGYTPNAKKWNTCGLITSSQVVSFLWCGGLTANKVRVRHERKEYMTLCEVQV 560
            MI L+F I  ++ + S+            ++V   A QS+       +     YA+DGN   D     CSHT    N +W +DL Q Y++  + I NR D   ERI GA +      E    N  + +T G++T+ +  +F     +    V V   + EY+ LCEV+V
Sbjct:   14 MIMLLFQILAISTLQSDSAYIPDRYTQENVAVRGKATQSALASGGGAVLSLPGYAIDGNRDSDSSHGSCSHTTNGPNPWWRVDLLQVYTIASVTITNRGDCCGERITGAHILIGNSLENNGINNPQCSTVGIMTAGETRTFHCSRPMIGRYVTVYLPKTEYLQLCEVEV 182          
BLAST of Fucolectin vs. UniProt/SwissProt
Match: sp|Q9I931|FUCL1_ANGJA (Fucolectin-1 OS=Anguilla japonica OX=7937 PE=2 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 2.018e-12
Identity = 38/118 (32.20%), Postives = 55/118 (46.61%), Query Frame = 3
Query:  225 ANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARV------EGYTPNAKKWNTCGLITSSQVVSFLWCGGLTANKVRVRHERKEYMTLCEVQV 560
              +A+DGN   D     CSHT    N +W +DL Q Y++T + I NR D   ERI GAR+      E    N    +  G + + +  +F     +    V V   + E + LCEV+V
Sbjct:   54 PGFAIDGNRDSDFSHGSCSHTTNSPNPWWRVDLLQLYTITSVTITNRGDCCGERISGARILIGNSLENNGINNPACSVIGSMETGETRTFHCPQPMIGRYVTVYLPKTEVLQLCEVEV 171          
BLAST of Fucolectin vs. UniProt/SwissProt
Match: sp|Q9I929|FUCL3_ANGJA (Fucolectin-3 OS=Anguilla japonica OX=7937 PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 2.624e-12
Identity = 49/169 (28.99%), Postives = 79/169 (46.75%), Query Frame = 3
Query:  117 MIFLIFYISLLTDVNSEVL----------ISVGKAAYQSSDYLDYTANYA-----VDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARV------EGYTPNAKKWNTCGLITSSQVVSFLWCGGLTANKVRVRHERKEYMTLCEVQV 560
            MI L+F I  ++ + S+            +++   A QS+      A +A     +DGN   +     CSHT  +N S+W +DLKQ Y++T + I NR D   ERI GAR+      E    N  + +T  ++ + +  +F     +    V V   + E + LCEV+V
Sbjct:    5 MIILLFQILAISTLKSDSADIPEGYIQENVALRGRATQSAQLKGEFAGFAHASNAIDGNRDSNYHHGSCSHTEGDN-SWWRVDLKQVYTITSVTITNRGDCCGERISGARILIGKHLENNGINNPECSTINIMAAGETKTFHCPQPMIGRYVTVYLPKAESLQLCEVEV 172          
BLAST of Fucolectin vs. UniProt/SwissProt
Match: sp|P49263|PXN1_XENLA (Pentraxin fusion protein OS=Xenopus laevis OX=8355 GN=pxn1 PE=2 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 1.072e-9
Identity = 45/139 (32.37%), Postives = 70/139 (50.36%), Query Frame = 3
Query:  192 AYQSSDY-LDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVE-GYTPNAKKWNT--CGLITS---SQVVSFLWCGGLTANKVRVR-HERKEYMTLCEVQVFSKKVQLE 584
             YQSS Y     A   +DG+   +     C HT  + + +W +D+K +  +  +AI NR D   ERI GA +  G +      N+  CG++      + +SF  C  L    V V   +R EY+TLCEVQVF+  ++++
Sbjct:   46 PYQSSYYGQKEQAKRVIDGSLASNYMEGDCCHTEKQMHPWWQLDMKSKMRVHSVAITNRGDCCRERINGAEIRIGNSKKEGGLNSTRCGVVFKMNYEETLSFN-CKELEGRYVTVTIPDRIEYLTLCEVQVFADPLEVD 183          
BLAST of Fucolectin vs. TrEMBL
Match: A0A5G3LE84 (INSC, spindle orientation adaptor protein OS=Xenopus tropicalis OX=8364 GN=insc PE=4 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 4.037e-17
Identity = 49/131 (37.40%), Postives = 70/131 (53.44%), Query Frame = 3
Query:  198 QSSDY-LDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLITS-SQVVSFLWCGGLTANKVRVR-HERKEYMTLCEVQVFSKKVQL 581
            QSSDY   Y A  AVDG    D+ ++ C+HT  +   +W +DLK+ Y +  + I NR D  SER++ A +            C  IT  SQ +  L CGG+    V V    R EY+TLCEV+V+ +K ++
Sbjct:   11 QSSDYEPQYGAETAVDGIIETDISIHPCTHTDEDYGPWWQVDLKKRYKVHTVVIVNRRDCCSERLLEAEIRVGDSEDNDNPICDTITDVSQAIISLSCGGMEGRYVGVVIPGRSEYLTLCEVEVYGEKAEV 141          
BLAST of Fucolectin vs. TrEMBL
Match: A0A1L8G0B8 (Uncharacterized protein OS=Xenopus laevis OX=8355 GN=XELAEV_18032443mg PE=4 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 5.481e-17
Identity = 52/132 (39.39%), Postives = 76/132 (57.58%), Query Frame = 3
Query:  192 AYQSSDYLD-YTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVE-GYTPNAKKWNTCGLITS-SQVVSFLWCGGLTANKVRVRHE-RKEYMTLCEVQVFSKKV 575
            A QSS YL  Y A  A+DGN   D  ++ C+HT  +N ++W +DLK  Y +  + I+NR D  SER++GA +  G +P+      C  IT  SQ    L+C G+    V V    R+E +TLCEV+V+ +K+
Sbjct:  605 AVQSSTYLSIYPAKLAIDGNIQTDFSIHPCTHTNNDNPAWWRLDLKARYEVEFVVIWNRMDEHSERLLGAEIRIGNSPDNTN-PVCDRITDISQFTITLYCKGVEGRYVSVIIPWRQEQLTLCEVEVYGEKL 735          

HSP 2 Score: 78.5666 bits (192), Expect = 2.494e-13
Identity = 51/136 (37.50%), Postives = 69/136 (50.74%), Query Frame = 3
Query:  171 LISVGKAAYQSSDYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLITS-SQVVSFLWCGGLTANKVRVR-HERKEYMTLCEVQVFSKK 572
            L  +G+A  QSSD     A  A+DG    D     CSHT  +N ++W +DLK  Y +  + I NR D+  ER++GA +            C  IT+ SQ    L C G+    V V    RKEY+TLCEV+VF  +
Sbjct:  296 LAKLGEAT-QSSDLDSQGAQLAIDGVKHTDNSQGSCSHTENDNPAWWRLDLKVRYKVETVVIRNRMDSHRERLLGAEIRVGDSVNNNNPICSTITNISQANITLCCNGMEGRYVSVVIPNRKEYLTLCEVEVFGDE 430          

HSP 3 Score: 78.1814 bits (191), Expect = 3.384e-13
Identity = 50/130 (38.46%), Postives = 69/130 (53.08%), Query Frame = 3
Query:  192 AYQSSDYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVE-GYTPNAKKWNTCGLITS-SQVVSFLWCGGLTANKVRVRHERK-EYMTLCEVQVFSKK 572
            A QSS +    A  A+DG    D  LN C+HT  E   +W +DLK+ Y +  + I NR D  SER++GA V  G + +  K   CG +T  S+    L C G+    V V    K +Y+TLCEV+V+  K
Sbjct:   21 ATQSSYWYFMHAGLAIDGINHTDYNLNSCAHTEYEYKPWWRLDLKRRYKIGKVVIVNRMDCCSERLLGAEVRVGNSGDHNKNPICGKVTDVSEATITLCCNGMEGRYVSVVIPGKVQYLTLCEVEVYGYK 150          

HSP 4 Score: 77.0258 bits (188), Expect = 8.454e-13
Identity = 48/144 (33.33%), Postives = 74/144 (51.39%), Query Frame = 3
Query:  159 NSEVLISVGKAAYQSSDYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLITSSQVVSF-LWCGGLTANKVRVR-HERKEYMTLCEVQVF-SKKVQL 581
            N +V ++    A QSSD++D  A  A+DG    +     C+ T   N ++W +DLK +Y +  + I NR D  S+R++GA +            CG IT     S  + C G+    + V    R+EY+TLCEV+V+  +KV L
Sbjct:  153 NKKVNVARLGEATQSSDWVDRGARLAIDGFKNTNYSHGSCAQTEKNNPAWWRLDLKDQYKVVTVLIVNRMDEHSKRLLGAEIHLGNSTDNNNTVCGTITDVSKASITVSCKGILGRYITVVIPGREEYLTLCEVEVYVEQKVNL 296          
BLAST of Fucolectin vs. TrEMBL
Match: A0A1L8G066 (Uncharacterized protein OS=Xenopus laevis OX=8355 GN=XELAEV_18032444mg PE=4 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 1.310e-16
Identity = 51/129 (39.53%), Postives = 76/129 (58.91%), Query Frame = 3
Query:  198 QSSDYLD-YTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVE-GYTPNAKKWNTCGLIT-SSQVVSFLWCGGLTANKVRVR-HERKEYMTLCEVQVFSKK 572
            QSS YL  Y A  AVDG    DL ++ C+HT  +N ++W +DLK+ Y +  + I NR D  SER++GA +  G +P+      CG IT  ++ +  L CGG+    V V    R+EY+ LCEV+V+ ++
Sbjct:  452 QSSTYLSTYPAEAAVDGIKVTDLLIHPCAHTNKDNPAWWQLDLKKRYKVKTVIIVNRMDEHSERLLGAEIRVGNSPDNNN-PVCGTITIGTEAIIILSCGGMEGRYVSVVIPGREEYLQLCEVEVYGEE 579          

HSP 2 Score: 80.8777 bits (198), Expect = 5.165e-14
Identity = 51/132 (38.64%), Postives = 71/132 (53.79%), Query Frame = 3
Query:  189 AAYQSSDYLDY-TANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLITS-SQVVSFLWCGGLTANKVRVR-HERKEYMTLCEVQVFSKKV 575
            A  QSS +L   +A+ A+DG    DL L+ C+HT  +N S+W +DLK  + +  + I  R D   ER++GA V            CG IT  SQ    L C G+    V V    RKEY+TLCEV+V+ +K+
Sbjct:  305 AVKQSSSFLSIQSADTAIDGVKLDDLSLHPCAHTSDDNPSWWRLDLKSRFEVDCVFIVYRMDDKRERLLGAEVRIGDSEDNNNPVCGTITDVSQGTVTLSCKGMEGRYVSVVIPGRKEYLTLCEVEVYGEKL 436          

HSP 3 Score: 73.559 bits (179), Expect = 1.532e-11
Identity = 47/142 (33.10%), Postives = 73/142 (51.41%), Query Frame = 3
Query:  171 LISVGKAAYQSSDY-LDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLITS-SQVVSFLWCGGLTANKVRVR-HERKEYMTLCEVQVFSKKVQLES 587
            L  +GKA  QSSDY  +Y A   +DG       +  CSHT  +  ++W +DL++ Y +  + I NR D  SER++ A +            C  I   S+V   L+C G+    V V    RKE++TLCE++V+ ++   E+
Sbjct:   36 LARLGKAT-QSSDYRPEYVAQTVIDGVKETSPLIRPCSHTNYDKPAWWQVDLRKRYKIETVVIVNREDCCSERLLAAEIRVGDSADNNNPVCDRIMDVSKVTITLFCKGMEGRYVSVVIPGRKEHLTLCELEVYGEESTKET 176          

HSP 4 Score: 63.5438 bits (153), Expect = 3.534e-8
Identity = 42/128 (32.81%), Postives = 65/128 (50.78%), Query Frame = 3
Query:  198 QSSDYLD-YTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLITS-SQVVSFLWCGGLTANKVRVR-HERKEYMTLCEVQVFSKK 572
            QSS Y   Y     VDG       ++ C+ T  +N ++W +DLK+ Y++  + I NR D  SER++GA +            C  IT  SQ    L+C G+    V V    R++Y+ LCEV+V+ ++
Sbjct:  595 QSSTYRQKYRTAATVDGVKRTKSLIHPCTPTKHDNPAWWQLDLKKRYNVQTVLIINRMDEHSERLLGAEIRVGDLANNNNPVCRNITDVSQANITLYCNGMEGRYVSVVIPGRRQYLQLCEVEVYGEE 722          
BLAST of Fucolectin vs. TrEMBL
Match: A0A1L8G077 (Uncharacterized protein OS=Xenopus laevis OX=8355 GN=XELAEV_18032436mg PE=4 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 1.779e-16
Identity = 53/144 (36.81%), Postives = 80/144 (55.56%), Query Frame = 3
Query:  159 NSEVLISVGKAAYQSSDY-LDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLITS-SQVVSFLWCGGLTANKVRVR-HERKEYMTLCEVQVFSKKVQL 581
            N+ V ++      QSS Y   Y A  A+DG T  D+ ++ CSHT  +N ++W +DLK+ Y +  + I NR D  SER++GA +            CG IT+ SQ    L+C GL    V V    R+EY+TLCEV+V+ ++ ++
Sbjct:  468 NATVNLARSGEVRQSSTYDQQYGAEAAIDGFTDTDILVHPCSHTDYDNPAWWQLDLKRRYKVETVVIVNREDCCSERLLGAEIHVGDSTDNNNLICGAITNISQATITLYCKGLEGRYVSVVIPGREEYLTLCEVEVYGEESEI 611          

HSP 2 Score: 87.4261 bits (215), Expect = 2.535e-16
Identity = 51/144 (35.42%), Postives = 79/144 (54.86%), Query Frame = 3
Query:  159 NSEVLISVGKAAYQSSDY-LDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLITS-SQVVSFLWCGGLTANKVRVR-HERKEYMTLCEVQVFSKKVQL 581
            N  V ++     +QSS Y   Y A  A+DG T  D+ ++ C+HT  +N ++W +DLK+ Y +  + I NR D  SER++GA++            CG IT+ SQ    L C G+    V V    R+EY+TLCEV+V+  + ++
Sbjct:  318 NGTVNLARSGEVHQSSTYDQQYGAGAAIDGFTDTDILVHPCTHTDYDNPAWWRLDLKKRYKVETVVIVNREDCCSERLLGAKIRVGDSADNNNPVCGAITNISQASITLVCNGMVGRYVSVVISRREEYLTLCEVEVYGAEAEI 461          

HSP 3 Score: 85.8853 bits (211), Expect = 1.065e-15
Identity = 50/136 (36.76%), Postives = 73/136 (53.68%), Query Frame = 3
Query:  171 LISVGKAAYQSSDYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLITS-SQVVSFLWCGGLTANKVRVR-HERKEYMTLCEVQVFSKK 572
            L   G+    SS    Y+A  A+DG    D+ +  CSHT  +N ++W +DLK+ + +  +AI NR D  SER++GA +            CG +T+ SQ    L+C GL    V V    R EY+TLCEV+VF ++
Sbjct: 1496 LARTGEVTQSSSYESHYSAETAIDGIIETDISIRPCSHTNDDNPAWWRLDLKKVHKVDAVAIVNRMDCCSERLLGAEIRVGNSADNNNPVCGTVTNISQATINLFCYGLEGRFVSVVIPGRAEYLTLCEVEVFGEE 1631          

HSP 4 Score: 85.1149 bits (209), Expect = 1.701e-15
Identity = 50/128 (39.06%), Postives = 69/128 (53.91%), Query Frame = 3
Query:  198 QSSDY-LDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLITS-SQVVSFLWCGGLTANKVRVR-HERKEYMTLCEVQVFSKK 572
            QSS Y   Y+A  A+DG    D+ ++ C+HT  +N S+W +DLK  Y++  + I NR D  SER++GA +            C  IT  SQ    L C GL    V V    R EY+TLCEV+V+ +K
Sbjct: 1792 QSSTYEPHYSAETAIDGIIETDIAIHPCTHTFDDNPSWWRLDLKNIYNVQTVVIVNRMDCCSERLLGAEIRVGNSGDNNNPICATITEVSQATITLSCNGLEGRYVSVVISGRAEYLTLCEVEVYGEK 1919          

HSP 5 Score: 84.7297 bits (208), Expect = 2.355e-15
Identity = 52/132 (39.39%), Postives = 73/132 (55.30%), Query Frame = 3
Query:  198 QSSDY-LDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGA--RVEGYTPNAKKWNTCGLITS-SQVVSFLWCGGLTANKVRVR-HERKEYMTLCEVQVFSKKVQ 578
            QSSDY   Y+A  AVDG    D+ ++ C+HT  +   +W +DLK  Y +  + + NR D  SER++GA  RV   T N      CG +T  SQ +  L C GL    V V    R EY+TLCEV+V+ ++ +
Sbjct: 1935 QSSDYEPQYSAETAVDGVIESDISVHPCTHTSDDYGPWWQVDLKNRYKVNTVVMVNRMDCCSERLLGAEIRVGDLTDNNNP--VCGTVTDVSQAIITLSCRGLEGQYVSVVIPGRSEYLTLCEVEVYGEEAE 2064          

HSP 6 Score: 84.3445 bits (207), Expect = 3.137e-15
Identity = 49/143 (34.27%), Postives = 77/143 (53.85%), Query Frame = 3
Query:  150 TDVNSEVLISVGKAAYQSSDYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLITS-SQVVSFLWCGGLTANKVRVR-HERKEYMTLCEVQVFSKK 572
            TD+ +  L   G     S+    Y+A  A+DG    D+ ++ CSHT ++N ++W +DLK+ Y +  + I NR D  SER++GA++        K   CG I   S+    + C GL    V V    R+EY+TLCEV+V+ ++
Sbjct: 1345 TDIAAVNLARSGDVRQSSTYEPHYSAETAIDGIIETDISIHPCSHTSSDNPAWWRLDLKKIYKVDSVVIVNRMDCCSERLMGAQIHVGDSADNKNPVCGTIFDISKATITILCNGLEGRYVSVVIPGREEYLTLCEVEVYGRE 1487          

HSP 7 Score: 81.6481 bits (200), Expect = 2.520e-14
Identity = 52/140 (37.14%), Postives = 72/140 (51.43%), Query Frame = 3
Query:  198 QSSDY-LDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLITS-SQVVSFLWCGGLTANKVRVR-HERKEYMTLCEVQVF------SKKVQLESF 590
            QSS Y   Y+A  A+DG    D+ +  C+HT  +N ++W +DLK+ Y +  + I NR D  SER++GA +            C  IT  SQ    L+C G+    V V    R EY+TLCEV+V+      SK V L  F
Sbjct: 1648 QSSTYEPHYSAETAIDGIIETDISIRACTHTFDDNPAWWRLDLKKIYKIDSVVIVNRMDCCSERLLGAEIHIGDSADNNNPVCDNITDISQATITLYCNGMEGRYVSVVIPGRSEYLTLCEVEVYGEESNNSKAVNLGRF 1787          

HSP 8 Score: 81.6481 bits (200), Expect = 2.720e-14
Identity = 48/150 (32.00%), Postives = 82/150 (54.67%), Query Frame = 3
Query:  150 TDVNSEVLISVGKAAYQSSDYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLITS-SQVVSFLWCGGLTANKVRVR-HERKEYMTLCEVQVFSKKVQLESFD 593
            T++N   L   G+    S+    + A  AVDG    +  ++ C+HT  +N+++W +DLK+ Y++  + I NR D  SER++GA +   +        CG IT+ SQ +  L C G+    V V    R+EY++LCEV+V+ ++ ++   D
Sbjct:  169 TEIN---LARTGEVTQSSTLEPQFGAEAAVDGIIETNSTVHPCTHTNNDNSAWWRLDLKKTYNVGTVVIANREDCCSERLLGAEIRVGSSRDNNNPVCGAITNISQAIITLSCNGMEGRYVSVVIPGREEYLSLCEVEVYGEESEMHGED 315          

HSP 9 Score: 80.8777 bits (198), Expect = 5.620e-14
Identity = 50/141 (35.46%), Postives = 76/141 (53.90%), Query Frame = 3
Query:  159 NSEVLISVGKAAYQSSDY-LDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLITS-SQVVSFLWCGGLTANKVRVR-HERKEYMTLCEVQVFSKK 572
            N+ V ++      QSS Y   Y A  A+DG T  D+ ++ C+HT  +N ++W ++LK+ Y +  + I NR D  SER++GA +            C  IT+ SQ    L C GL    V V    R+EY+TLCEV+V+ ++
Sbjct: 1059 NATVNLARSGEVRQSSTYDQQYGAGAAIDGFTDTDILVHPCTHTDYDNPAWWRLNLKRRYKVETVVIVNREDCCSERLLGAEIRIGDSTDNNNPVCSTITNISQATITLSCNGLEGRYVSVVIPGREEYLTLCEVEVYGEE 1199          

HSP 10 Score: 78.5666 bits (192), Expect = 2.766e-13
Identity = 48/128 (37.50%), Postives = 69/128 (53.91%), Query Frame = 3
Query:  198 QSSDYLD-YTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLITS-SQVVSFLWCGGLTANKVRVR-HERKEYMTLCEVQVFSKK 572
            QSS Y   Y A  AVD     D+ ++ CSHT  +N ++W +DLK+ Y +  + I NR D  SER+ GA +            CG IT+ +     L C GL  + V V    R+EY+TLCEV+V+ ++
Sbjct: 1216 QSSTYESHYNAETAVDSIKETDISIHPCSHTFNDNPAWWRLDLKKIYRIESVVIVNRGDCCSERLFGAEIRVGDSADNNNPVCGTITNIAHSTITLSCNGLDGHFVSVVIPGREEYLTLCEVEVYGEE 1343          

HSP 11 Score: 77.0258 bits (188), Expect = 1.213e-12
Identity = 43/121 (35.54%), Postives = 66/121 (54.55%), Query Frame = 3
Query:  219 YTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVE-GYTPNAKKWNTCGLITSSQVVSF-LWCGGLTANKVRVR-HERKEYMTLCEVQVFSKK 572
            Y A  AVDG    D+ L+ C+HT  ++ ++W +DLK+ + +  + I NR D  SER++GA +  G +     +  CG I      S  + C G     V V    R+EY+TLCEV+V+ K+
Sbjct:   44 YGAETAVDGIKETDMSLSPCTHTGNDHPAWWQLDLKESFEVQSVVIVNRGDCCSERLLGAEIRVGNSLAELNYTVCGTIDDVSEASLRICCNGTEGQYVSVVIPGREEYLTLCEVEVYGKE 164          
BLAST of Fucolectin vs. TrEMBL
Match: A0A5G3LFH4 (Uncharacterized protein OS=Xenopus tropicalis OX=8364 GN=LOC100127564 PE=4 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 3.671e-16
Identity = 51/134 (38.06%), Postives = 73/134 (54.48%), Query Frame = 3
Query:  198 QSSDY-LDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLIT-SSQVVSFLWCGGLTANKVRVR-HERKEYMTLCEVQVFSKKVQLESF 590
            QSS Y  +Y A  AVDGN   ++ L  CSHT ++N ++W +DLK+ Y +  + I NR D   ER+ GA V            CG IT +SQ    L C G+    V V    R EY+TLCEV+V+ ++ + ++ 
Sbjct:  122 QSSTYRPEYNAATAVDGNKNSNMMLGSCSHTNSDNPAWWQLDLKKRYQVEKVVIVNRGDCCGERLRGAEVRVGNSADNNNPVCGAITDASQATITLPCKGMKGRYVSVVIPGRNEYLTLCEVEVYGQEAKPDAV 255          

HSP 2 Score: 79.7221 bits (195), Expect = 8.061e-14
Identity = 46/138 (33.33%), Postives = 76/138 (55.07%), Query Frame = 3
Query:  171 LISVGKAAYQSSDYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVE-GYTPNAKKWNTCGLITS-SQVVSFLWCGGLTANKVRVR-HERKEYMTLCEVQVFSKKV 575
            L   G+A   S+   +Y A  A+DG+ G ++  + CSHT  +N ++W +DL ++Y++  + I NR D  SER+ GA +  G  P       C  +T  S+    L C G+    + V    R+EY+TLCEV+V+ +++
Sbjct:  258 LAKSGRARQSSTYRPEYNAAAAIDGDKGTNIFQHPCSHTNPDNPAWWQLDLTKKYNIESVVIVNRGDCCSERLRGAEIRVGIFPFINS-PVCDTVTDVSKPTITLNCNGMVGQYISVVIPGRQEYLTLCEVEVYGQEI 394          

HSP 3 Score: 62.003 bits (149), Expect = 1.172e-7
Identity = 36/106 (33.96%), Postives = 56/106 (52.83%), Query Frame = 3
Query:  267 LNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLI-TSSQVVSFLWCGGLTANKVRVR-HERKEYMTLCEVQVFSKKVQ 578
            ++ C+HT  +N ++W +DLK+ Y +  I I NR D  SER++GA +            C  I   SQ    L C GL    V V    R+E ++LCEV+V+ ++ +
Sbjct:    3 VHPCTHTDYDNPAWWQLDLKKRYKVDTIVIVNRGDCCSERLLGAEIRVGDSADNNNPVCDTIKVGSQGTITLCCEGLEGRYVSVVIPGREENLSLCEVEVYGQEAK 108          
BLAST of Fucolectin vs. Ensembl Cavefish
Match: ENSAMXT00000008051.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000995.1:49634:61503:-1 gene:ENSAMXG00000007830.2 transcript:ENSAMXT00000008051.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.7962 bits (190), Expect = 1.803e-16
Identity = 51/136 (37.50%), Postives = 76/136 (55.88%), Query Frame = 3
Query:  192 AYQSSDYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVE-GYTP--NAKKWNTCGLITS---SQVVSFLWCGGLTANKVRVR-HERKEYMTLCEVQVFSKKVQ 578
            A QSS+Y    A  A+DGN   +     C+HT  + + +W +DL++ + ++ I I NR DA+ ER+ GA +  G  P  N  +   CG+I+S   +  V+F  C G+    V +    RKEY+TLCEV+VF   VQ
Sbjct:  479 ASQSSNYGTGCAIKAIDGNRDGNYFSGSCTHTKYDLSPWWKLDLQKTHKVSSITITNRQDAVPERLNGAVIRIGDNPAHNGIQNPKCGVISSIGKNPSVTF-QCNGMKGRYVTIMIPGRKEYLTLCEVEVFGAPVQ 613          

HSP 2 Score: 66.2402 bits (160), Expect = 1.764e-12
Identity = 48/142 (33.80%), Postives = 71/142 (50.00%), Query Frame = 3
Query:  174 ISVGKAAYQSSDYLDYTANY-----AVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVE---GYTPNAKKWNTCGL---ITSSQVVSFLWCGGLTANKVRV-RHERKEYMTLCEVQVF 563
            I+ G  A QSS      A +     A+DG T  +     C+HT  ++N +W +DL +EY++  I I NR D  SERI GA +      + N       G+   IT+ +  SF +  G++   + V    +K  +TLCEVQVF
Sbjct:  323 IAFGGTATQSSFVEQLYATHGDPSKAIDGKTTSEYSQGSCTHTETQDNPWWRLDLLKEYNIYSITITNRGDCCSERINGAEIRVGNSLSNNGNDNPRVGVISSITAGKSKSFHFKEGVSGRYLNVIIPGKKRILTLCEVQVF 464          

HSP 3 Score: 62.003 bits (149), Expect = 4.798e-11
Identity = 40/117 (34.19%), Postives = 62/117 (52.99%), Query Frame = 3
Query:  234 AVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGA--RVEGYTPNAKKWNT-CGLITS---SQVVSFLWCGGLTANKVRV-RHERKEYMTLCEVQVF 563
            A+DG T  +     C+HT  ++N +W +DL+ EY +T + + NR D  SER+ GA  R+     N    N   G+I+S    +  +F    G++   V V    +K  +TLCEV+VF
Sbjct:   51 AIDGKTTSEYSQGSCTHTETQDNPWWRLDLQDEYIVTSVTVTNRGDCCSERLNGAEIRIGNSLSNDGNSNPRVGVISSISAGKSQTFTLNQGVSGRYVNVIIPGKKRILTLCEVEVF 167          

HSP 4 Score: 57.7658 bits (138), Expect = 1.417e-9
Identity = 44/146 (30.14%), Postives = 66/146 (45.21%), Query Frame = 3
Query:  171 LISVGKAAYQSSDYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLITSSQVVSFLWCGGLTANKVRVRHERKE---------------YMTLCEVQVF 563
            L   GKA  QSS   D   + A+D N   +     C+HT+ + N +W +DL  E+++T I I NR D  + R+ GA +  +  N+   N  G      + S      + A K +  H +KE                +TLCEV+VF
Sbjct:  177 LAPRGKAT-QSSLAFDGHPSKAIDKNKDTNYHQGSCTHTVIQQNPWWRVDLLDEFTITSIVITNRGDCCAGRLEGAEI--HVGNSLINNGNGNPRVEVIKS------IPAGKSQTFHLKKEVSGRYVNLIIPGSNQILTLCEVEVF 313          
BLAST of Fucolectin vs. Ensembl Cavefish
Match: ENSAMXT00000050908.1 (pep primary_assembly:Astyanax_mexicanus-2.0:2:30949256:30953032:-1 gene:ENSAMXG00000032389.1 transcript:ENSAMXT00000050908.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.0998 bits (183), Expect = 5.839e-16
Identity = 45/138 (32.61%), Postives = 69/138 (50.00%), Query Frame = 3
Query:  174 ISVGKAAYQSSDYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYT--PNAKKWNTCGLITSSQVVSFLWCGGLTANKVRVRHERKEYMTLCEVQVFSKKVQL 581
            I++G  A QSS Y    A  AVDGN+  +     CSHT  E + +W ++L   Y++T + I NR D   +RI+GA ++ +T     +K  +    T  Q V+    G             ++ +TLCEVQVFS  + +
Sbjct:   21 IAIGARAVQSSTYDSGHAQNAVDGNSNANYWKGSCSHTSYETDPWWRLELPAVYNITSVTIVNRGDCCGKRIIGAEIQAFTLLEKNQKNKSIRKTTEGQFVNIFLPGS------------RKILTLCEVQVFSDNIAV 146          

HSP 2 Score: 72.4034 bits (176), Expect = 6.227e-15
Identity = 60/170 (35.29%), Postives = 82/170 (48.24%), Query Frame = 3
Query:  111 FDMIFLIFYISLLTDVNSEVL---ISVGKAAYQSSDYLDY-TANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLI-----TSSQVV---SFLWCGGLTANKVRVRHERKEYMTLCEVQVFSKKVQLE 584
            F  IFL     +LT    +V    I+VG  A QSS         YAVDGNT  D     CSHTL E N +W ++L    ++T + I NR D  S+RI GA++        K N   L+     T S++     F    G   N + +  E K  ++LCEV+VF+ K +LE
Sbjct:  120 FVNIFLPGSRKILTLCEVQVFSDNIAVGAKAVQSSTTPTLGNPEYAVDGNTDTDSRRGSCSHTLTEANPWWRVELPGVCNVTSVTIVNREDCCSDRIKGAQIHIGNSLKNKGNDNKLVAVIGPTLSEITMTYKFKATRGRFVN-IFLPGEDK-ILSLCEVKVFTGKKELE 287          
BLAST of Fucolectin vs. Ensembl Cavefish
Match: ENSAMXT00000051649.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001233.1:37316:47749:1 gene:ENSAMXG00000029862.1 transcript:ENSAMXT00000051649.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.0998 bits (183), Expect = 1.204e-15
Identity = 54/154 (35.06%), Postives = 85/154 (55.19%), Query Frame = 3
Query:  117 MIFLIFYISLLTDVNSEVLISVGKAAYQSSDYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVE-GYTP--NAKKWNTCGLITS---SQVVSFLWCGGLTANKVR-VRHERKEYMTLCEVQ 557
            M F +F  S L    SE  +++   A QSS++ D  A  A+DGN   +     C+HT ++ + +W +DL++ + ++ I I NR DA+ ER+ GA +  G  P  N  +   CG+I+S   +  V+F  C G+    V  V   RKE++TLCEV+
Sbjct:    1 MDFPVF--SFLFCWCSEENVALKGFASQSSNFDDGYAIKAIDGNRDGNYFCGSCTHTKSDLSPWWKLDLQKTHKVSSITITNRQDAVPERLNGAEIRIGDNPAHNGIQNPRCGVISSIGKNPSVTFQ-CNGMKGRYVTIVNSGRKEFLTLCEVE 151          

HSP 2 Score: 57.7658 bits (138), Expect = 1.007e-9
Identity = 50/155 (32.26%), Postives = 77/155 (49.68%), Query Frame = 3
Query:  126 LIFYISLLTDVNSEVLISVGKAAYQSSDYLDYT------ANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLITSSQVVS--FLWCGGLTANKVRV-RHERKEYMTLCEVQVF 563
            ++ +I+L+ +V     +++   A QS D ++Y       A  A+DGNT  +     CS T  + N +W +DL  EY++T I I NR D+ SE I GA V  +  N+       LI +    S  F W  G++   V V     K  + LCEV+V+
Sbjct:  153 ILDFITLVDEVAPGQNLALRGKATQS-DLVEYPYTGHGHAYNAIDGNTDPNYYHGSCSSTDWQQNPWWRVDLLDEYTITSIVITNRGDSCSELINGAEV--HVGNS-------LINNGNRRSHTFTWDKGVSGRYVNVIIPGNKRMLILCEVEVY 297          

HSP 3 Score: 47.7506 bits (112), Expect = 2.692e-6
Identity = 42/135 (31.11%), Postives = 63/135 (46.67%), Query Frame = 3
Query:  177 SVGKAAYQSSDYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARV---EGYTPNAKKWNTCGLI--TSSQVVSFLWCGGLTANKVRVR-HERKEYMTLCEVQVF 563
            +V   A QSS Y  + A+ A+DGN         CS T  + + +W +DL + +           D  + R+ GA +   +    N      CG+I  T S  V+F  C G+    V V    R+EY+TLCEV+V+
Sbjct:  308 AVQGTATQSSLYGYFLASGAIDGNRN---GPGSCSFTNYDLSPWWRVDLLKRHK----------DVYASRLKGAEIRIGDNLEDNGNNNPRCGVIESTGSPTVTFQ-CNGMEGRYVNVVISGRREYLTLCEVEVY 428          
BLAST of Fucolectin vs. Ensembl Cavefish
Match: ENSAMXT00000058044.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000247.1:335638:339087:-1 gene:ENSAMXG00000031034.1 transcript:ENSAMXT00000058044.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 1.388e-12
Identity = 40/107 (37.38%), Postives = 63/107 (58.88%), Query Frame = 3
Query:  117 MIFLIFYISLLT-----DVNSEVLISVGKAAYQS---SDY--LDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVE 407
            +I+L+  I++ T     D+  + L   GKA   S   + Y  L + +N A+DGNT  + E   CSHT ++ N +W +DL +EY++T I I NR D +SER+ GA++ 
Sbjct:    5 VIYLLGVITIATFTNTADLKVKNLALYGKACQSSLVENPYAPLGHPSN-AIDGNTDANFERGSCSHTASQQNPWWRVDLLEEYTITSITITNR-DYLSERLNGAKIH 109          
BLAST of Fucolectin vs. Ensembl Cavefish
Match: ENSAMXT00000053324.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001233.1:37313:45265:1 gene:ENSAMXG00000029862.1 transcript:ENSAMXT00000053324.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 1.447e-12
Identity = 52/166 (31.33%), Postives = 75/166 (45.18%), Query Frame = 3
Query:  111 FDMIFLIFYISLLTDVNSEVLISVGKAAYQSSDYLDYT------ANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVE-------GYTPNAKKWNTCGLITSSQVVSFLWCGGLTANKVRV-RHERKEYMTLCEVQVFS 566
            F +   +FY+S     + + L   GKA    SD ++Y       A  A+DGNT  +     CS T  + N +W +DL  EY++T I I NR D+ SE I GA V            N + W     I   +  +F W  G++   V V     K  + LCEV+V+ 
Sbjct:    4 FPVFSFLFYMSKCGPASWQNLALRGKAT--QSDLVEYPYTGHGHAYNAIDGNTDPNYYHGSCSSTDWQQNPWWRVDLLDEYTITSIVITNRGDSCSELINGAEVHVGNSLINNGNSNLRVW-VITSIPPGRSHTFTWDKGVSGRYVNVIIPGNKRMLILCEVEVYG 166          
BLAST of Fucolectin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008255.1 (pep scaffold:Pmarinus_7.0:GL478865:24920:31349:1 gene:ENSPMAG00000007470.1 transcript:ENSPMAT00000008255.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.595 bits (109), Expect = 3.887e-7
Identity = 36/134 (26.87%), Postives = 60/134 (44.78%), Query Frame = 3
Query:  171 LISVGKAAYQSSDYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVE-GYTPNAKKWNTCG---LITSSQVVSFLWCGGLTANKVRVRHERKEYMTLCEVQV 560
            ++  G+A   S+   D+ A+ A+DG  G +     CS T  E   ++ I L   Y++  ++I NR D    R+ G  ++ G   N  K   C     +T  Q V F     L      V   R + ++LC+V++
Sbjct:    1 IVVYGEAMQSSTAGPDHNASKAIDGTNGTNFCSGMCSATSYEWEPWFCITLDDVYTVDAVSITNRDDTEGIRLFGVHIKVGEWSNHSKNALCAGDIFVTPGQSVRFPCQSQLGRYVFIVIPGRMDSLSLCQVKL 134          
BLAST of Fucolectin vs. Ensembl Nematostella
Match: EDO42729 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0H4])

HSP 1 Score: 52.373 bits (124), Expect = 1.754e-8
Identity = 45/147 (30.61%), Postives = 72/147 (48.98%), Query Frame = 3
Query:  153 DVNSEVLISVGKAAYQSSDYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARV---EGYTPNAKKWNTCGLITSSQVVSFL--WCGGLTANK---VRVRHERKEYMTLCEVQVFSK 569
            +VN    +++ K+  QS+   +  A+ AVDGNT    E + C+HT  E N +W +DL     +  + + NR    SER+  A +   +  T N      CG + S   +  L  +C    A +   VR+   R   +TLCEV+V+S+
Sbjct:   93 NVNPNANLALSKSTAQSAVSNNGVASRAVDGNTDGKWEHSSCTHTPFEANPWWRVDLGTTKPVFEVFLVNRL--TSERLHNAEIRVGDDLTDNGNANPRCGDMFSLAGLHKLSIYCKPRRAGRYVNVRLVGSRV-ILTLCEVEVYSE 236          
BLAST of Fucolectin vs. Ensembl Nematostella
Match: EDO40750 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6H5])

HSP 1 Score: 47.3654 bits (111), Expect = 3.474e-7
Identity = 25/78 (32.05%), Postives = 41/78 (52.56%), Query Frame = 3
Query:  171 LISVGKAAYQSSDYL-----DYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERI 389
            ++++ K   QSS Y      D  +N+AVDGN   +     CS T A+ N +W +DL++ +    + + NR D   ER+
Sbjct:    1 MVAIWKPTVQSSTYRSDSKGDGLSNHAVDGNRSGNYYQKSCSSTTAQTNPWWRVDLQKSHVNLRLFVVNRADCCGERL 78          
BLAST of Fucolectin vs. Ensembl Nematostella
Match: EDO35302 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLU7])

HSP 1 Score: 48.1358 bits (113), Expect = 5.751e-7
Identity = 43/147 (29.25%), Postives = 69/147 (46.94%), Query Frame = 3
Query:  144 LLTDVNSEVLISVGKAAYQSSDYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARV---EGYTPNAKKWNTCGLITSSQVVSFL--WCGGLTANK-VRVRHERKEY-MTLCEVQVF 563
            ++ + N  V +++ K   Q S Y    A+ AVDGNT        C+HT A  N +W +DL     ++ + + NR    S+R+  A V   +  T N+     CG + S   +  L  +C    + + V VR       +TLCEV+V+
Sbjct:  117 VMVNRNPTVNLALKKPTTQISLYGAGYASRAVDGNTDGIFSRGSCTHTNAHTNPWWRVDLGTTQPVSEVFLVNRV-TDSQRLQNAEVRVGDSLTDNSNTNPRCGDMFSMATLQKLSIYCKPRRSGRYVNVRLVGANMVLTLCEVEVY 262          
BLAST of Fucolectin vs. Ensembl Nematostella
Match: EDO35325 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLV7])

HSP 1 Score: 47.3654 bits (111), Expect = 1.100e-6
Identity = 41/147 (27.89%), Postives = 69/147 (46.94%), Query Frame = 3
Query:  144 LLTDVNSEVLISVGKAAYQSSDYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARV---EGYTPNAKKWNTCGLITSSQVVSFL--WCGGLTANK-VRVRHERKEY-MTLCEVQVF 563
            ++ ++N    +++ K+  QS+      A+ AVDGNT  D     C+HT  + N +W +DL     ++ + + NR    SE +  A V   +  T N      CG + S   +  L  +C    + + V VR       +TLCEV+V+
Sbjct:  135 VMVNLNPSANLALSKSTAQSTTDHSGDASRAVDGNTDGDYGRGSCTHTQDQPNPWWRVDLGITQPVSEVFLVNRASG-SEILQNAEVRVGDDLTDNGNTNPLCGDMFSMATLQKLSIYCKPRRSGRYVNVRLVGASMVLTLCEVEVY 280          
BLAST of Fucolectin vs. Ensembl Nematostella
Match: EDO42402 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1P6])

HSP 1 Score: 44.669 bits (104), Expect = 2.219e-6
Identity = 36/129 (27.91%), Postives = 53/129 (41.09%), Query Frame = 3
Query:  225 ANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNR---------YDAMSE-RIVGARVEGYTPNAKKWNTCG---LITSSQVVSFLWCGGLTANKVRVRHERKEYMTLCEVQVFSKK 572
            A  AVDG+   D   N C+HT    + +W +DL     +  + I NR         +D   E RI      G   N K    CG    I  ++V S ++C      +          +TLCEV+V++ K
Sbjct:    1 ATRAVDGDPNPDYPANTCTHTKGMTDPWWRVDLGSSQPIAEVVITNRDGTYGTQRLWDKTFELRIGEDGTRGGVSNPK----CGDVYAIPDARVRS-IYCIPAMPGRYLTIKSNVPLLTLCEVEVYTTK 124          
BLAST of Fucolectin vs. Planmine SMEST
Match: SMESG000014402.1 (SMESG000014402.1)

HSP 1 Score: 270.396 bits (690), Expect = 2.490e-91
Identity = 134/148 (90.54%), Postives = 134/148 (90.54%), Query Frame = 3
Query:  156 VNSEVLISVGKAAYQSSDYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLITSSQVVSFLWCGGLTANKVRVRHERKEYMTLCEVQVFSKKVQLESFDGF 599
            VNSEVLISVGKAAYQSSDYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLITSSQ              VRVRHERKEYMTLCEVQVFSKKVQLESFDGF
Sbjct:  179 VNSEVLISVGKAAYQSSDYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLITSSQ--------------VRVRHERKEYMTLCEVQVFSKKVQLESFDGF 312          
BLAST of Fucolectin vs. Planmine SMEST
Match: SMESG000014445.1 (SMESG000014445.1)

HSP 1 Score: 147.132 bits (370), Expect = 4.544e-45
Identity = 71/149 (47.65%), Postives = 97/149 (65.10%), Query Frame = 3
Query:  117 MIFLIFYISLLTDVNSEVLISVGKAAYQSSDYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLITSSQVVSFLWCGGLTANKVRVRHERKEYMTLCEVQVF 563
            M+FLI Y+SL +D N +V++S GK A QSSDYL + A+YAVDGN G  L  +KCSHT  ++  +WM+DL+  Y++T + I+NR   +S R+VGA VE    N    + CG I +   V  L C     +KVR+R  R EY+TLCEVQV+
Sbjct:    1 MLFLILYLSLTSDANCDVMLSQGKPASQSSDYLSFVASYAVDGNLGQSLNKDKCSHTNKDSQPWWMVDLQGSYTITSVTIFNRNSFVSNRLVGAIVEVLDSNGVVVSRCGKIKTDDSVHILRCKKRIGSKVRIRMARPEYLTLCEVQVY 149          
BLAST of Fucolectin vs. Planmine SMEST
Match: SMESG000014428.1 (SMESG000014428.1)

HSP 1 Score: 143.28 bits (360), Expect = 1.589e-43
Identity = 70/149 (46.98%), Postives = 97/149 (65.10%), Query Frame = 3
Query:  117 MIFLIFYISLLTDVNSEVLISVGKAAYQSSDYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLITSSQVVSFLWCGGLTANKVRVRHERKEYMTLCEVQVF 563
            M+FLI Y+SL + VN +V++S GK A QSSDYL + A+YAVDGN G  L  +KCSHT  ++  +WM+DL+  Y++T + I+NR   +S R+VGA VE    N    + CG + +   V  L C     +KVR+R  R EY+TLCEVQV+
Sbjct:    1 MLFLILYLSLTSYVNCDVMLSQGKPASQSSDYLSFVASYAVDGNVGQSLNKDKCSHTNKDSQPWWMVDLQGSYAITSVIIFNRNSFVSNRLVGAIVEVLDSNGLVVSRCGEVKTDDSVHLLHCQKSRGSKVRIRMTRPEYLTLCEVQVY 149          
BLAST of Fucolectin vs. Planmine SMEST
Match: SMESG000014421.1 (SMESG000014421.1)

HSP 1 Score: 144.05 bits (362), Expect = 1.832e-43
Identity = 72/155 (46.45%), Postives = 100/155 (64.52%), Query Frame = 3
Query:  111 FDMIFLIFYISLLTDVNSEVLISVGKAAYQSSDYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLITSSQVVSFLWCG---GLTANKVRVRHERKEYMTLCEVQVFS 566
            F MIF+I Y+ L T+VN E L S G+ +YQSS   +Y A  AVDGN G +L  + CS T  EN  +WM++L+ E  ++M+ I+NR D   +RIVGA V+      K   TCG+IT    +S +WC    G+  +KVR+R ER+EY+TLCEV+V+S
Sbjct:   20 FSMIFIILYVFLFTNVNCEELWSEGRPSYQSSQVGNYMAKLAVDGNHGQNLLKDGCSQTSNENRPWWMVNLENEIRISMVMIFNRVDDYQDRIVGAIVDVLDKENKFVGTCGIITKYDPISLMWCNNGTGILGSKVRIRMERQEYLTLCEVKVYS 174          
BLAST of Fucolectin vs. Planmine SMEST
Match: SMESG000014441.1 (SMESG000014441.1)

HSP 1 Score: 132.88 bits (333), Expect = 1.803e-39
Identity = 68/142 (47.89%), Postives = 92/142 (64.79%), Query Frame = 3
Query:  150 TDVNSEVLISVGKAAYQSSDYLDYTANYAVDGNTGVDLELNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYTPNAKKWNTCGLITSSQVVSFLWC---GGLTANKVRVRHERKEYMTLCEVQVFS 566
            T++  E+L+S GK AYQSS Y DY A YAVDGN G  LE +KCS T  +N  +WM++L  E  +T++ I+NR D  SERI GA VE    N +    CG++ +   V  LWC    G+  +KVRV+ ER+EY+TLCEV+V+ 
Sbjct:   12 TNIYCELLLSRGKPAYQSSVYEDYHAGYAVDGNNGQHLEKHKCSQTSNDNRPWWMVNLTVEAKITLVTIFNRQDQFSERIEGAVVEVLDKNDEVTGLCGIVMADNSVINLWCNQRAGIFGSKVRVKLERQEYLTLCEVEVYG 153          
The following BLAST results are available for this feature:
BLAST of Fucolectin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fucolectin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fucolectin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fucolectin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-359m17.26.365e-1433.33si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-... [more]
si:ch73-359m17.25.831e-1334.46si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-... [more]
si:ch73-359m17.22.879e-1234.46si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-... [more]
zgc:1714241.317e-1028.66zgc:171424 [Source:ZFIN;Acc:ZDB-GENE-080204-26][more]
si:cabz01040626.22.087e-1029.68si:cabz01040626.2 [Source:ZFIN;Acc:ZDB-GENE-160113... [more]
back to top
BLAST of Fucolectin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
insc2.571e-2037.40INSC, spindle orientation adaptor protein [Source:... [more]
fucolectin2.338e-1938.06x-epilectin [Source:NCBI gene;Acc:100144955][more]
ENSXETT00000034809.12.764e-1936.92pep primary_assembly:Xenopus_tropicalis_v9.1:6:133... [more]
fucolectin1.138e-1835.17x-epilectin [Source:NCBI gene;Acc:100144955][more]
fucolectin1.196e-1835.17x-epilectin [Source:NCBI gene;Acc:100144955][more]
back to top
BLAST of Fucolectin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fucolectin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9I926|FUCL6_ANGJA2.551e-1531.10Fucolectin-6 OS=Anguilla japonica OX=7937 PE=2 SV=... [more]
sp|Q9I927|FUCL5_ANGJA2.572e-1429.59Fucolectin-5 OS=Anguilla japonica OX=7937 PE=2 SV=... [more]
sp|Q9I931|FUCL1_ANGJA2.018e-1232.20Fucolectin-1 OS=Anguilla japonica OX=7937 PE=2 SV=... [more]
sp|Q9I929|FUCL3_ANGJA2.624e-1228.99Fucolectin-3 OS=Anguilla japonica OX=7937 PE=2 SV=... [more]
sp|P49263|PXN1_XENLA1.072e-932.37Pentraxin fusion protein OS=Xenopus laevis OX=8355... [more]
back to top
BLAST of Fucolectin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5G3LE844.037e-1737.40INSC, spindle orientation adaptor protein OS=Xenop... [more]
A0A1L8G0B85.481e-1739.39Uncharacterized protein OS=Xenopus laevis OX=8355 ... [more]
A0A1L8G0661.310e-1639.53Uncharacterized protein OS=Xenopus laevis OX=8355 ... [more]
A0A1L8G0771.779e-1636.81Uncharacterized protein OS=Xenopus laevis OX=8355 ... [more]
A0A5G3LFH43.671e-1638.06Uncharacterized protein OS=Xenopus tropicalis OX=8... [more]
back to top
BLAST of Fucolectin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000008051.21.803e-1637.50pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000050908.15.839e-1632.61pep primary_assembly:Astyanax_mexicanus-2.0:2:3094... [more]
ENSAMXT00000051649.11.204e-1535.06pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000058044.11.388e-1237.38pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000053324.11.447e-1231.33pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Fucolectin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000008255.13.887e-726.87pep scaffold:Pmarinus_7.0:GL478865:24920:31349:1 g... [more]
back to top
BLAST of Fucolectin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fucolectin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO427291.754e-830.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407503.474e-732.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353025.751e-729.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353251.100e-627.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424022.219e-627.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Fucolectin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fucolectin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014402.12.490e-9190.54SMESG000014402.1[more]
SMESG000014445.14.544e-4547.65SMESG000014445.1[more]
SMESG000014428.11.589e-4346.98SMESG000014428.1[more]
SMESG000014421.11.832e-4346.45SMESG000014421.1[more]
SMESG000014441.11.803e-3947.89SMESG000014441.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013992 ID=SMED30013992|Name=Fucolectin|organism=Schmidtea mediterranea sexual|type=transcript|length=622bp
CTTGAAATCTAGGTAGAAAATACAGAAAAAGGAAGAAATTTGAATAAATA
GTTAAAGGATATGTGGAAAGATTAATAATTTATAAATTGTCTTACTTTTC
CATTCAATAATTTGACATGATCTTTTTGATTTTTTATATTTCCCTTCTTA
CAGATGTCAACAGTGAAGTTCTAATATCGGTGGGAAAGGCTGCCTATCAG
TCGAGTGATTATCTAGATTATACAGCAAATTACGCAGTCGACGGAAACAC
AGGAGTTGATCTTGAACTCAACAAGTGCAGCCATACGCTAGCCGAGAATA
ATTCGTATTGGATGATTGACTTGAAACAGGAGTATTCGCTCACTATGATA
GCCATATATAACCGATATGATGCCATGAGTGAAAGAATAGTTGGAGCACG
TGTTGAAGGTTACACCCCCAATGCAAAAAAGTGGAACACTTGTGGATTGA
TAACTAGTAGTCAGGTAGTTTCGTTTTTGTGGTGCGGGGGGTTAACAGCA
AATAAGGTAAGAGTACGCCATGAAAGAAAGGAATACATGACACTCTGCGA
AGTTCAAGTTTTTTCAAAAAAGGTACAACTGGAAAGTTTTGATGGATTTT
AAAATAAAATTGAATATTTGAA
back to top

protein sequence of SMED30013992-orf-1

>SMED30013992-orf-1 ID=SMED30013992-orf-1|Name=SMED30013992-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=162bp
MIFLIFYISLLTDVNSEVLISVGKAAYQSSDYLDYTANYAVDGNTGVDLE
LNKCSHTLAENNSYWMIDLKQEYSLTMIAIYNRYDAMSERIVGARVEGYT
PNAKKWNTCGLITSSQVVSFLWCGGLTANKVRVRHERKEYMTLCEVQVFS
KKVQLESFDGF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005576extracellular region
GO:0005615extracellular space
Vocabulary: INTERPRO
TermDefinition
IPR006585FTP1
IPR000421FA58C
IPR008979Galactose-bd-like_sf
Vocabulary: biological process
TermDefinition
GO:0001868regulation of complement activation, lectin pathway
GO:0010185regulation of cellular defense response
GO:0045088regulation of innate immune response
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0030246carbohydrate binding
GO:0042806fucose binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006585Fucolectin tachylectin-4 pentraxin-1SMARTSM00607ftpcoord: 17..156
e-value: 3.0E-7
score: 40.1
IPR008979Galactose-binding-like domain superfamilyGENE3DG3DSA:2.60.120.260coord: 15..154
e-value: 4.1E-30
score: 106.6
IPR008979Galactose-binding-like domain superfamilySUPERFAMILYSSF49785Galactose-binding domain-likecoord: 20..152
IPR000421Coagulation factor 5/8 C-terminal domainPFAMPF00754F5_F8_type_Ccoord: 28..133
e-value: 2.3E-7
score: 31.0
NoneNo IPR availablePANTHERPTHR45713FAMILY NOT NAMEDcoord: 16..152
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.71