Innexin

Overview
NameInnexin
Smed IDSMED30013987
Length (bp)1611
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Innexin (SMED30013987) t-SNE clustered cells

Violin plots show distribution of expression levels for Innexin (SMED30013987) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Innexin (SMED30013987) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Innexin (SMED30013987) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013987

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30013987h1SMcG0007482 SmedASXL_010729SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30013987h1SMcG0007482 Contig40833newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30013987h1SMcG0007482 Contig40833uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Innexin vs. Ensembl Celegans
Match: inx-18 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q8MXG8])

HSP 1 Score: 109.768 bits (273), Expect = 1.258e-25
Identity = 90/381 (23.62%), Postives = 177/381 (46.46%), Query Frame = 2
Query:  185 EDGIDRVFHKYSIALILIFSGFIINQYLVNNSINCFAPITIGDEKLFNAYLNQYCWVNMRSSKFSLSHLNPDNSLNRLTSSQSPSVSYYYWMPFILFLQALIIWLPSQFWDYICRRS--TGRDFIELINKAAKVADKNDPKDVEILHKEFKQILLENKTAESNDKIAGKLRAMFKMR---GKKLSVCYSLIMMTYFAIAIGENLLMMRIFGYENPKQYFIGIWGAVTSGQFTTESPQFPRMIYARIPDF-LALGGNVD-MIAKCILPMNMVIEKGVIILSMWFTFVTVLQVWKFISWICCHIIEGGRRNFVMKLLRLPTDKDNENRNRIIDDFIESFLQTDGVFVLGMLXXXXXXXXXXXXAKQMYIFYRKQAIRPMLRNE 1306
            +D +DR+ + Y+  ++L+F+  +  +  V + I CF P      +    Y   YCWV   +       L P    +RL   +   + YY W+PF+L + AL   +PS  W  +  +S       ++L+     V      K V+I+ +     L+  +   +  + +  + A+FK+    G  +S  Y  I   + A  I + +L+       +   +   +   +  G+   +S +FPR+    + DF + + GNV     +C+L +NM+ EK  I L +W T + ++     I W    +    R +FV K L + +D+        I  F+  FL+ DGVF+L M++  S   ++ +V +Q+++ + +++ +P++ ++
Sbjct:   25 DDFVDRLHYLYTSTMVLMFAVLVSAKQYVGHPIECFVPAQF--TRAMEQYTENYCWVQ-NTYWVPFQDLIP----HRLDDRERRQIGYYQWVPFVLAVAALTFHIPSSVWRMLAGQSGLNAGLVLQLVCGDENVDPVVRDKTVDIVARHIDDALMYQRDHGAR-RHSVYIFAIFKLGKFYGAYVSSVYIFIKALHLANVILQFMLLNSFLQTSDYPMFGAHVLYDLFMGREWRDSGKFPRVT---LCDFEIRVLGNVHRHTVQCVLVINMLTEKIFIFLWLWLTVLAIVTALNLIFWFIALVSNSCREHFVSKHLDIQSDQ--------ISRFVHRFLRADGVFLLQMIASHSGNLMAAKVTEQLWMIFVRRSGKPVIEDK 386          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-18 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q8MXG8])

HSP 1 Score: 109.383 bits (272), Expect = 1.483e-25
Identity = 90/381 (23.62%), Postives = 177/381 (46.46%), Query Frame = 2
Query:  185 EDGIDRVFHKYSIALILIFSGFIINQYLVNNSINCFAPITIGDEKLFNAYLNQYCWVNMRSSKFSLSHLNPDNSLNRLTSSQSPSVSYYYWMPFILFLQALIIWLPSQFWDYICRRS--TGRDFIELINKAAKVADKNDPKDVEILHKEFKQILLENKTAESNDKIAGKLRAMFKM---RGKKLSVCYSLIMMTYFAIAIGENLLMMRIFGYENPKQYFIGIWGAVTSGQFTTESPQFPRMIYARIPDF-LALGGNVD-MIAKCILPMNMVIEKGVIILSMWFTFVTVLQVWKFISWICCHIIEGGRRNFVMKLLRLPTDKDNENRNRIIDDFIESFLQTDGVFVLGMLXXXXXXXXXXXXAKQMYIFYRKQAIRPMLRNE 1306
            +D +DR+ + Y+  ++L+F+  +  +  V + I CF P      +    Y   YCWV   +       L P    +RL   +   + YY W+PF+L + AL   +PS  W  +  +S       ++L+     V      K V+I+ +     L+  +   +  + +  + A+FK+    G  +S  Y  I   + A  I + +L+       +   +   +   +  G+   +S +FPR+    + DF + + GNV     +C+L +NM+ EK  I L +W T + ++     I W    +    R +FV K L + +D+        I  F+  FL+ DGVF+L M++  S   ++ +V +Q+++ + +++ +P++ ++
Sbjct:   25 DDFVDRLHYLYTSTMVLMFAVLVSAKQYVGHPIECFVPAQF--TRAMEQYTENYCWVQ-NTYWVPFQDLIP----HRLDDRERRQIGYYQWVPFVLAVAALTFHIPSSVWRMLAGQSGLNAGLVLQLVCGDENVDPVVRDKTVDIVARHIDDALMYQRDHGAR-RHSVYIFAIFKLGKFYGAYVSSVYIFIKALHLANVILQFMLLNSFLQTSDYPMFGAHVLYDLFMGREWRDSGKFPRVT---LCDFEIRVLGNVHRHTVQCVLVINMLTEKIFIFLWLWLTVLAIVTALNLIFWFIALVSNSCREHFVSKHLDIQSDQ--------ISRFVHRFLRADGVFLLQMIASHSGNLMAAKVTEQLWMIFVRRSGKPVIEDK 386          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-18 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q8MXG8])

HSP 1 Score: 109.383 bits (272), Expect = 1.483e-25
Identity = 90/381 (23.62%), Postives = 177/381 (46.46%), Query Frame = 2
Query:  185 EDGIDRVFHKYSIALILIFSGFIINQYLVNNSINCFAPITIGDEKLFNAYLNQYCWVNMRSSKFSLSHLNPDNSLNRLTSSQSPSVSYYYWMPFILFLQALIIWLPSQFWDYICRRS--TGRDFIELINKAAKVADKNDPKDVEILHKEFKQILLENKTAESNDKIAGKLRAMFKM---RGKKLSVCYSLIMMTYFAIAIGENLLMMRIFGYENPKQYFIGIWGAVTSGQFTTESPQFPRMIYARIPDF-LALGGNVD-MIAKCILPMNMVIEKGVIILSMWFTFVTVLQVWKFISWICCHIIEGGRRNFVMKLLRLPTDKDNENRNRIIDDFIESFLQTDGVFVLGMLXXXXXXXXXXXXAKQMYIFYRKQAIRPMLRNE 1306
            +D +DR+ + Y+  ++L+F+  +  +  V + I CF P      +    Y   YCWV   +       L P    +RL   +   + YY W+PF+L + AL   +PS  W  +  +S       ++L+     V      K V+I+ +     L+  +   +  + +  + A+FK+    G  +S  Y  I   + A  I + +L+       +   +   +   +  G+   +S +FPR+    + DF + + GNV     +C+L +NM+ EK  I L +W T + ++     I W    +    R +FV K L + +D+        I  F+  FL+ DGVF+L M++  S   ++ +V +Q+++ + +++ +P++ ++
Sbjct:   25 DDFVDRLHYLYTSTMVLMFAVLVSAKQYVGHPIECFVPAQF--TRAMEQYTENYCWVQ-NTYWVPFQDLIP----HRLDDRERRQIGYYQWVPFVLAVAALTFHIPSSVWRMLAGQSGLNAGLVLQLVCGDENVDPVVRDKTVDIVARHIDDALMYQRDHGAR-RHSVYIFAIFKLGKFYGAYVSSVYIFIKALHLANVILQFMLLNSFLQTSDYPMFGAHVLYDLFMGREWRDSGKFPRVT---LCDFEIRVLGNVHRHTVQCVLVINMLTEKIFIFLWLWLTVLAIVTALNLIFWFIALVSNSCREHFVSKHLDIQSDQ--------ISRFVHRFLRADGVFLLQMIASHSGNLMAAKVTEQLWMIFVRRSGKPVIEDK 386          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-13 (Innexin [Source:UniProtKB/TrEMBL;Acc:O44887])

HSP 1 Score: 105.916 bits (263), Expect = 1.504e-24
Identity = 86/344 (25.00%), Postives = 155/344 (45.06%), Query Frame = 2
Query:  185 EDGIDRVFHKYSIALILIFSGFIINQYLVNNSINCFAPITIGDEKLFNAYLNQYCWVNMRSSKFSLSHLNPDNSLNRLTSSQSPSVSYYYWMPFILFLQALIIWLPSQFWDYICRRSTGRDFIELINKAAKVADKNDPKDVEILHKEFKQILLENKTAESNDKIAGKLRAMFKMRGKKLSVCYSLIMMTYFAIAIGENLLMMRIFGYENPKQYFIGIWGAVTSGQFTTESPQFPRMIYARIPDFLALGGNVDMIAKCILPMNMVIEKGVIILSMWFTFVTVLQVWKFISWICCHIIEGGRRNFVMKLLRLPTD--KDNENRNRIIDDFIESFLQTDGVFVLGML 1210
            +D IDR+ + ++  L++IF+  +  +  V   I C+ P        +  Y   YC+V   +   S     PD+ ++R    +   + YY W+PFIL LQA++ +LPS FW  +   ++G    +++   AK AD+ D K      K     L E+ T +S      K  + F   G  L+  Y  +   Y    + + +++    G  +   + +GI   + +G+   ES  FPR+      +   LG       +C+L +NM  EK  + L  W   V V      ++W    +    R+  +   L++  +   DN    +I+D F++  L++DGVF+  ++
Sbjct:   17 DDSIDRLNYYWTPMLLVIFALTLSAKQYVGQPIQCWIPAQF--TGAWEQYSENYCFVQ-NTYFISPDKYIPDSEIDR----EGAEIGYYQWVPFILGLQAILFYLPSLFWR-LMNFNSGVALKKML-FGAKKADRVDEKARNEAAKSTGAHLYESLTLQSR---FAKYTSAFTYGGSYLTYLYLFVKFLYLVQIVFQFIILNNFLG-TSYTFWGLGILSDILNGREWEESGHFPRVTMCDF-EVRVLGNKHRHTVQCVLMINMFNEKVYVFLWFWLVIVGVATFLNLVNWTRKLMFRSARKAHIKSYLQIEDNFSDDNSRNGQILDKFVDYKLKSDGVFITHLI 346          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-20 (Innexin [Source:UniProtKB/TrEMBL;Acc:E5QCJ1])

HSP 1 Score: 99.3673 bits (246), Expect = 4.965e-22
Identity = 81/348 (23.28%), Postives = 144/348 (41.38%), Query Frame = 2
Query:  185 EDGIDRVFHKYSIALILIFSGFIINQYLVNNSINCFAPITIGDEKLFNAYLNQYCWV-NMRSSKFSLSHLNPDNSLNRLTSSQSPSVSYYYWMPFILFLQALIIWLPSQFWDYICRRSTGR--DFIELINKAAKVADKNDPKDVEILHKEFKQILLENKTAESNDKIAGKLRAMFKMRGKK--LSVCYSLIMMTYFAIAIGENLLMMRIFGYENPKQYFIGIWGAVTSGQFTTESPQFPRMIYARIPDFLALGGNVDMIAKCILPMNMVIEKGVIILSMWFTFVTVLQVWKFISWICCHIIEGGRRNFVMKLLRLPTDKDNENR-NRIIDDFIESFLQTDGVFVLGML 1210
            +D  DR+ + Y+   +L+ +  I  +      I C+ P        +  Y   YCW  N   + F       D++L  + + +   VSYY W+PF L   A   + P   W     +S  R  D +   N  A V       ++  L      +               K+  +F +R  +  L+  Y  I   +    + +   M R    ++ + Y  GI+  +  G+   ES  FP + Y  +     LG       +C+L +N+  EK   IL +W+T ++++     +SWI   I    RR F+ + L L      ++R  + +D+F+  +++ DG+FVL M+
Sbjct:   19 DDIFDRLHYYYTTTFLLLTAVLISLKMFGGRPIECWLPAEYKSS--WEDYTEMYCWARNTYVTAFE------DDNLPEVVNREYTMVSYYQWVPFFLVYVAFSFYAPCLIWRLFYDKSGIRLKDIMGFANDKANVVPTQRTANIRGLSAHLSSVFKHRFRIGEKHPYHHKVFRIFNVRYYESYLTYLYLAIKCLFLMNVLTQMYFMSRFLELDSHRYYGYGIFYDLIMGKGWKESSNFPVVTYCDM-QIRILGHVQRHTVQCVLVINIFTEKIFFILWLWYTMLSLISFGSILSWIFASIPFNQRRQFIARRLELADVNFEKSRFKQELDEFVRDYIKIDGIFVLRMI 357          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|A8WVX4|INX19_CAEBR (Innexin-19 OS=Caenorhabditis briggsae OX=6238 GN=inx-19 PE=3 SV=3)

HSP 1 Score: 91.2781 bits (225), Expect = 2.220e-18
Identity = 83/401 (20.70%), Postives = 169/401 (42.14%), Query Frame = 2
Query:  185 EDGIDRVFHKYSIALILIFSGFIINQYLVNNSINCFAPITIGDEKLFNAYLNQYCWVNMRSSKFSLSHLNPDNSLNRLTSSQSPSVSYYYWMPFILFLQALIIWLPSQFWDYICRRSTGRDFIELINKAAKVADKNDPKDVEILHKEFKQILLENKTAES-NDKIAGK---LRAMFK--MRGKKLSVCYSLIMMTYFAIAIGENLLMMRIFGYENPKQYFIGIWGAVTSGQFTTESPQFPRMIYARIPDFLA--LGGNVDMIAKCILPMNMVIEKGVIILSMWFTFVTVLQVWKFISWICCHIIEGGRRNFVMKLLRLPTDKDNENRNR-------------------IIDDFIESFLQTDGVFVLGMLXXXXXXXXXXXXAKQMYIFYRKQAIRPMLRNE 1306
            +D +DR+ + Y+  ++ +    I  +      I C+  +     +    Y+  YCW+   +    +    PD+     T+ +   + YY W+PFIL  +AL+  LP  FW  +C   +G +   LIN A       D  D +   +      ++N   +S N +I  +    R  F   + G+ +S+ YS   + Y    + +  ++           +   +   + +G+  TE+  FPR+    + DF    L        +C L +N++ EK    L  W+  + ++    FI WI    I   + ++VMK +++    + +   +                   ++D F+  FL++DG+ +L M+S  + + +  ++ + ++  YR++  R    +E
Sbjct:   21 DDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECW--VNPHSRESMEEYIESYCWIQ-NTYWIPMYENVPDDH----TAREEKQIGYYQWVPFILIAEALMFSLPCIFWR-LCSFQSGLNIQTLINAACDAQALLDYSDRQKAVEAITCNFVDNLDLQSPNGRIRARGWIARIKFSRFLSGQCISIVYSFTKLLYSVNVVAQFFILNACLKSSEFVFFGFQVLSDIWAGRPWTETGHFPRVT---LCDFEVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLDSFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLWQEYRERNWREFEEHE 410          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|O61715|INX19_CAEEL (Innexin-19 OS=Caenorhabditis elegans OX=6239 GN=inx-19 PE=1 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 5.227e-18
Identity = 84/401 (20.95%), Postives = 171/401 (42.64%), Query Frame = 2
Query:  185 EDGIDRVFHKYSIALILIFSGFIINQYLVNNSINCFAPITIGDEKLFNAYLNQYCWVNMRSSKFSLSHLNPDNSLNRLTSSQSPSVSYYYWMPFILFLQALIIWLPSQFWDYICRRSTGRDFIELINKAAKVADKNDPKDVEILHKEFKQILLENKTAES-NDKIAGK---LRAMFK--MRGKKLSVCYSLIMMTYFAIAIGENLLMMRIFGYENPKQYFIGIWGAVTSGQFTTESPQFPRMIYARIPDFLA--LGGNVDMIAKCILPMNMVIEKGVIILSMWFTFVTVLQVWKFISWICCHIIEGGRRNFVMKLLRLPTDKDNENRNR-------------------IIDDFIESFLQTDGVFVLGMLXXXXXXXXXXXXAKQMYIFYRKQAIRPMLRNE 1306
            +D +DR+ + Y+  ++ +    I  +      I C+  +     +    Y+  YCW+   +    +    PD+     T+ +   + YY W+PFIL  +AL+  LP  FW  +C   +G +   LIN A       D  D +   +      ++N   +S N +I  +    R  F   + G+ LS+ +S   + Y    + + L++       +   +   +   + +G+  TE+  FPR+    + DF    L        +C L +N++ EK    L  W+  + ++    FI WI    I   + ++VMK +++    + +   +                   ++D F+  FL++DGV +L M+S  + + +  ++ + ++  +R++  R    +E
Sbjct:   37 DDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECW--VNPHSRESMEEYIESYCWIQ-NTYWIPMYENVPDDH----TAREEKQIGYYQWVPFILIAEALMFSLPCIFWR-LCSFQSGLNIQTLINAACDGQALLDASDRQKAVEAITTNFVDNLDLQSPNGRIRARGWIARIKFSRFLSGQCLSILHSFTKLLYSMNVVAQFLILNACLKSSDFLFFGFQVLNDIWAGRPWTETGHFPRVT---LCDFEVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEFKKLQKFEKDATVERLYTVIAFAPHLLDTFVSDFLKSDGVLMLRMISNHAGDMIVVQLVRNLWQEFRERNWREFEEHE 426          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|O01393|UNC9_CAEEL (Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN=unc-9 PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 1.431e-17
Identity = 86/369 (23.31%), Postives = 164/369 (44.44%), Query Frame = 2
Query:  185 EDGIDRVFHKYSIALILIFSGFIINQYLVNNSINCFAPITIGDEKLFNAYLNQYCWVNMRSSKFSLSHLNPDNSLNRLTSSQSPSVSYYYWMPFILFLQALIIWLPSQFWDYICRRSTGRDFIELINKAAKVADKNDPKDVEILHKEFKQIL--LENKTAESNDKIAGKLRAMFKM------RGKKLSVCYSLIMMTYFAIAIGENLLMMRIFGYENPKQYFIGIWGAVTSGQFTTESPQFPRMIYARIPDF-LALGGNVD-MIAKCILPMNMVIEKGVIILSMWFTFVTVLQVWKFISWICCHIIEGGRRNFVMKLLRLPTDKDNENRNRIIDDFIESFLQTDGVFVLGMLXXXXXXXXXXXXAKQMY 1261
            +D ID++ + Y+ A+I +F+  +  +  V   I C+ P T  +      Y   YCWV   +    L    P N   R    ++  + YY W+PF+L L+AL+ ++P+  W  +  +S        +    ++A  +   D+E  ++  + I   +E      +  ++G    +  +       G  ++  Y  + + Y    +G+  L+    G    K Y + +   + +G+   ES  FPR+    + DF + + GNV     +C+L +NM  EK  + L  W+  +    +     WI   ++   + NFV K L    +      ++ +  F+  FL+ DGVF+L M++  + E    E+AK ++
Sbjct:   21 DDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTEP--MEQYTENYCWVQ-NTYFLPLHDYIPHNYAER----ENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQSGIH-----VQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLG-NRSKWYGLQVLNDLMNGREWEESGHFPRVT---LCDFEVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLT-GIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLW 372          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q23157|INX11_CAEEL (Innexin-11 OS=Caenorhabditis elegans OX=6239 GN=inx-11 PE=3 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.055e-17
Identity = 88/355 (24.79%), Postives = 138/355 (38.87%), Query Frame = 2
Query:  185 EDGIDRVFHKYSIALILIFSGFIINQYLVNNSINCFAPITIGDEKLFNAYLNQYCWVNMRSSKFSLSHLNPDNSLNRLTSSQSP--SVSYYYWMPFILFLQALIIWLPSQFWDYICRRSTGR--DFIELINKAAKVADKNDPKDVEILHKEFKQILLENKTAESNDKIAGKLRAM--FKMRGKKLSVCYSLIMMTYFAIAIGENLLMMRIFGYENPKQYFIGIWGAVTSGQFTTESPQFPRMIYARIPDF-LALGGNVDMIA-KCILPMNMVIEKGVIILSMWFTFVTVLQVWKFISWICCHIIEGGRRNFVMKLLRLPTDKDNENRNRIIDD-----FIESFLQTDGVFVLGML 1210
            +D  DR+ +  +  ++L FS  I  +      I C  P        +  Y   YCW    S          D SL +     +P   +SYY W+PF L LQA     PS  W Y    S  R  + +E    +A V ++   K++ IL +     L      E       K      F+     +S  Y    + YF     +  LM    G      Y  G+   +  G+    S  FPR   A + DF +    N+   + +C+L +N+  EK  ++L  W+  + +      + W    +     + FV + L L T ++   RN   +D     F+  +L  DGVFVL M+
Sbjct:   20 DDWSDRLNYLMTPNILLAFSVLISFKQFGGRPIECMFPNKFPGS--WEQYAENYCW----SQDTYFVEPTQDVSLLKKEERYTPDRQLSYYQWVPFFLLLQAAFFRAPSYLWKYFSNHSGIRIHEVVEKAKDSANVEEEVREKNILILKRHLSSALRFQANMERKKVQVHKTVTFLNFQYSSGFISWIYLFTKVLYFLNVFAQLYLMNYFLGTNRHHWYGFGVVQDIVQGEPWERSGYFPR---AAVCDFEVRQVANIQRYSVQCVLVINIFNEKIFVLLWFWYVILLLSSTVSLVQWFIVLVFPCFSKWFVKQHLALSTLQNFNQRNSRREDSDVSKFVTQYLHKDGVFVLRMV 365          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q22549|INX10_CAEEL (Innexin-10 OS=Caenorhabditis elegans OX=6239 GN=inx-10 PE=3 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.025e-15
Identity = 80/362 (22.10%), Postives = 151/362 (41.71%), Query Frame = 2
Query:  188 DGIDRVFHKYSIALILIFSGFIINQYLVNNSINCFAPITIGDEKLFNAYLNQYCWVNMRSSKFSLSHLNPDNSLNRLTSSQSPSVSYYYWMPFILFLQALIIWLPSQFWDYICRRSTGRDFIELINKAAKVADKNDPKDVEILHKEFKQILLENKTAESNDKIAGKLRAMFKMRGKKL---------SVCYSLIMMT---------YFAIAIGENLLMMRIFGYENPKQYFIGIWGAVTSGQFTTESPQFPRMIYARIPDFLALGGNVDMIAKCILPMNMVIEKGVIILSMWFTFVTVLQVWKFISWICCHIIEGGRRNFVMKLLRLPT---DKDNENRNRIIDDFIESFLQTDGVFVLGML 1210
            D +DR+   ++  L++  +  +  +      + C  P        +  Y   YCW    S  + +    P   L      Q   +SYY W+PF L L+A    LPS  W Y+   S  +     IN+  K++  +DP +++    + K+  +++ T      + G LR   +++ K++         ++ YS   +T         Y A    + + M R    +  K Y +G    + +G    +S  FPR+      D   +G   +   +C+L +N+  EK  I+L  W+  + V     F  W+   +       F+++ L +     D   +     ++ FI ++L++DGVFV+ M+
Sbjct:   20 DFVDRLHSYFTCNLLIGLAVLVSFKQFGGKPVECLVPDIFSSS--WEQYAENYCWA---SDTYYVPTNEPVAGLQSDEKRQR-KISYYQWVPFFLLLEAACFRLPSLLWKYLAGHSGIK-----INEIVKLS--SDPNNIK---PDIKRANIKSLTVH----LQGALRFHRRLQKKQIRPHRFLWLFNLPYSAFFVTAMYLCTKFFYLANVCLQLMFMNRFLETDKYKWYGMGALVDLLNGTTWEQSGMFPRVSLCDF-DVRVMGNMQEHTIQCVLVINIFNEKIFILLWFWYLALLVFTFGSFFYWLLVSLWRHLNVRFIIRHLEMSDIAFDSSEDGAQEKVNRFISNYLKSDGVFVIRMM 360          
BLAST of Innexin vs. TrEMBL
Match: A0A0R3U3C1 (Innexin OS=Mesocestoides corti OX=53468 GN=inx PE=3 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 5.952e-34
Identity = 125/410 (30.49%), Postives = 199/410 (48.54%), Query Frame = 2
Query:  176 LRLEDGIDRVFHKYSIALILIFSGFI-INQYLVNNSINCFAPITIGDEKLFNAYLNQYCWVNMRSSKFSLSHLNPDNSLNRLTSSQSPSVSYYYWMPFILFLQALIIWLPSQFWDYICRRSTGRDFIELINKAAKVAD--KNDPKD-VEILHKEFKQILLENKTAESNDKIAGKLRAMFKMRG-----KKLSV----CYSLIMMTYFAIAIGENLLMMRIFGYENPKQYF-IGIWGAVTSGQFTTESPQFPRMIYARIPDFLALGGNVDMIAKCILPMNMVIEKGVIILSMWFTFVTVLQVWKFISWICCHIIEGGRRNFVMKLLRLPTDKDNENRNRIIDDFIESFLQTDGVFVLGMLXXXXXXXXXXXXAKQMYIFYR-KQAIRPMLRN-------E*ILESAGEETN 1339
            L +ED  D++   YS+ ++L+ +  I + QYL+  SI C+ P T+   K F+ +L  +CWV+         H+ P N      + Q+  ++YY W+PF+L LQ ++ ++P   W  IC   TG D   L+  A   ++  +ND K  V+ +    +++L +++    + K+A   R  FK+ G     K+L       Y  I   Y A AIG+  LM    G+      F   +   +  G+   E+  FPR+ +  +     LG     +A+C+LP+NM+ EK  I L  W   V V        WI     E  R +F+ K LRL      E+R  I+ +FI  FL+ DGVF+L M+S  + + V+ +V  +M+  YR K   R ML +       + +LES GE T 
Sbjct:   19 LGVEDFADKMSFMYSVLILLLSTTVIAVKQYLLA-SIACYIP-TVPSGKDFDKFLQNFCWVHGTIPLLEGEHI-PQNYSEWHEADQNLRINYYQWVPFMLGLQCILFYIPRVVWQIICYNRTGTDLEHLVTVANNASNTIENDRKGLVKHVAATMEEMLFQHRDYR-HGKVADARRKAFKLCGMFVASKRLGTWLIFTYLFIKCIYLANAIGQLYLMQTFLGFNKSMGNFGYEVAKYMIEGRDWDETRIFPRVSFCYLEHVRHLGTTNRYVAQCVLPVNMLNEKLYIFLWFWTAIVAVCTAISIPLWIVRLGREKNRTHFIKKFLRLQEIYTTEDRE-ILHNFICDFLRHDGVFLLRMISMNAGDVVTSDVVVEMWNIYRTKYKNRTMLNDIARDIIAQRLLESGGETTQ 423          

HSP 2 Score: 105.531 bits (262), Expect = 5.638e-20
Identity = 88/379 (23.22%), Postives = 160/379 (42.22%), Query Frame = 2
Query:  167 SKILRLEDGIDRVFHKYSIALILIFSGFIINQYLVNNSINCFAPITIGDEKLFNAYLNQYCWVNMRSSKFSLSHLNPDNSLNRLTSSQSPSVSYYYWMPFILFLQALIIWLPSQFWDYICRRSTGRDFIELINKAAKVADKNDPKDVEIL----HKEFKQILLENKTAESNDKIAGKLR--------AMFKMRGKKLSVCYSLIMMTYFAIAIGENLLMMRIFGY-ENPKQYFIGIWGAVTSGQFTTESPQFPRMIYARIPDFLALGGNVD-MIAKCILPMNMVIEKGVIILSMWFTFVTVLQVWKFISWICCHIIEGGRRNFVMKLLRLPTDKD-----------------NENRNRIIDDFIESFLQTDGVFVLGML 1210
            + ++ ++D  DR+ + +S  + L+ +  +  +  + + + C  P T+     F++Y + YCWV+  ++   ++   P++ +      +   ++YY W+PFIL LQ ++ +LP   W  I     G D   +I KA        P   E +     K  + +L  ++      K A K R         + K  G      Y  I + Y   A+G+  LM    GY E+   + + I  ++ +G    ES  FPR+ +  +     LG   +  +  C L +NM+ EK  + L  W   V +      I+W     +   + + + K L+L    D                 +  R   ++ FI  FL+ DGVF++ ML
Sbjct:  437 ATLIGIQDWADRMSYAHSTIIFLLCTAIVSAKTYILSPLACHVP-TVPSGSDFDSYFDSYCWVH-GTTPIRMNETIPEDDVAWTEFERERKITYYQWVPFILGLQTILFYLPHVAWQNITFNRLGADLTAIIVKAMDALKTTSPSKRETMVANVAKRLELLLFAHRDFRRGKKAALKRRLHAACGIFLVSKRMGTWTVFSYLCIKILYLVNAVGQLYLMKHFLGYGEDMVGFGLTIAHSLVAGIKWRESLFFPRVAFCSVT-VRHLGQKTNRYMGMCALAINMLNEKLYVFLWFWTLAVAIATFVSLINWFLRLAVRRRQASVIRKYLKLAPIVDKPEKEGSITPLSLSESLDPGRPDTVERFIHEFLRLDGVFIVHML 812          
BLAST of Innexin vs. TrEMBL
Match: A0A068WGF5 (Innexin OS=Echinococcus granulosus OX=6210 GN=inx PE=3 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 4.774e-32
Identity = 122/414 (29.47%), Postives = 191/414 (46.14%), Query Frame = 2
Query:  167 SKILRLEDGIDRVFHKYSIALILIFSGFI-INQYLVNNSINCFAPITIGDEKLFNAYLNQYCWVNMRSSKFSLSHLNPDNSLNRLTSSQSPSVSYYYWMPFILFLQALIIWLPSQFWDYICRRSTGRDFIELI---NKAAKVADKNDPKDVEILHKEFKQILLENKTAESNDKIAGKLRAMFKMRG-----KKLSV----CYSLIMMTYFAIAIGENLLMMRIFGYENPKQYF-IGIWGAVTSGQFTTESPQFPRMIYARIPDFLALGGNVDMIAKCILPMNMVIEKGVIILSMWFTFVTVLQVWKFISWICCHIIEGGRRNFVMKLLRLPTDKDNENRNRIIDDFIESFLQTDGVFVLGMLXXXXXXXXXXXXAKQMYIFYR-KQAIRPMLRN--------E*ILESAGEETN 1339
            S  L LED  D++   YS+ ++L+ +  I + QYL+  SI C+ P T+   K F  +L  +CWV+         H+ P N      + ++  ++YY W+PF+L LQ ++ ++P   W  IC   TG D   LI   NKA+   + +    V+ +     ++L +++      K+A   R  FK  G     K+L       Y  I   Y A AIG+  LM    G+      F   +   + +G+   E+  FPR+ +  +     LG     +A+C+LP+NM+ EK  I L  W   V V        WI     E  + +F+ K LRL  D        I+ +FI  FL+ DGVF+L M+S  + + V+ +V  +M+  Y+ K   R ML +           LE  GE T 
Sbjct:   16 SDFLGLEDFADKMSFMYSVLILLLCTTIIAVKQYLLA-SIACYIP-TVPSGKDFEKFLQNFCWVHGTIPILEGEHI-PQNYSEWHDADENMRINYYQWVPFMLGLQCILFYVPRVVWQIICYNRTGTDLENLIAVANKASNTIENDRKMLVKHVAGTMAEMLFQHRDYRRG-KVADARRKAFKFFGMFIASKRLGTWLIFTYLFIKCIYLANAIGQLYLMQTFLGFNKSMSNFGYEVARYMVNGRDWDETRIFPRVSFCYLEHVRHLGTTNRYVAQCVLPVNMLNEKLYIFLWFWTAIVAVCTAVSIPLWIMRLGREKNKVHFIKKFLRL-QDIYTPEHKEILRNFISDFLRHDGVFLLRMISMNAGDVVTADVVVEMWDIYKTKYKNRAMLNDIARDIAAQRRQLEEGGETTQ 424          
BLAST of Innexin vs. TrEMBL
Match: A0A068Y4N3 (Innexin OS=Echinococcus multilocularis OX=6211 GN=inx PE=3 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 5.161e-32
Identity = 122/414 (29.47%), Postives = 191/414 (46.14%), Query Frame = 2
Query:  167 SKILRLEDGIDRVFHKYSIALILIFSGFI-INQYLVNNSINCFAPITIGDEKLFNAYLNQYCWVNMRSSKFSLSHLNPDNSLNRLTSSQSPSVSYYYWMPFILFLQALIIWLPSQFWDYICRRSTGRDFIELI---NKAAKVADKNDPKDVEILHKEFKQILLENKTAESNDKIAGKLRAMFKMRG-----KKLSV----CYSLIMMTYFAIAIGENLLMMRIFGYENPKQYF-IGIWGAVTSGQFTTESPQFPRMIYARIPDFLALGGNVDMIAKCILPMNMVIEKGVIILSMWFTFVTVLQVWKFISWICCHIIEGGRRNFVMKLLRLPTDKDNENRNRIIDDFIESFLQTDGVFVLGMLXXXXXXXXXXXXAKQMYIFYR-KQAIRPMLRN--------E*ILESAGEETN 1339
            S  L LED  D++   YS+ ++L+ +  I + QYL+  SI C+ P T+   K F  +L  +CWV+         H+ P N      + ++  ++YY W+PF+L LQ ++ ++P   W  IC   TG D   LI   NKA+   + +    V+ +     ++L +++      K+A   R  FK  G     K+L       Y  I   Y A AIG+  LM    G+      F   +   + +G+   E+  FPR+ +  +     LG     +A+C+LP+NM+ EK  I L  W   V V        WI     E  + +F+ K LRL  D        I+ +FI  FL+ DGVF+L M+S  + + V+ +V  +M+  Y+ K   R ML +           LE  GE T 
Sbjct:   16 SDFLGLEDFADKMSFMYSVLILLLCTTIIAVKQYLLA-SIACYIP-TVPSGKDFEKFLQNFCWVHGTIPILEGEHI-PQNYSEWHDADENMRINYYQWVPFMLGLQCILFYVPRVVWQIICYNRTGTDLENLIAVANKASNTIENDRKMLVKHVAGTMAEMLFQHRDYRRG-KVADARRKAFKFFGMFIASKRLGTWLIFTYLFIKCIYLANAIGQLYLMQTFLGFNKSMSNFGYEVARYMVNGRDWDETRIFPRVSFCYLEHVRHLGTTNRYVAQCVLPVNMLNEKLYIFLWFWTAIVAVCTAVSIPLWIMRLGREKNKVHFIKKFLRL-QDIYTPEHKEILRNFISDFLRHDGVFLLRMISMNAGDVVTADVVVEMWDIYKTKYKNRAMLNDIARDIAAQRRKLEEGGETTQ 424          
BLAST of Innexin vs. TrEMBL
Match: A0A183SWW7 (Innexin OS=Schistocephalus solidus OX=70667 GN=inx PE=3 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 5.741e-32
Identity = 115/401 (28.68%), Postives = 193/401 (48.13%), Query Frame = 2
Query:  146 FAKNRTRSKILRLEDGIDRVFHKYSIALILIFSGFI-INQYLVNNSINCFAPITIGDEKLFNAYLNQYCWVNMRSSKFSLSHLNPDNSLNRLTSSQSPSVSYYYWMPFILFLQALIIWLPSQFWDYICRRSTGRDFIELI---NKAAKVADKNDPKDVEILHKEFKQILLENKTAESNDKIAGKLRAMFKMRG-----KKLSV----CYSLIMMTYFAIAIGENLLMMRIFGYENPKQYFIGIWGA-VTSGQFTTESPQFPRMIYARIPDFLALGGNVDMIAKCILPMNMVIEKGVIILSMWFTFVTVLQVWKFISWICCHIIEGGRRNFVMKLLRLPTDKDNENRNRIIDDFIESFLQTDGVFVLGMLXXXXXXXXXXXXAKQMYIFYR-KQAIRPMLRN 1303
            + K    S+ L +ED  D++   YS+ ++L+ +  I + QYL++ SI+C+ P T      F+ +L  YCWV+      +   + P    +      +  ++YY W+PF+L LQ ++ ++P   W  IC   TG D   L+   N A+   +      V+ +    +++L +++   S  K+A   R  F M G     K+L       Y  I + Y A AIG+  LM    G+ +    F  +  + +  G+   E+  FPR+ +  +     LG     +A+C+LP+NM+ EK  I L  W   V +        WI    +E  R +FV K LRL     +E+R  I+ +FI  FL+ DG+F+L M+S  + + V+ +V   ++  YR K   R ML +
Sbjct:    9 YLKKLQVSEFLGVEDFADKMSFMYSVVILLLCTTIIAVKQYLLS-SISCYIPTTPSGSD-FDKFLENYCWVHGTIPLLAGDQI-PQKYEDWHMLDMNHRINYYQWVPFMLGLQTILFYMPRVVWQIICYNRTGTDLEHLVTVANSASNAVEGERKGLVKHVACTLEEMLFQHR-EYSVGKVATARRRAFTMCGMFVASKRLGTWLIFTYIAIKLVYLANAIGQLYLMQSFLGFNSSMSSFGYVLASYMVEGRDWDETRIFPRVSFCYLEHVRHLGTTNKYVAQCVLPVNMLNEKLYIFLWFWTLLVAICTALSIPLWILRMGLEKNRSHFVKKFLRLQEIYTDEDRE-ILHNFICDFLRHDGIFLLRMISMNAGDVVTSDVVAALWNIYRTKYKNRKMLHD 404          

HSP 2 Score: 91.2781 bits (225), Expect = 1.772e-15
Identity = 90/407 (22.11%), Postives = 159/407 (39.07%), Query Frame = 2
Query:  173 ILRLEDGIDRVFHKYSIALILIFSGFIINQYLVNNSINCFAPITIGDEKLFNAYLNQYCWVNMRSSKFSLSHLNPDN--SLNRLTSSQSPSVS-----------------------------YYYWMPFILFLQALIIWLPSQFWDYICRRSTGRDFIELINKAAKVADKNDPKDVE--------------ILHKEFKQILLENKTAESNDKIAGKLRAMFKMRGKKLSVCYSLIMMTYFAIAIGENLLMMRIFGY-ENPKQYFIGIWGAVTSGQFTTESPQFPRMIYARIPDFLALGGNVD--MIAKCILPMNMVIEKGVIILSMWFTFVTVLQVWKFISWIC-------------CHIIEGGRRNFVMKLLRLPTDKDNENRNRIIDDFIESFLQTDGVFVLGML 1210
            ++ ++D  DR+   +S  +++I +  +  +  +   + C  P T+     F  Y+  YCWV+  +    ++   P++  S + L++ +   VS                             YY W+PF+L LQ ++ ++P   W  +     G D   +I+KA        P+  E                H+++++  +     + +D     L +  K  G      Y  I + Y A AIG+  LM    GY E+   + I +  ++  G    ES  FPR+ +  +   L   G  D   +  C L +NM+ EK  I L  W   V +      I+W                ++  G           L  D  + +  R +D FI+ FL+ DGVF++ ML
Sbjct:  440 LVGVQDWADRLSFAHSTVILIICTAIVSAKTYILKPLACHVP-TVPTGSNFKDYMASYCWVH-GTVPIGINETIPEDETSWDALSAERKMGVSLSFMLLQIPQWMCIPYPFFLLTQSRFLAAYYQWVPFVLGLQTILFYVPHVIWQNVTFNRLGTDLTAIISKAMDALKTTAPEKREQKIANVAERLELLLFAHRDYRRGKMAAVGRQVSDTCGLLLAS--KRLGTWTVFSYLCIKLLYLANAIGQLYLMKEFLGYSESMTGFMIQLTQSLIQGSDWRESLYFPRVAFCSVK--LRHLGQSDNRFLGMCALAVNMLNEKIYIFLWYWTMLVAICTGVSIITWFLRLTIRRRKTRIIRKYLKLGPEPEPSESEKELDADTLDPDDPRTVDRFIKEFLRLDGVFIVHML 840          
BLAST of Innexin vs. TrEMBL
Match: W6UMB0 (Innexin OS=Echinococcus granulosus OX=6210 GN=inx PE=3 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 6.523e-32
Identity = 122/414 (29.47%), Postives = 193/414 (46.62%), Query Frame = 2
Query:  167 SKILRLEDGIDRVFHKYSIALILIFSGFI-INQYLVNNSINCFAPITIGDEKLFNAYLNQYCWVNMRSSKFSLSHLNPDNSLNRLTSSQSPSVSYYYWMPFILFLQALIIWLPSQFWDYICRRSTGRDFIELI---NKAAKVADKNDPKDVEILHKEFKQILLENKTAESNDKIAGKLRAMFKMRG-----KKLSV----CYSLIMMTYFAIAIGENLLMMRIFGYENPKQYF-IGIWGAVTSGQFTTESPQFPRMIYARIPDFLALGGNVDMIAKCILPMNMVIEKGVIILSMWFTFVTVLQVWKFISWICCHIIEGGRRNFVMKLLRLPTDKDNENRNRIIDDFIESFLQTDGVFVLGMLXXXXXXXXXXXXAKQMYIFYR-KQAIRPMLRN--------E*ILESAGEETN 1339
            S  L LED  D++   YS+ ++L+ +  I + QYL+  SI C+ P T+   K F  +L  +CWV+         H+ P N      + ++  ++YY W+PF+L LQ ++ ++P   W  IC   TG D   LI   NKA+   + +    V+ +     ++L +++      K+A   R  FK  G     K+L       Y  I   Y A AIG+  LM    G+      F   +   + +G+   E+  FPR+ +  +     LG     +A+C+LP+NM+ EK  I L  W   V V        WI     E  + +F+ K LRL      E++  I+ +FI  FL+ DGVF+L M+S  + + V+ +V  +M+  Y+ K   R ML +           LE  GE T 
Sbjct:   76 SDFLGLEDFADKMSFMYSVLILLLCTTIIAVKQYLLA-SIACYIP-TVPSGKDFEKFLQNFCWVHGTIPILEGEHI-PQNYSEWHDADENMRINYYQWVPFMLGLQCILFYVPRVVWQIICYNRTGTDLENLIAVANKASNTIENDRKMLVKHVAGTMAEMLFQHRDYRRG-KVADARRKAFKFFGMFIASKRLGTWLIFTYLFIKCIYLANAIGQLYLMQTFLGFNKSMSNFGYEVARYMVNGRDWDETRIFPRVSFCYLEHVRHLGTTNRYVAQCVLPVNMLNEKLYIFLWFWTAIVAVCTAVSIPLWIMRLGREKNKVHFIKKFLRLQDIYTPEHKE-ILRNFISDFLRHDGVFLLRMISMNAGDVVTADVVVEMWDIYKTKYKNRAMLNDIARDIAAQRRQLEEGGETTQ 484          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000071556.1 (SMESG000071556.1)

HSP 1 Score: 785.408 bits (2027), Expect = 0.000e+0
Identity = 393/395 (99.49%), Postives = 394/395 (99.75%), Query Frame = 2
Query:  122 MINDITETFAKNRTRSKILRLEDGIDRVFHKYSIALILIFSGFIINQYLVNNSINCFAPITIGDEKLFNAYLNQYCWVNMRSSKFSLSHLNPDNSLNRLTSSQSPSVSYYYWMPFILFLQALIIWLPSQFWDYICRRSTGRDFIELINKAAKVADKNDPKDVEILHKEFKQILLENKTAESNDKIAGKLRAMFKMRGKKLSVCYSLIMMTYFAIAIGENLLMMRIFGYENPKQYFIGIWGAVTSGQFTTESPQFPRMIYARIPDFLALGGNVDMIAKCILPMNMVIEKGVIILSMWFTFVTVLQVWKFISWICCHIIEGGRRNFVMKLLRLPTDKDNENRNRIIDDFIESFLQTDGVFVLGMLXXXXXXXXXXXXAKQMYIFYRKQAIRPMLRNE 1306
            MINDITETFAKNRTRSKILRLEDGIDRVFHKYSIALILIFSGFIINQYLVNNSINCFAPITIGDEKLFNAYLNQYCWVNMRSSKFSLSHLNPDNSLNRLTSSQSPSVSYYYWMPFILFLQALIIWLPSQFWDYICRRSTGRDFIELINKAAKVADKNDPKDVEILHKEFKQILLENKTAESNDKIAGKLRA+FKMRGKKLSVCYSLIMMTYFAIAIGENLLMMRIFGYENPKQYFIGIWGAVTSGQFTTESPQFPRMIYARIPDFLALGGNVDMIAKCILPMNMVIEKGVIILSMWFTFVTVLQV KFISWICCHIIEGGRRNFVMKLLRLPTDKDNENRNRIIDDFIESFLQTDGVFVLGMLSRTSSESVSREVAKQMYIFYRKQAIRPMLRNE
Sbjct:    1 MINDITETFAKNRTRSKILRLEDGIDRVFHKYSIALILIFSGFIINQYLVNNSINCFAPITIGDEKLFNAYLNQYCWVNMRSSKFSLSHLNPDNSLNRLTSSQSPSVSYYYWMPFILFLQALIIWLPSQFWDYICRRSTGRDFIELINKAAKVADKNDPKDVEILHKEFKQILLENKTAESNDKIAGKLRALFKMRGKKLSVCYSLIMMTYFAIAIGENLLMMRIFGYENPKQYFIGIWGAVTSGQFTTESPQFPRMIYARIPDFLALGGNVDMIAKCILPMNMVIEKGVIILSMWFTFVTVLQVCKFISWICCHIIEGGRRNFVMKLLRLPTDKDNENRNRIIDDFIESFLQTDGVFVLGMLSRTSSESVSREVAKQMYIFYRKQAIRPMLRNE 395          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000071573.1 (SMESG000071573.1)

HSP 1 Score: 776.933 bits (2005), Expect = 0.000e+0
Identity = 389/395 (98.48%), Postives = 391/395 (98.99%), Query Frame = 2
Query:  122 MINDITETFAKNRTRSKILRLEDGIDRVFHKYSIALILIFSGFIINQYLVNNSINCFAPITIGDEKLFNAYLNQYCWVNMRSSKFSLSHLNPDNSLNRLTSSQSPSVSYYYWMPFILFLQALIIWLPSQFWDYICRRSTGRDFIELINKAAKVADKNDPKDVEILHKEFKQILLENKTAESNDKIAGKLRAMFKMRGKKLSVCYSLIMMTYFAIAIGENLLMMRIFGYENPKQYFIGIWGAVTSGQFTTESPQFPRMIYARIPDFLALGGNVDMIAKCILPMNMVIEKGVIILSMWFTFVTVLQVWKFISWICCHIIEGGRRNFVMKLLRLPTDKDNENRNRIIDDFIESFLQTDGVFVLGMLXXXXXXXXXXXXAKQMYIFYRKQAIRPMLRNE 1306
            MINDITETFAKNRTRSKILRLEDGIDRVFHKYSIALILIFSGFIINQYLVNNSINCFAPITIGDEKLFNAYLNQYCWVNMRSSKFSLSHLNP+NSLNRLTSSQSPSVSYYYWMPFILFLQALIIWLPSQFWDYICRRSTGRDFIELINKAAKVADKNDPKDVEILHKEFKQILLENKTAESNDKIAGKL AMFKMRGKKLS+CYSLIMMTYFAIAIGENLLMMRIFGYENPKQYFIGIWGAVTSGQFTTESPQFPRMIYARIPDFLALGGNVDMIAKCILPMNMVIEKGVIILSMWFTFV VLQV KFISWICCHIIEGGRRNFVMKLLRLPTDKDNENRNRIIDDFIESFLQ DGVFVLGMLSRTSSESVSREVAKQMYIFYRKQAIRPMLRNE
Sbjct:    1 MINDITETFAKNRTRSKILRLEDGIDRVFHKYSIALILIFSGFIINQYLVNNSINCFAPITIGDEKLFNAYLNQYCWVNMRSSKFSLSHLNPNNSLNRLTSSQSPSVSYYYWMPFILFLQALIIWLPSQFWDYICRRSTGRDFIELINKAAKVADKNDPKDVEILHKEFKQILLENKTAESNDKIAGKLSAMFKMRGKKLSICYSLIMMTYFAIAIGENLLMMRIFGYENPKQYFIGIWGAVTSGQFTTESPQFPRMIYARIPDFLALGGNVDMIAKCILPMNMVIEKGVIILSMWFTFVIVLQVCKFISWICCHIIEGGRRNFVMKLLRLPTDKDNENRNRIIDDFIESFLQRDGVFVLGMLSRTSSESVSREVAKQMYIFYRKQAIRPMLRNE 395          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000080788.1 (SMESG000080788.1)

HSP 1 Score: 119.013 bits (297), Expect = 8.840e-29
Identity = 91/364 (25.00%), Postives = 164/364 (45.05%), Query Frame = 2
Query:  167 SKILRLEDGIDRVFHKYSIALILIFSGFIINQYLVNNSINCFAPITIGDEKLFNAYLNQYCWVNMRSSKFSLSHLNPDNSLNRLTSSQSPSVSYYYWMPFILFLQALIIWLPSQFWDYICRRSTGRDFIELINKAAKVADKNDP----KD-VEILHKEFKQILLENKTAESNDKIAGKLR----------AMFKMRGKKLSVCYSLIMMTYFAIAIGENLLMMRIFGYENPKQYF-IGIWGAVTSGQFTTESPQFPRMIYARIPDFLALGGNVDMIAKCILPMNMVIEKGVIILSMWFTFVTVLQVWKFISWICCHIIEGGRRNFVMKLLRLPTDKDNENRNRIIDDFIESFLQTDGVFVLGML 1210
            S  + +ED  D++   +S+ L+++    +  +  +   + C+     G    F  YL  YCWV+  +  F      P N ++   +  +  ++YY W+PFIL LQ  + ++P   W  IC   +G +   ++N A   A  N P    KD +E + +  + +L +++     +    KLR             K  G  L + Y LI   Y    IG+  +M +  G+ N    F   +   + SG+   ++  FPR+ Y  + +   +G     +A+C LP+NM+ EK  + L  W   V ++       W         R  F+ + L +  + +  ++  +I++FIE FL+ DGVF++ ML
Sbjct:   16 STYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSN-FENYLENYCWVH-GTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCFMFYIPKIIWQIICYNKSGTNLESIVNDAN--AANNTPPVERKDKIERIARTIEDMLFQHRDYRQGN--FAKLRRKIYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNSTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDK-PMINNFIEEFLRHDGVFLVRML 372          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000081749.1 (SMESG000081749.1)

HSP 1 Score: 117.857 bits (294), Expect = 1.529e-28
Identity = 97/413 (23.49%), Postives = 190/413 (46.00%), Query Frame = 2
Query:  140 ETFAKNRTR---SKILRLEDGIDRVFHKYSIALILIFSGFIINQYLVNNSINCFAPITIGDEKLFNAYLNQYCWVNMRSSKFSLSHLNPDNSLNRLTSSQSPSVSYYYWMPFILFLQALIIWLPSQFWDYICRRSTGRDFIELINKAAKVADK-NDPKDVEILH--KEFKQILLENKTAESNDKIAGKLRAMFKMRGKKLSV----CYSLIMMTYFAIAIGENLLMMRIFGYENPK---QYFIGIWGAVTSGQFTTESPQFPRMIYARIPDFLALGGNVDMIAKCILPMNMVIEKGVIILSMWFTFVTVLQVWKFISWICCHIIEGGRRNFVMKLLRLPTDKDNENRNRIIDDFIESFLQTDGVFVLGMLXXXXXXXXXXXXAKQMYIFYRKQAIRPMLRNE*ILESAGEETN 1339
            ETF    T     K + +ED  D+    +S+ ++++ S  +  +  +   I+C+ P+ +    L + Y+  YCWV+  +  F  +   P      + +  S  ++YY W+PF+L LQ ++ +LP   W  I    +G D   L+  A K +++  + +   IL   K  + + L+ +          + +      G++  V     Y +I + Y   AI + +LM     Y   K    +   I   + SG+   ++  FPR+ +  I D   +      IA+C LP+NM+ EK  I L  W   V  L +     W+        R++F+ + L++ +    + +N +I  F+E FL+ DG+F+L ++S  + + ++ ++  +++  Y K  ++   R + I  S+ E++ 
Sbjct:    2 ETFLSQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITADISCYIPVVLSGVDL-DKYVKNYCWVH-GTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKN-LISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKKYI-SSSNEKSK 410          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000081749.1 (SMESG000081749.1)

HSP 1 Score: 117.087 bits (292), Expect = 3.192e-28
Identity = 95/400 (23.75%), Postives = 186/400 (46.50%), Query Frame = 2
Query:  167 SKILRLEDGIDRVFHKYSIALILIFSGFIINQYLVNNSINCFAPITIGDEKLFNAYLNQYCWVNMRSSKFSLSHLNPDNSLNRLTSSQSPSVSYYYWMPFILFLQALIIWLPSQFWDYICRRSTGRDFIELINKAAKVADK-NDPKDVEILH--KEFKQILLENKTAESNDKIAGKLRAMFKMRGKKLSV----CYSLIMMTYFAIAIGENLLMMRIFGYENPK---QYFIGIWGAVTSGQFTTESPQFPRMIYARIPDFLALGGNVDMIAKCILPMNMVIEKGVIILSMWFTFVTVLQVWKFISWICCHIIEGGRRNFVMKLLRLPTDKDNENRNRIIDDFIESFLQTDGVFVLGMLXXXXXXXXXXXXAKQMYIFYRKQAIRPMLRNE*ILESAGEET 1336
             K + +EDG D+    +S+ ++++ +  +  +  +   I C+ PI    EKL   Y+  YCW +  +  F  +   P N  + + +     ++YY W+PF+L LQ ++ +LP   W  I    +G D   L+  A K +++  + +   IL   K  + + L+ +          + +      G++  V     Y +I + Y   AI + +LM     Y   K    +   I   + SG+   ++  FPR+ +  I D   +      IA+C LP+NM+ EK  I L  W   V  L +     W+        R++F+ + L++ +    + +N +I  F+E FL+ DG+F+L ++S  + + ++ ++  +++  Y K  ++   R + I  S+ E++
Sbjct:   14 EKYVGVEDGADKASFLFSVVILVVCTVIVSTKQYIFGEIACYIPILNTGEKL-EDYIQNYCWAH-GTIPFRENETLPQNRKDWMQADFDRRLNYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKN-LISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKKYI-SSSNEKS 409          
The following BLAST results are available for this feature:
BLAST of Innexin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inx-181.258e-2523.62Innexin [Source:UniProtKB/TrEMBL;Acc:Q8MXG8][more]
inx-181.483e-2523.62Innexin [Source:UniProtKB/TrEMBL;Acc:Q8MXG8][more]
inx-181.483e-2523.62Innexin [Source:UniProtKB/TrEMBL;Acc:Q8MXG8][more]
inx-131.504e-2425.00Innexin [Source:UniProtKB/TrEMBL;Acc:O44887][more]
inx-204.965e-2223.28Innexin [Source:UniProtKB/TrEMBL;Acc:E5QCJ1][more]
back to top
BLAST of Innexin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A8WVX4|INX19_CAEBR2.220e-1820.70Innexin-19 OS=Caenorhabditis briggsae OX=6238 GN=i... [more]
sp|O61715|INX19_CAEEL5.227e-1820.95Innexin-19 OS=Caenorhabditis elegans OX=6239 GN=in... [more]
sp|O01393|UNC9_CAEEL1.431e-1723.31Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q23157|INX11_CAEEL2.055e-1724.79Innexin-11 OS=Caenorhabditis elegans OX=6239 GN=in... [more]
sp|Q22549|INX10_CAEEL1.025e-1522.10Innexin-10 OS=Caenorhabditis elegans OX=6239 GN=in... [more]
back to top
BLAST of Innexin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3U3C15.952e-3430.49Innexin OS=Mesocestoides corti OX=53468 GN=inx PE=... [more]
A0A068WGF54.774e-3229.47Innexin OS=Echinococcus granulosus OX=6210 GN=inx ... [more]
A0A068Y4N35.161e-3229.47Innexin OS=Echinococcus multilocularis OX=6211 GN=... [more]
A0A183SWW75.741e-3228.68Innexin OS=Schistocephalus solidus OX=70667 GN=inx... [more]
W6UMB06.523e-3229.47Innexin OS=Echinococcus granulosus OX=6210 GN=inx ... [more]
back to top
BLAST of Innexin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071556.10.000e+099.49SMESG000071556.1[more]
SMESG000071573.10.000e+098.48SMESG000071573.1[more]
SMESG000080788.18.840e-2925.00SMESG000080788.1[more]
SMESG000081749.11.529e-2823.49SMESG000081749.1[more]
SMESG000081749.13.192e-2823.75SMESG000081749.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013987 ID=SMED30013987|Name=Innexin|organism=Schmidtea mediterranea sexual|type=transcript|length=1611bp
ATTCATAAGCTTTTTTTTTAAAAACCATTTTTGAGGAAAAATAAATAAAA
AGTTTCCGGAATATTGTGCAACCGCCAACTATAAAAACAATAAATTCAAT
GATAAATTATTATCATTCAAAATGATTAATGATATCACTGAAACATTTGC
TAAAAATAGAACGAGATCTAAAATTCTCAGACTGGAAGATGGCATCGATC
GAGTATTCCACAAATACAGCATCGCGTTGATATTGATTTTCTCCGGCTTC
ATAATCAATCAATATCTCGTCAACAATTCCATCAATTGCTTTGCTCCAAT
CACCATCGGCGATGAGAAACTATTCAACGCATATCTAAATCAATACTGCT
GGGTGAATATGCGTTCGAGTAAATTTTCTCTTTCACATTTAAATCCTGAC
AATTCATTGAATCGCTTGACGAGTTCTCAATCGCCTTCTGTCAGTTATTA
TTATTGGATGCCATTCATATTGTTTCTTCAAGCTCTAATCATATGGCTAC
CGAGCCAGTTTTGGGATTACATTTGTAGAAGATCGACTGGAAGAGACTTC
ATTGAATTGATCAACAAAGCTGCAAAGGTCGCCGACAAAAATGATCCAAA
AGATGTGGAAATATTGCACAAGGAATTCAAACAAATTCTTCTAGAAAATA
AAACTGCCGAATCCAATGATAAAATTGCCGGTAAATTGAGAGCGATGTTC
AAGATGCGAGGAAAGAAATTGAGCGTTTGCTATTCGCTGATAATGATGAC
GTATTTCGCAATTGCGATTGGTGAAAACTTGCTCATGATGCGCATTTTCG
GATATGAGAACCCGAAACAATATTTCATTGGGATTTGGGGCGCTGTCACA
TCTGGGCAGTTTACAACGGAAAGTCCTCAGTTTCCTCGAATGATCTATGC
AAGAATTCCCGATTTCTTAGCGTTAGGAGGAAATGTCGATATGATTGCCA
AATGCATATTGCCAATGAATATGGTGATTGAGAAAGGCGTCATCATTTTG
TCAATGTGGTTCACGTTTGTGACAGTTCTTCAGGTTTGGAAATTCATCTC
TTGGATTTGTTGTCACATCATTGAGGGAGGCAGACGGAACTTTGTTATGA
AACTGTTGAGATTGCCAACTGACAAGGACAATGAAAACAGAAATAGAATA
ATTGACGATTTCATAGAATCTTTTCTCCAGACAGATGGAGTATTCGTATT
GGGAATGCTGAGTAGAACGAGTTCAGAATCCGTGTCAAGAGAAGTGGCCA
AGCAAATGTATATATTTTATCGGAAACAAGCTATCCGTCCGATGCTACGC
AATGAGTGAATCTTAGAGTCTGCTGGCGAAGAAACGAATTTCCTAGTTTA
GATTTCTCTTATTATTTGCAATTTATTATTGCTCTGATCCCCTAATATTT
CATGGGGGGGGGCAAAATGCGCTTTCATTCATTTGACTGATTGGATAAAC
TTTATTATTTTACATTTGTTGAATATTAAATAAAAAATAATATTATTTTA
TACATTTTCTTCATTTCTTATTTTGTGGAGTTAATCGATATAAATTACGC
AGTTCATCTCTCCTTTCAATGCATTTTATGCGGCTTGTTACGGCATAATA
TTTTATATCCC
back to top

protein sequence of SMED30013987-orf-1

>SMED30013987-orf-1 ID=SMED30013987-orf-1|Name=SMED30013987-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=396bp
MINDITETFAKNRTRSKILRLEDGIDRVFHKYSIALILIFSGFIINQYLV
NNSINCFAPITIGDEKLFNAYLNQYCWVNMRSSKFSLSHLNPDNSLNRLT
SSQSPSVSYYYWMPFILFLQALIIWLPSQFWDYICRRSTGRDFIELINKA
AKVADKNDPKDVEILHKEFKQILLENKTAESNDKIAGKLRAMFKMRGKKL
SVCYSLIMMTYFAIAIGENLLMMRIFGYENPKQYFIGIWGAVTSGQFTTE
SPQFPRMIYARIPDFLALGGNVDMIAKCILPMNMVIEKGVIILSMWFTFV
TVLQVWKFISWICCHIIEGGRRNFVMKLLRLPTDKDNENRNRIIDDFIES
FLQTDGVFVLGMLSRTSSESVSREVAKQMYIFYRKQAIRPMLRNE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0005921gap junction
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000421tail
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR000990Innexin
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000990InnexinPRINTSPR01262INNEXINcoord: 278..294
score: 40.94
coord: 109..131
score: 46.26
IPR000990InnexinPFAMPF00876Innexincoord: 22..380
e-value: 6.2E-58
score: 196.8
IPR000990InnexinPANTHERPTHR11893INNEXINcoord: 16..386
IPR000990InnexinPROSITEPS51013PANNEXINcoord: 17..389
score: 21.332
NoneNo IPR availableTMHMMTMhelixcoord: 200..222
NoneNo IPR availableTMHMMTMhelixcoord: 28..50
NoneNo IPR availableTMHMMTMhelixcoord: 109..131
NoneNo IPR availableTMHMMTMhelixcoord: 290..312