Ig-like domain-containing protein

Overview
NameIg-like domain-containing protein
Smed IDSMED30013984
Length (bp)1631
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ig-like domain-containing protein (SMED30013984) t-SNE clustered cells

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30013984) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ig-like domain-containing protein (SMED30013984) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30013984) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013984

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30013984h1SMcG0019166 SmedASXL_014606SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30013984h1SMcG0019166 dd_Smed_v6_13558_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30013984h1SMcG0019166 dd_Smed_v4_13558_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: PXDN (peroxidasin [Source:HGNC Symbol;Acc:HGNC:14966])

HSP 1 Score: 70.0922 bits (170), Expect = 5.599e-12
Identity = 65/265 (24.53%), Postives = 133/265 (50.19%), Query Frame = 1
Query:  370 LQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKAL-HLQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRL--KLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPEIQSS------ENASLSVLRKSRIDK--YKCVIKN 1128
            L+F  +  I    F  L +L  L L++N +  IP   F+ L +L++L L  N++    R +F+GL ++ +L L    +  LD + F  + +  +  +  N   +++   F  L E++  L+++ N  +C C + WL  +L +  ++ N  ++      A C YP R++G+ +A +  ++ +C+ PR+  +  D  +TS ++   TC +E   +  P++IW+   RN     +++       ++ +L +      D+  Y+C+ KN
Sbjct:   65 LRFNRIREIQPGAFRRLRNLNTLLLNNNQIKRIPSGAFEDLENLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLDPDSFQHLPKLERLFLHNNRITHLVPGTFNHL-ESMKRLRLDSNTLHCDCEILWLADLLKTYAESGNAQAA------AICEYPRRIQGRSVATITPEELNCERPRITSEPQDADVTSGNTVYFTCRAE--GNPKPEIIWL---RNNNELSMKTDSRLNLLDDGTLMIQNTQETDQGIYQCMAKN 317          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: PXDN (peroxidasin [Source:HGNC Symbol;Acc:HGNC:14966])

HSP 1 Score: 70.0922 bits (170), Expect = 6.821e-12
Identity = 65/265 (24.53%), Postives = 133/265 (50.19%), Query Frame = 1
Query:  370 LQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKAL-HLQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRL--KLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPEIQSS------ENASLSVLRKSRIDK--YKCVIKN 1128
            L+F  +  I    F  L +L  L L++N +  IP   F+ L +L++L L  N++    R +F+GL ++ +L L    +  LD + F  + +  +  +  N   +++   F  L E++  L+++ N  +C C + WL  +L +  ++ N  ++      A C YP R++G+ +A +  ++ +C+ PR+  +  D  +TS ++   TC +E   +  P++IW+   RN     +++       ++ +L +      D+  Y+C+ KN
Sbjct:   69 LRFNRIREIQPGAFRRLRNLNTLLLNNNQIKRIPSGAFEDLENLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLDPDSFQHLPKLERLFLHNNRITHLVPGTFNHL-ESMKRLRLDSNTLHCDCEILWLADLLKTYAESGNAQAA------AICEYPRRIQGRSVATITPEELNCERPRITSEPQDADVTSGNTVYFTCRAE--GNPKPEIIWL---RNNNELSMKTDSRLNLLDDGTLMIQNTQETDQGIYQCMAKN 321          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: SLIT1 (slit guidance ligand 1 [Source:HGNC Symbol;Acc:HGNC:11085])

HSP 1 Score: 69.3218 bits (168), Expect = 1.161e-11
Identity = 80/314 (25.48%), Postives = 123/314 (39.17%), Query Frame = 1
Query:  160 SNPCPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALH-LQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCN-LTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLI----DVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPEIQSSENASLSV 1083
            S  CP++C    C  G++ C   GL  IP  L +                               + +I L+   + SI    FS    LR +DLS+N + EI PD F+ L  L  L L  NK+    R  F GL   +L L + N +  +  + F ++       +  N   ++    F  L   +  L + +NPF C CNL+WL   L  R   I  S        A+C  P R+  K+I  +  K F C +     I    D  + S  ++ + C    K     +V+  +  + T +PE      A L +
Sbjct:  279 SGSCPAMC---TCSNGIVDCRGKGLTAIPANLPET------------------------------MTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSLAKGTFTSL-RAIQTLHLAQNPFICDCNLKWLADFL--RTNPIETSG-------ARCASPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYQLNSECNSDVVCPH--KCRCEANVVECSSLKLTKIPERIPQSTAELRL 547          

HSP 2 Score: 64.3142 bits (155), Expect = 4.510e-10
Identity = 66/250 (26.40%), Postives = 102/250 (40.80%), Query Frame = 1
Query:  169 CPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKAL-HLQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCD 912
            CP   H+  C+  V+ C+   L +IP  + Q T ++ ++N   S    T   F         ++KI L   ++  I    F     +  L L+ N L  I    F+ L  L+ L L +N++   H  SF GL NV  LSL+D  +T +    F  +                         ++L  L +  NPFNC C L WL   L  RK+ I       +    +C  PD ++   + D+   DF C+
Sbjct:  513 CP---HKCRCEANVVECSSLKLTKIPERIPQSTAELRLNNNEISILEAT-GMFKKL----THLKKINLSNNKVSEIEDGAFEGAASVSELHLTANQLESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNQITTVSPGAFDTL-------------------------QSLSTLNLLANPFNCNCQLAWLGGWL--RKRKI-------VTGNPRCQNPDFLRQIPLQDVAFPDFRCE 720          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: SLIT1 (slit guidance ligand 1 [Source:HGNC Symbol;Acc:HGNC:11085])

HSP 1 Score: 68.5514 bits (166), Expect = 2.002e-11
Identity = 80/314 (25.48%), Postives = 123/314 (39.17%), Query Frame = 1
Query:  160 SNPCPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALH-LQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCN-LTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLI----DVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPEIQSSENASLSV 1083
            S  CP++C    C  G++ C   GL  IP  L +                               + +I L+   + SI    FS    LR +DLS+N + EI PD F+ L  L  L L  NK+    R  F GL   +L L + N +  +  + F ++       +  N   ++    F  L   +  L + +NPF C CNL+WL   L  R   I  S        A+C  P R+  K+I  +  K F C +     I    D  + S  ++ + C    K     +V+  +  + T +PE      A L +
Sbjct:  279 SGSCPAMC---TCSNGIVDCRGKGLTAIPANLPET------------------------------MTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSLAKGTFTSL-RAIQTLHLAQNPFICDCNLKWLADFL--RTNPIETSG-------ARCASPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYQLNSECNSDVVCPH--KCRCEANVVECSSLKLTKIPERIPQSTAELRL 547          

HSP 2 Score: 63.5438 bits (153), Expect = 8.383e-10
Identity = 66/250 (26.40%), Postives = 102/250 (40.80%), Query Frame = 1
Query:  169 CPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKAL-HLQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCD 912
            CP   H+  C+  V+ C+   L +IP  + Q T ++ ++N   S    T   F         ++KI L   ++  I    F     +  L L+ N L  I    F+ L  L+ L L +N++   H  SF GL NV  LSL+D  +T +    F  +                         ++L  L +  NPFNC C L WL   L  RK+ I       +    +C  PD ++   + D+   DF C+
Sbjct:  513 CP---HKCRCEANVVECSSLKLTKIPERIPQSTAELRLNNNEISILEAT-GMFKKL----THLKKINLSNNKVSEIEDGAFEGAASVSELHLTANQLESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNQITTVSPGAFDTL-------------------------QSLSTLNLLANPFNCNCQLAWLGGWL--RKRKI-------VTGNPRCQNPDFLRQIPLQDVAFPDFRCE 720          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: PXDN (peroxidasin [Source:HGNC Symbol;Acc:HGNC:14966])

HSP 1 Score: 63.929 bits (154), Expect = 4.399e-11
Identity = 47/185 (25.41%), Postives = 98/185 (52.97%), Query Frame = 1
Query:  442 LSHNLLGEIPPDTFKAL-HLQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRL--KLIDVFMTSTSSAKLTCISE 984
            L++N +  IP   F+ L +L++L L  N++    R +F+GL ++ +L L    +  LD + F  + +  +  +  N   +++   F  L E++  L+++ N  +C C + WL  +L +  ++ N  ++      A C YP R++G+ +A +  ++ +C+ PR+  +  D  +TS ++   TC +E
Sbjct:   17 LNNNQIKRIPSGAFEDLENLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLDPDSFQHLPKLERLFLHNNRITHLVPGTFNHL-ESMKRLRLDSNTLHCDCEILWLADLLKTYAESGNAQAA------AICEYPRRIQGRSVATITPEELNCERPRITSEPQDADVTSGNTVYFTCRAE 194          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: pxn-1 (Peroxidasin homolog [Source:UniProtKB/Swiss-Prot;Acc:Q1ENI8])

HSP 1 Score: 58.5362 bits (140), Expect = 1.053e-8
Identity = 81/324 (25.00%), Postives = 129/324 (39.81%), Query Frame = 1
Query:  169 CPSVCHEMACQTG--VLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDL---QINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPEIQSSE--NASLSVLRKSRIDKYKCV 1119
            CP  C    C     V+ C+  GL +IP  + +    +++ N R     L  S+   +     ++E + L   ++  I  N   HL +L+ L L+HN L  IPP    +  L  L L  N  IQF       ++   L  F  +LT+LDF      S R K                  LF+NLP L    ++ NP++C C          S+ KA  L    +   +  C  P  ++ + + ++D     C  P  +       +    KLTC    K  SS  V+WM E+       +   E  +  ++V RK+ ++   C 
Sbjct:   23 CPVEC---TCDKKGLVVDCSSSGLTRIPKNISRNVRSLVIRNNRIHK--LKRSDLEGFN----QLETLVLTHNKIKIIEENVLDHLPELKRLSLAHNELVYIPPLCSDSRPLASLNLKRNH-IQF-------IDEQVLRYFP-DLTQLDFSHNRIQSLRTK------------------LFDNLPALSHAHLHSNPWHCDCR--------ASKVKA--LLQKVKWEKKVYCTNPVELRHQALDEVDDSALTCARPAEE-----SWTGEEIKLTC---AKNSSSKLVVWMYENVEVDSSSLDGYEIHDTVITVPRKTNVNFMTCT 292          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: slt-1 (Slit homolog 1 protein [Source:UniProtKB/Swiss-Prot;Acc:G5EFX6])

HSP 1 Score: 51.9878 bits (123), Expect = 1.157e-6
Identity = 67/257 (26.07%), Postives = 106/257 (41.25%), Query Frame = 1
Query:  145 KTSAHSNPCPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALH-LQFLRLDDNKMIQFHRFSFR-GLNVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDC 909
            KT   +  CP  C    C    + C D GL  +P  L                            PP+    +I L+  ++ SI S+ F +L +L  LDLS N++ EI P  F  LH L  L L  N +      +F    ++  L L    LT +    F  + +     +  N+  ++ +  F+ L  +L  L + +NP  C CNL+WL  + + +    N+ +S      A+C  P R++ K+ A L    F C
Sbjct:  252 KTCETAEICPLPC---TCTGTTVDCRDSGLTYVPTNL----------------------------PPS--TTEIRLEQNQISSIPSHSFKNLKNLTRLDLSKNIITEIQPKAFLGLHNLHTLVLYGNNITDLKSDTFEGLGSLQLLLLNANQLTCIRRGTFDHVPKLSMLSLYDNDIKSISEVTFQNL-TSLSTLHLAKNPLICDCNLQWLAQINLQK----NIETSG-----ARCEQPKRLRKKKFATLPPNKFKC 465          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330730)

HSP 1 Score: 72.0182 bits (175), Expect = 7.993e-13
Identity = 64/249 (25.70%), Postives = 111/249 (44.58%), Query Frame = 1
Query:  169 CPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFK-ALHLQFLRLDDNKMIQFHRFSFRGLNVAE-LSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDC 909
            CP VC   +C    + C+  GL  +P  +     ++ +     +  + T  +F        K+  + L   ++ +I  N F  L  L  LD+S+N++  +    FK A  L+ L+LD+N++      +F+GL   E L+L + NLT L   +F  +                   R R L       ++++NPF C C+L WL+  L          S+ R+    +C  P ++KG+ +ADL  ++F C
Sbjct:   73 CPRVC---SCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYET--DFQRL----TKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLG------------------RLRAL-------RLSDNPFACDCHLSWLSRFL---------RSATRLAPYTRCQSPSQLKGQNVADLHDQEFKC 278          

HSP 2 Score: 67.781 bits (164), Expect = 1.678e-11
Identity = 70/252 (27.78%), Postives = 109/252 (43.25%), Query Frame = 1
Query:  169 CPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASN-CFSHLTDLRVLDLSHNLLGEIPPDTFK-ALHLQFLRLDDNKMIQFHRFSFRGLN-VAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDS 915
            CP++CH   C+   + CT  GL +IP  +   T ++++++                               EL  I+S+  F  L  L  L+L  N L  I P+ F+ A H+Q L+L +NK+ +     F GL+ +  L+L+D           ++IS              V+   F  L  +L  L +  NPFNC C+L W    L  RKK++N  +       A+C  P +V+  QI DL   +F C S
Sbjct:  519 CPAMCH---CEGTTVDCTGRGLKEIPRDIPLHTTELLLNDN------------------------------ELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYD-----------NQIS-------------CVMPGSFEHL-NSLTSLNLASNPFNCNCHLAWFAEWL--RKKSLNGGA-------ARCGAPSKVRDVQIKDLPHSEFKCSS 703          

HSP 3 Score: 50.447 bits (119), Expect = 4.981e-6
Identity = 65/261 (24.90%), Postives = 105/261 (40.23%), Query Frame = 1
Query:  163 NPCPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSS-PHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDD-NKMIQFHRFSFRGLNVAELSL-FDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDC--DSPRLKL 930
            N CP   H   C  G++ C +  L  +P  L   T ++ +     +  P  ++S+F        ++ +I L    +  IA +  S L  L  L L  N + ++P   FK L    L L + N++    + +FR L+   L   +D N+  L    F  +                         +++  + + +NPF C CNLRWL   L   K  I  S        A+C  P R+  ++I  L  + F C  D  R+KL
Sbjct:  293 NSCP---HPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFR-------RLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAM-------------------------KSIKTVHLAKNPFICDCNLRWLADYL--HKNPIETSG-------ARCESPKRMHRRRIESLREEKFKCSWDELRMKL 509          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330729)

HSP 1 Score: 72.0182 bits (175), Expect = 8.147e-13
Identity = 64/249 (25.70%), Postives = 111/249 (44.58%), Query Frame = 1
Query:  169 CPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFK-ALHLQFLRLDDNKMIQFHRFSFRGLNVAE-LSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDC 909
            CP VC   +C    + C+  GL  +P  +     ++ +     +  + T  +F        K+  + L   ++ +I  N F  L  L  LD+S+N++  +    FK A  L+ L+LD+N++      +F+GL   E L+L + NLT L   +F  +                   R R L       ++++NPF C C+L WL+  L          S+ R+    +C  P ++KG+ +ADL  ++F C
Sbjct:   73 CPRVC---SCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYET--DFQRL----TKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLG------------------RLRAL-------RLSDNPFACDCHLSWLSRFL---------RSATRLAPYTRCQSPSQLKGQNVADLHDQEFKC 278          

HSP 2 Score: 68.1662 bits (165), Expect = 1.477e-11
Identity = 70/252 (27.78%), Postives = 109/252 (43.25%), Query Frame = 1
Query:  169 CPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNC-FSHLTDLRVLDLSHNLLGEIPPDTFK-ALHLQFLRLDDNKMIQFHRFSFRGLN-VAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDS 915
            CP++CH   C+   + CT  GL +IP  +   T ++++++                               EL  I+S+  F  L  L  L+L  N L  I P+ F+ A H+Q L+L +NK+ +     F GL+ +  L+L+D           ++IS              V+   F  L  +L  L +  NPFNC C+L W    L  RKK++N  +       A+C  P +V+  QI DL   +F C S
Sbjct:  519 CPAMCH---CEGTTVDCTGRGLKEIPRDIPLHTTELLLNDN------------------------------ELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYD-----------NQIS-------------CVMPGSFEHL-NSLTSLNLASNPFNCNCHLAWFAEWL--RKKSLNGGA-------ARCGAPSKVRDVQIKDLPHSEFKCSS 703          

HSP 3 Score: 50.0618 bits (118), Expect = 5.116e-6
Identity = 65/261 (24.90%), Postives = 105/261 (40.23%), Query Frame = 1
Query:  163 NPCPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSS-PHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDD-NKMIQFHRFSFRGLNVAELSL-FDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDC--DSPRLKL 930
            N CP   H   C  G++ C +  L  +P  L   T ++ +     +  P  ++S+F        ++ +I L    +  IA +  S L  L  L L  N + ++P   FK L    L L + N++    + +FR L+   L   +D N+  L    F  +                         +++  + + +NPF C CNLRWL   L   K  I  S        A+C  P R+  ++I  L  + F C  D  R+KL
Sbjct:  293 NSCP---HPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFR-------RLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAM-------------------------KSIKTVHLAKNPFICDCNLRWLADYL--HKNPIETSG-------ARCESPKRMHRRRIESLREEKFKCSWDELRMKL 509          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330732)

HSP 1 Score: 72.0182 bits (175), Expect = 8.147e-13
Identity = 64/249 (25.70%), Postives = 111/249 (44.58%), Query Frame = 1
Query:  169 CPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFK-ALHLQFLRLDDNKMIQFHRFSFRGLNVAE-LSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDC 909
            CP VC   +C    + C+  GL  +P  +     ++ +     +  + T  +F        K+  + L   ++ +I  N F  L  L  LD+S+N++  +    FK A  L+ L+LD+N++      +F+GL   E L+L + NLT L   +F  +                   R R L       ++++NPF C C+L WL+  L          S+ R+    +C  P ++KG+ +ADL  ++F C
Sbjct:   73 CPRVC---SCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYET--DFQRL----TKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLG------------------RLRAL-------RLSDNPFACDCHLSWLSRFL---------RSATRLAPYTRCQSPSQLKGQNVADLHDQEFKC 278          

HSP 2 Score: 68.1662 bits (165), Expect = 1.477e-11
Identity = 70/252 (27.78%), Postives = 109/252 (43.25%), Query Frame = 1
Query:  169 CPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNC-FSHLTDLRVLDLSHNLLGEIPPDTFK-ALHLQFLRLDDNKMIQFHRFSFRGLN-VAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDS 915
            CP++CH   C+   + CT  GL +IP  +   T ++++++                               EL  I+S+  F  L  L  L+L  N L  I P+ F+ A H+Q L+L +NK+ +     F GL+ +  L+L+D           ++IS              V+   F  L  +L  L +  NPFNC C+L W    L  RKK++N  +       A+C  P +V+  QI DL   +F C S
Sbjct:  519 CPAMCH---CEGTTVDCTGRGLKEIPRDIPLHTTELLLNDN------------------------------ELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYD-----------NQIS-------------CVMPGSFEHL-NSLTSLNLASNPFNCNCHLAWFAEWL--RKKSLNGGA-------ARCGAPSKVRDVQIKDLPHSEFKCSS 703          

HSP 3 Score: 50.0618 bits (118), Expect = 5.116e-6
Identity = 65/261 (24.90%), Postives = 105/261 (40.23%), Query Frame = 1
Query:  163 NPCPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSS-PHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDD-NKMIQFHRFSFRGLNVAELSL-FDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDC--DSPRLKL 930
            N CP   H   C  G++ C +  L  +P  L   T ++ +     +  P  ++S+F        ++ +I L    +  IA +  S L  L  L L  N + ++P   FK L    L L + N++    + +FR L+   L   +D N+  L    F  +                         +++  + + +NPF C CNLRWL   L   K  I  S        A+C  P R+  ++I  L  + F C  D  R+KL
Sbjct:  293 NSCP---HPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFR-------RLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAM-------------------------KSIKTVHLAKNPFICDCNLRWLADYL--HKNPIETSG-------ARCESPKRMHRRRIESLREEKFKCSWDELRMKL 509          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: kek3 (gene:FBgn0028370 transcript:FBtr0300848)

HSP 1 Score: 71.633 bits (174), Expect = 1.041e-12
Identity = 77/300 (25.67%), Postives = 131/300 (43.67%), Query Frame = 1
Query:  169 CPSVCHEMACQTG--VLACTDGGLLQIPPVLHQKTHKI--------IVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPP-DTFKALHLQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHR 1032
            CP+VC E   ++G   + C +  L  IP  L   T  +        ++ +  F++  L              ++K+ L  C L  I  + F  L +L  LDLS NLL  IP    +    L+ LRL  N +++    +F  +  + +L L DC L+ +    F+ +   L+ L L  N+L+ +         +L  L++  N +NC+C+LR L + ++ +    N+ S   IP    C  P R+ G+    LD+ DF C  P++   D          +T     +    P V W+ ++R
Sbjct:   79 CPAVC-ECKWKSGKESVLCLNANLTHIPQPLDAGTQLLDLSGNEIQLIPDDSFATAQL------------LNLQKVYLARCHLRLIERHAFRKLINLVELDLSQNLLSAIPSLALYHVSELRELRLSGNPILRVPDDAFGHVPQLVKLELSDCRLSHIAVRAFAGLESSLEWLKLDGNRLSEVRSGTITSLASLHGLELARNTWNCSCSLRPLRAWMLQQ----NIPSG--IP--PTCESPPRLSGRAWDKLDVDDFAC-VPQIVATDTTAHGVEGRNITMSCYVEGVPQPAVKWLLKNR 356          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: kek3 (gene:FBgn0028370 transcript:FBtr0080752)

HSP 1 Score: 71.633 bits (174), Expect = 1.041e-12
Identity = 77/300 (25.67%), Postives = 131/300 (43.67%), Query Frame = 1
Query:  169 CPSVCHEMACQTG--VLACTDGGLLQIPPVLHQKTHKI--------IVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPP-DTFKALHLQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHR 1032
            CP+VC E   ++G   + C +  L  IP  L   T  +        ++ +  F++  L              ++K+ L  C L  I  + F  L +L  LDLS NLL  IP    +    L+ LRL  N +++    +F  +  + +L L DC L+ +    F+ +   L+ L L  N+L+ +         +L  L++  N +NC+C+LR L + ++ +    N+ S   IP    C  P R+ G+    LD+ DF C  P++   D          +T     +    P V W+ ++R
Sbjct:   79 CPAVC-ECKWKSGKESVLCLNANLTHIPQPLDAGTQLLDLSGNEIQLIPDDSFATAQL------------LNLQKVYLARCHLRLIERHAFRKLINLVELDLSQNLLSAIPSLALYHVSELRELRLSGNPILRVPDDAFGHVPQLVKLELSDCRLSHIAVRAFAGLESSLEWLKLDGNRLSEVRSGTITSLASLHGLELARNTWNCSCSLRPLRAWMLQQ----NIPSG--IP--PTCESPPRLSGRAWDKLDVDDFAC-VPQIVATDTTAHGVEGRNITMSCYVEGVPQPAVKWLLKNR 356          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: pxdn (peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2])

HSP 1 Score: 76.2554 bits (186), Expect = 5.566e-14
Identity = 61/243 (25.10%), Postives = 121/243 (49.79%), Query Frame = 1
Query:  433 VLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRL--KLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPEIQSS------ENASLSVLRKSRIDK--YKCVIKN 1128
            +LDL  N + ++ P +    H ++L    N++    R +F+GL ++ +L L   N+  L+ E FS + +  +  +  N   ++    F  L +++  L+++ N  +C C L WL  +L    ++ N  ++      A C+YP+R++G+ +A L   + +C+ PR+  +  DV +TS ++   TC +E   +  P +IW+   RN     ++        E+ +L +      D+  Y+C+ KN
Sbjct:   53 ILDLRFNKIKDLQPASITFFHFEYLY--KNEIQAIDREAFKGLVSLEQLYLHFNNIESLEPESFSHLPKLERLFLHNNRISHLALGTFSHL-QSMKRLRLDSNALHCDCELLWLADLLKQYAESGNAQAA------ATCDYPNRLQGRSVATLTAHELNCEVPRITSEPQDVDVTSGNTVYFTCRAE--GNPKPQIIWL---RNNNALNMRDDTRLNLLEDGTLMIQDTRETDQGVYQCMAKN 281          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: pxdn (peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2])

HSP 1 Score: 73.1738 bits (178), Expect = 5.158e-13
Identity = 61/233 (26.18%), Postives = 118/233 (50.64%), Query Frame = 1
Query:  466 IPPDTFKAL-HLQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRL--KLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPEIQSS------ENASLSVLRKSRIDK--YKCVIKN 1128
            IP   F+ L +L++L L  N++    R +F+GL ++ +L L   N+  L+ E FS + +  +  +  N   ++    F  L +++  L+++ N  +C C L WL  +L    ++ N  ++      A C+YP+R++G+ +A L   + +C+ PR+  +  DV +TS ++   TC +E   +  P +IW+   RN     ++        E+ +L +      D+  Y+C+ KN
Sbjct:   91 IPRGAFEDLENLKYLYLYKNEIQAIDREAFKGLVSLEQLYLHFNNIESLEPESFSHLPKLERLFLHNNRISHLALGTFSHL-QSMKRLRLDSNALHCDCELLWLADLLKQYAESGNAQAA------ATCDYPNRLQGRSVATLTAHELNCEVPRITSEPQDVDVTSGNTVYFTCRAE--GNPKPQIIWL---RNNNALNMRDDTRLNLLEDGTLMIQDTRETDQGVYQCMAKN 311          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: pxdn (peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2])

HSP 1 Score: 73.1738 bits (178), Expect = 5.311e-13
Identity = 61/233 (26.18%), Postives = 118/233 (50.64%), Query Frame = 1
Query:  466 IPPDTFKAL-HLQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRL--KLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPEIQSS------ENASLSVLRKSRIDK--YKCVIKN 1128
            IP   F+ L +L++L L  N++    R +F+GL ++ +L L   N+  L+ E FS + +  +  +  N   ++    F  L +++  L+++ N  +C C L WL  +L    ++ N  ++      A C+YP+R++G+ +A L   + +C+ PR+  +  DV +TS ++   TC +E   +  P +IW+   RN     ++        E+ +L +      D+  Y+C+ KN
Sbjct:   96 IPRGAFEDLENLKYLYLYKNEIQAIDREAFKGLVSLEQLYLHFNNIESLEPESFSHLPKLERLFLHNNRISHLALGTFSHL-QSMKRLRLDSNALHCDCELLWLADLLKQYAESGNAQAA------ATCDYPNRLQGRSVATLTAHELNCEVPRITSEPQDVDVTSGNTVYFTCRAE--GNPKPQIIWL---RNNNALNMRDDTRLNLLEDGTLMIQDTRETDQGVYQCMAKN 316          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: pxdn (peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2])

HSP 1 Score: 73.1738 bits (178), Expect = 5.543e-13
Identity = 61/233 (26.18%), Postives = 118/233 (50.64%), Query Frame = 1
Query:  466 IPPDTFKAL-HLQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRL--KLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPEIQSS------ENASLSVLRKSRIDK--YKCVIKN 1128
            IP   F+ L +L++L L  N++    R +F+GL ++ +L L   N+  L+ E FS + +  +  +  N   ++    F  L +++  L+++ N  +C C L WL  +L    ++ N  ++      A C+YP+R++G+ +A L   + +C+ PR+  +  DV +TS ++   TC +E   +  P +IW+   RN     ++        E+ +L +      D+  Y+C+ KN
Sbjct:   93 IPRGAFEDLENLKYLYLYKNEIQAIDREAFKGLVSLEQLYLHFNNIESLEPESFSHLPKLERLFLHNNRISHLALGTFSHL-QSMKRLRLDSNALHCDCELLWLADLLKQYAESGNAQAA------ATCDYPNRLQGRSVATLTAHELNCEVPRITSEPQDVDVTSGNTVYFTCRAE--GNPKPQIIWL---RNNNALNMRDDTRLNLLEDGTLMIQDTRETDQGVYQCMAKN 313          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: lrig1 (leucine-rich repeats and immunoglobulin-like domains 1 [Source:ZFIN;Acc:ZDB-GENE-031113-23])

HSP 1 Score: 71.2478 bits (173), Expect = 1.658e-12
Identity = 75/319 (23.51%), Postives = 136/319 (42.63%), Query Frame = 1
Query:  307 HLTYSNFSNYGPPNY----KIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALH-LQFLRLDDNKM---IQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLIDVFMTSTSS-----AKLTCISEPKAHSSPDVIWMAEHRNTYVPEIQSSENASLS---VLRKSRIDKYKCVIKNNNDYVTVVISIHWPVKRVNNASQSLNTL 1212
            +L  ++ SN+ P  +    ++ ++ L +  L  ++   F+ L +L  L L HN +  I    F+ L  L+ L LD N +   I+    +F GL N+ +L+LF   +  +  + FS +       +  N   ++  + F  + +NL  L I  + F C C L W    L++R     +        QA C +P+ +KG  I     + F CD      I V   +T++      +LTC +   + S     W+ +       E+++  +   S   V+  + I   + V  N+      +IS H+     N A  ++N L
Sbjct:  256 YLANNSISNFNPEGWGFCERLRELNLSYNNLTKLSEGSFAKLVNLISLRLGHNSISHITEGAFRGLSSLRTLELDHNDISGTIEDTSGAFTGLENLNKLTLFGNKIKSVAKKAFSGLEALEHLNLGENAIRSIQPEAFSKM-KNLRYLHIQSDSFLCDCQLHWFPDWLLTRGLNPGV--------QATCAHPESLKGTSIYQAPPQSFVCDDLPKPQITVHPVTTAAVLGKDVRLTCTAASSSSSPMTFTWLKDQETLRQAEVENFAHVRASDGGVMEYTTILHLRHVTFNHEGRYQCIISNHFGSSYSNKARVTVNVL 565          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: polr1e (polymerase (RNA) I polypeptide E [Source:Xenbase;Acc:XB-GENE-1003651])

HSP 1 Score: 73.559 bits (179), Expect = 6.509e-13
Identity = 70/277 (25.27%), Postives = 142/277 (51.26%), Query Frame = 1
Query:  340 PPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKAL-HLQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRL--KLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPEIQSSENASLSVL----------RKSRIDKYKCVIKN 1128
            PP+  I  + L+F  +  I +  F HL +L  L L++N +  IP + FK L +L++L L  N++    R +F+GL ++ +L L    +  L+ E F+ + +  +  +  N   +++   F  L E++  L+++ N  +C C + WL  +L    ++ N  ++      A C YP R++G+ ++ +   + +C+ PR+  +  DV +T  ++   TC +E   +  P++IW+   RN    E+   +++ L++L          +++    Y+C+ KN
Sbjct:  120 PPHTTI--LDLRFNRIKDIQTGAFKHLKNLNTLLLNNNQIKRIPSEAFKDLENLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLEPESFNYLPKLERLFLHNNRITHLVPGTFSQL-ESMKRLRLDSNALHCDCEILWLADLLKIYSESGNAQAA------ATCEYPRRLQGRSVSTITPSELNCERPRITSEPQDVDVTFGNTVYFTCRAE--GNPKPEIIWL---RNNN--ELSMKDDSRLNLLNDGTLMIQNTKETDQGIYQCMAKN 380          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: polr1e (polymerase (RNA) I polypeptide E [Source:Xenbase;Acc:XB-GENE-1003651])

HSP 1 Score: 73.1738 bits (178), Expect = 6.648e-13
Identity = 67/272 (24.63%), Postives = 138/272 (50.74%), Query Frame = 1
Query:  340 PPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKAL-HLQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRL--KLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPE---IQSSENASLSVLRKSRIDK--YKCVIKN 1128
            PP+  I  + L+F  +  I +  F HL +L  L L++N +  IP + FK L +L++L L  N++    R +F+GL ++ +L L    +  L+ E F+ + +  +  +  N   +++   F  L E++  L+++ N  +C C + WL  +L    ++ N  ++      A C YP R++G+ ++ +   + +C+ PR+  +  DV +T  ++   TC +E   +  P++IW+  +    + +   +    + +L +      D+  Y+C+ KN
Sbjct:   54 PPHTTI--LDLRFNRIKDIQTGAFKHLKNLNTLLLNNNQIKRIPSEAFKDLENLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLEPESFNYLPKLERLFLHNNRITHLVPGTFSQL-ESMKRLRLDSNALHCDCEILWLADLLKIYSESGNAQAA------ATCEYPRRLQGRSVSTITPSELNCERPRITSEPQDVDVTFGNTVYFTCRAE--GNPKPEIIWLRNNNELSMKDDSRLNLLNDGTLMIQNTKETDQGIYQCMAKN 314          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: polr1e (polymerase (RNA) I polypeptide E [Source:Xenbase;Acc:XB-GENE-1003651])

HSP 1 Score: 73.1738 bits (178), Expect = 7.254e-13
Identity = 67/272 (24.63%), Postives = 138/272 (50.74%), Query Frame = 1
Query:  340 PPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKAL-HLQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRL--KLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPE---IQSSENASLSVLRKSRIDK--YKCVIKN 1128
            PP+  I  + L+F  +  I +  F HL +L  L L++N +  IP + FK L +L++L L  N++    R +F+GL ++ +L L    +  L+ E F+ + +  +  +  N   +++   F  L E++  L+++ N  +C C + WL  +L    ++ N  ++      A C YP R++G+ ++ +   + +C+ PR+  +  DV +T  ++   TC +E   +  P++IW+  +    + +   +    + +L +      D+  Y+C+ KN
Sbjct:   59 PPHTTI--LDLRFNRIKDIQTGAFKHLKNLNTLLLNNNQIKRIPSEAFKDLENLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLEPESFNYLPKLERLFLHNNRITHLVPGTFSQL-ESMKRLRLDSNALHCDCEILWLADLLKIYSESGNAQAA------ATCEYPRRLQGRSVSTITPSELNCERPRITSEPQDVDVTFGNTVYFTCRAE--GNPKPEIIWLRNNNELSMKDDSRLNLLNDGTLMIQNTKETDQGIYQCMAKN 319          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: lgi1 (leucine-rich, glioma inactivated 1 [Source:NCBI gene;Acc:779819])

HSP 1 Score: 70.8626 bits (172), Expect = 2.468e-12
Identity = 54/194 (27.84%), Postives = 83/194 (42.78%), Query Frame = 1
Query:  340 PPNYKIEKIALQFC--ELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKAL-HLQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDC 909
            P  +  + I+L F   E   I    F H+  L++L  + N    I  D F  L HL++L +++NK+    R +FRGL ++  LSL + NL  L  +VF  +                         ++L ++ +  N F+C C L+WL   L      +          Q  C  P   KG++I  L  KDFDC
Sbjct:   57 PRTFLPDVISLSFVRSEFTEIPEGSFLHIPSLQLLLFTSNAFDAISDDAFTGLPHLEYLFIENNKIKSISRNAFRGLKSLIHLSLANNNLQSLPKDVFKGL-------------------------DSLTNVDLRGNAFHCDCKLKWLVEWLDKTNATVE---------QIHCESPPEYKGRKINSLSAKDFDC 216          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: lgi1 (leucine-rich, glioma inactivated 1 [Source:NCBI gene;Acc:779819])

HSP 1 Score: 70.4774 bits (171), Expect = 3.018e-12
Identity = 54/194 (27.84%), Postives = 83/194 (42.78%), Query Frame = 1
Query:  340 PPNYKIEKIALQFC--ELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKAL-HLQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDC 909
            P  +  + I+L F   E   I    F H+  L++L  + N    I  D F  L HL++L +++NK+    R +FRGL ++  LSL + NL  L  +VF  +                         ++L ++ +  N F+C C L+WL   L      +          Q  C  P   KG++I  L  KDFDC
Sbjct:   43 PRTFLPDVISLSFVRSEFTEIPEGSFLHIPSLQLLLFTSNAFDAISDDAFTGLPHLEYLFIENNKIKSISRNAFRGLKSLIHLSLANNNLQSLPKDVFKGL-------------------------DSLTNVDLRGNAFHCDCKLKWLVEWLDKTNATVE---------QIHCESPPEYKGRKINSLSAKDFDC 202          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Pxdn (peroxidasin [Source:MGI Symbol;Acc:MGI:1916925])

HSP 1 Score: 72.4034 bits (176), Expect = 1.007e-12
Identity = 66/265 (24.91%), Postives = 133/265 (50.19%), Query Frame = 1
Query:  370 LQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKAL-HLQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRL--KLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPEIQSS------ENASLSVLRKSRIDK--YKCVIKN 1128
            L+F  +  I    F  L  L  L L++N + +IP   F+ L +L++L L  N++    R +F+GL ++ +L L    +  LD E F  + +  +  +  N   +++   F  L E++  L+++ N  +C C + WL  +L +  ++ N  ++      A C YP R++G+ +A +  ++ +C+ PR+  +  D  +TS ++   TC +E   +  P++IW+   RN     +++       ++ +L +      D+  Y+C+ KN
Sbjct:   66 LRFNRIREIQPGAFRRLRSLNTLLLNNNQIKKIPNGAFEDLENLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLDPESFQHLPKLERLFLHNNRITHLVPGTFSQL-ESMKRLRLDSNALHCDCEILWLADLLKTYAQSGNAQAA------ATCEYPRRIQGRSVATITPEELNCERPRITSEPQDADVTSGNTVYFTCRAE--GNPKPEIIWL---RNNNELSMKTDSRLNLLDDGTLMIQNTQEADEGVYQCMAKN 318          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Slit1 (slit guidance ligand 1 [Source:MGI Symbol;Acc:MGI:1315203])

HSP 1 Score: 70.0922 bits (170), Expect = 4.790e-12
Identity = 76/303 (25.08%), Postives = 124/303 (40.92%), Query Frame = 1
Query:  160 SNPCPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALH-LQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCN-LTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLI----DVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPE 1050
            S  CP++C   +C +G++ C   GL  IP  L +                               + +I L+   + SI    FS    LR +DLS+N + EI PD F+ L  L  L L  NK+    R  F GL   +L L + N +  +  + F ++       +  N   ++    F  L   +  L + +NPF C CNL+WL   L  R   I  +        A+C  P R+  K+I  +  K F C +     I    D  + S  ++ + C  + +  +S  V+  +  + + +PE
Sbjct:  279 SGSCPAMC---SCSSGIVDCRGKGLTAIPANLPET------------------------------MTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSLAKGTFTSL-RAIQTLHLAQNPFICDCNLKWLADFL--RTNPIETTG-------ARCASPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYHLNSECTSDVACPHKCRCEAS--VVECSSLKLSKIPE 536          

HSP 2 Score: 63.929 bits (154), Expect = 4.328e-10
Identity = 66/252 (26.19%), Postives = 105/252 (41.67%), Query Frame = 1
Query:  169 CPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLT--YSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKAL-HLQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCD 912
            CP   H+  C+  V+ C+   L +IP  + Q T ++ ++N   S    T  +   S+       ++KI L   ++  I    F     +  L L+ N L  I    F+ L  L+ L L +N++   H  SF GL NV  LSL+D ++T +    F  +                         + L  L +  NPFNC C+L WL   L  RK+ I       +    +C  PD ++   + D+   DF C+
Sbjct:  513 CP---HKCRCEASVVECSSLKLSKIPERIPQSTTELRLNNNEISILEATGLFKKLSH-------LKKINLSNNKVSEIEDGTFEGAASVSELHLTANQLESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNHITTISPGAFDTL-------------------------QALSTLNLLANPFNCNCHLSWLGDWL--RKRKI-------VTGNPRCQNPDFLRQIPLQDVAFPDFRCE 720          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Slit1 (slit guidance ligand 1 [Source:MGI Symbol;Acc:MGI:1315203])

HSP 1 Score: 69.707 bits (169), Expect = 6.312e-12
Identity = 76/303 (25.08%), Postives = 124/303 (40.92%), Query Frame = 1
Query:  160 SNPCPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALH-LQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCN-LTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLI----DVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPE 1050
            S  CP++C   +C +G++ C   GL  IP  L +                               + +I L+   + SI    FS    LR +DLS+N + EI PD F+ L  L  L L  NK+    R  F GL   +L L + N +  +  + F ++       +  N   ++    F  L   +  L + +NPF C CNL+WL   L  R   I  +        A+C  P R+  K+I  +  K F C +     I    D  + S  ++ + C  + +  +S  V+  +  + + +PE
Sbjct:  279 SGSCPAMC---SCSSGIVDCRGKGLTAIPANLPET------------------------------MTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSLAKGTFTSL-RAIQTLHLAQNPFICDCNLKWLADFL--RTNPIETTG-------ARCASPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYHLNSECTSDVACPHKCRCEAS--VVECSSLKLSKIPE 536          

HSP 2 Score: 63.5438 bits (153), Expect = 5.699e-10
Identity = 66/252 (26.19%), Postives = 105/252 (41.67%), Query Frame = 1
Query:  169 CPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLT--YSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKAL-HLQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCD 912
            CP   H+  C+  V+ C+   L +IP  + Q T ++ ++N   S    T  +   S+       ++KI L   ++  I    F     +  L L+ N L  I    F+ L  L+ L L +N++   H  SF GL NV  LSL+D ++T +    F  +                         + L  L +  NPFNC C+L WL   L  RK+ I       +    +C  PD ++   + D+   DF C+
Sbjct:  513 CP---HKCRCEASVVECSSLKLSKIPERIPQSTTELRLNNNEISILEATGLFKKLSH-------LKKINLSNNKVSEIEDGTFEGAASVSELHLTANQLESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNHITTISPGAFDTL-------------------------QALSTLNLLANPFNCNCHLSWLGDWL--RKRKI-------VTGNPRCQNPDFLRQIPLQDVAFPDFRCE 720          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Slit1 (slit guidance ligand 1 [Source:MGI Symbol;Acc:MGI:1315203])

HSP 1 Score: 69.3218 bits (168), Expect = 8.777e-12
Identity = 76/303 (25.08%), Postives = 124/303 (40.92%), Query Frame = 1
Query:  160 SNPCPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALH-LQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCN-LTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLI----DVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPE 1050
            S  CP++C   +C +G++ C   GL  IP  L +                               + +I L+   + SI    FS    LR +DLS+N + EI PD F+ L  L  L L  NK+    R  F GL   +L L + N +  +  + F ++       +  N   ++    F  L   +  L + +NPF C CNL+WL   L  R   I  +        A+C  P R+  K+I  +  K F C +     I    D  + S  ++ + C  + +  +S  V+  +  + + +PE
Sbjct:  279 SGSCPAMC---SCSSGIVDCRGKGLTAIPANLPET------------------------------MTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSLAKGTFTSL-RAIQTLHLAQNPFICDCNLKWLADFL--RTNPIETTG-------ARCASPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYHLNSECTSDVACPHKCRCEAS--VVECSSLKLSKIPE 536          

HSP 2 Score: 63.1586 bits (152), Expect = 7.510e-10
Identity = 66/252 (26.19%), Postives = 105/252 (41.67%), Query Frame = 1
Query:  169 CPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLT--YSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKAL-HLQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCD 912
            CP   H+  C+  V+ C+   L +IP  + Q T ++ ++N   S    T  +   S+       ++KI L   ++  I    F     +  L L+ N L  I    F+ L  L+ L L +N++   H  SF GL NV  LSL+D ++T +    F  +                         + L  L +  NPFNC C+L WL   L  RK+ I       +    +C  PD ++   + D+   DF C+
Sbjct:  513 CP---HKCRCEASVVECSSLKLSKIPERIPQSTTELRLNNNEISILEATGLFKKLSH-------LKKINLSNNKVSEIEDGTFEGAASVSELHLTANQLESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNHITTISPGAFDTL-------------------------QALSTLNLLANPFNCNCHLSWLGDWL--RKRKI-------VTGNPRCQNPDFLRQIPLQDVAFPDFRCE 720          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Pxdn (peroxidasin [Source:MGI Symbol;Acc:MGI:1916925])

HSP 1 Score: 62.003 bits (149), Expect = 5.208e-10
Identity = 60/244 (24.59%), Postives = 117/244 (47.95%), Query Frame = 1
Query:  433 VLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQ-FHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRL--KLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPEIQSS------ENASLSVLRKSRIDK--YKCVIKN 1128
            +LDL  N + EI P  F+ L      L +N  I+     +F  L N+  L L    +  LD E F  + +  +  +  N   +++   F  L E++  L+++ N  +C C + WL  +L +  ++ N  ++      A C YP R++G+ +A +  ++ +C+ PR+  +  D  +TS ++   TC +E   +  P++IW+   RN     +++       ++ +L +      D+  Y+C+ KN
Sbjct:   63 ILDLRFNRIREIQPGAFRRLRSLNTLLLNNNQIKKIPNGAFEDLENLKYLYLHFNQIETLDPESFQHLPKLERLFLHNNRITHLVPGTFSQL-ESMKRLRLDSNALHCDCEILWLADLLKTYAQSGNAQAA------ATCEYPRRIQGRSVATITPEELNCERPRITSEPQDADVTSGNTVYFTCRAE--GNPKPEIIWL---RNNNELSMKTDSRLNLLDDGTLMIQNTQEADEGVYQCMAKN 294          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|A4IGL7|PXDN_XENTR (Peroxidasin OS=Xenopus tropicalis OX=8364 GN=pxdn PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 3.257e-12
Identity = 67/272 (24.63%), Postives = 138/272 (50.74%), Query Frame = 1
Query:  340 PPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKAL-HLQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRL--KLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPE---IQSSENASLSVLRKSRIDK--YKCVIKN 1128
            PP+  I  + L+F  +  I +  F HL +L  L L++N +  IP + FK L +L++L L  N++    R +F+GL ++ +L L    +  L+ E F+ + +  +  +  N   +++   F  L E++  L+++ N  +C C + WL  +L    ++ N  ++      A C YP R++G+ ++ +   + +C+ PR+  +  DV +T  ++   TC +E   +  P++IW+  +    + +   +    + +L +      D+  Y+C+ KN
Sbjct:   51 PPHTTI--LDLRFNRIKDIQTGAFKHLKNLNTLLLNNNQIKRIPSEAFKDLENLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLEPESFNYLPKLERLFLHNNRITHLVPGTFSQL-ESMKRLRLDSNALHCDCEILWLADLLKIYSESGNAQAA------ATCEYPRRLQGRSVSTITPSELNCERPRITSEPQDVDVTFGNTVYFTCRAE--GNPKPEIIWLRNNNELSMKDDSRLNLLNDGTLMIQNTKETDQGIYQCMAKN 311          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3UQ28|PXDN_MOUSE (Peroxidasin homolog OS=Mus musculus OX=10090 GN=Pxdn PE=1 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 7.046e-12
Identity = 66/265 (24.91%), Postives = 133/265 (50.19%), Query Frame = 1
Query:  370 LQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKAL-HLQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRL--KLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPEIQSS------ENASLSVLRKSRIDK--YKCVIKN 1128
            L+F  +  I    F  L  L  L L++N + +IP   F+ L +L++L L  N++    R +F+GL ++ +L L    +  LD E F  + +  +  +  N   +++   F  L E++  L+++ N  +C C + WL  +L +  ++ N  ++      A C YP R++G+ +A +  ++ +C+ PR+  +  D  +TS ++   TC +E   +  P++IW+   RN     +++       ++ +L +      D+  Y+C+ KN
Sbjct:   66 LRFNRIREIQPGAFRRLRSLNTLLLNNNQIKKIPNGAFEDLENLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLDPESFQHLPKLERLFLHNNRITHLVPGTFSQL-ESMKRLRLDSNALHCDCEILWLADLLKTYAQSGNAQAA------ATCEYPRRIQGRSVATITPEELNCERPRITSEPQDADVTSGNTVYFTCRAE--GNPKPEIIWL---RNNNELSMKTDSRLNLLDDGTLMIQNTQEADEGVYQCMAKN 318          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q92626|PXDN_HUMAN (Peroxidasin homolog OS=Homo sapiens OX=9606 GN=PXDN PE=1 SV=2)

HSP 1 Score: 70.0922 bits (170), Expect = 3.275e-11
Identity = 65/265 (24.53%), Postives = 133/265 (50.19%), Query Frame = 1
Query:  370 LQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKAL-HLQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRL--KLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPEIQSS------ENASLSVLRKSRIDK--YKCVIKN 1128
            L+F  +  I    F  L +L  L L++N +  IP   F+ L +L++L L  N++    R +F+GL ++ +L L    +  LD + F  + +  +  +  N   +++   F  L E++  L+++ N  +C C + WL  +L +  ++ N  ++      A C YP R++G+ +A +  ++ +C+ PR+  +  D  +TS ++   TC +E   +  P++IW+   RN     +++       ++ +L +      D+  Y+C+ KN
Sbjct:   69 LRFNRIREIQPGAFRRLRNLNTLLLNNNQIKRIPSGAFEDLENLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLDPDSFQHLPKLERLFLHNNRITHLVPGTFNHL-ESMKRLRLDSNTLHCDCEILWLADLLKTYAESGNAQAA------AICEYPRRIQGRSVATITPEELNCERPRITSEPQDADVTSGNTVYFTCRAE--GNPKPEIIWL---RNNNELSMKTDSRLNLLDDGTLMIQNTQETDQGIYQCMAKN 321          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q80TR4|SLIT1_MOUSE (Slit homolog 1 protein OS=Mus musculus OX=10090 GN=Slit1 PE=1 SV=2)

HSP 1 Score: 69.3218 bits (168), Expect = 6.139e-11
Identity = 76/303 (25.08%), Postives = 124/303 (40.92%), Query Frame = 1
Query:  160 SNPCPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALH-LQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCN-LTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLI----DVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPE 1050
            S  CP++C   +C +G++ C   GL  IP  L +                               + +I L+   + SI    FS    LR +DLS+N + EI PD F+ L  L  L L  NK+    R  F GL   +L L + N +  +  + F ++       +  N   ++    F  L   +  L + +NPF C CNL+WL   L  R   I  +        A+C  P R+  K+I  +  K F C +     I    D  + S  ++ + C  + +  +S  V+  +  + + +PE
Sbjct:  279 SGSCPAMC---SCSSGIVDCRGKGLTAIPANLPET------------------------------MTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSLAKGTFTSL-RAIQTLHLAQNPFICDCNLKWLADFL--RTNPIETTG-------ARCASPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYHLNSECTSDVACPHKCRCEAS--VVECSSLKLSKIPE 536          

HSP 2 Score: 63.1586 bits (152), Expect = 5.253e-9
Identity = 66/252 (26.19%), Postives = 105/252 (41.67%), Query Frame = 1
Query:  169 CPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLT--YSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKAL-HLQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCD 912
            CP   H+  C+  V+ C+   L +IP  + Q T ++ ++N   S    T  +   S+       ++KI L   ++  I    F     +  L L+ N L  I    F+ L  L+ L L +N++   H  SF GL NV  LSL+D ++T +    F  +                         + L  L +  NPFNC C+L WL   L  RK+ I       +    +C  PD ++   + D+   DF C+
Sbjct:  513 CP---HKCRCEASVVECSSLKLSKIPERIPQSTTELRLNNNEISILEATGLFKKLSH-------LKKINLSNNKVSEIEDGTFEGAASVSELHLTANQLESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNHITTISPGAFDTL-------------------------QALSTLNLLANPFNCNCHLSWLGDWL--RKRKI-------VTGNPRCQNPDFLRQIPLQDVAFPDFRCE 720          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|O75093|SLIT1_HUMAN (Slit homolog 1 protein OS=Homo sapiens OX=9606 GN=SLIT1 PE=1 SV=4)

HSP 1 Score: 68.5514 bits (166), Expect = 9.614e-11
Identity = 80/314 (25.48%), Postives = 123/314 (39.17%), Query Frame = 1
Query:  160 SNPCPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALH-LQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCN-LTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLI----DVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPEIQSSENASLSV 1083
            S  CP++C    C  G++ C   GL  IP  L +                               + +I L+   + SI    FS    LR +DLS+N + EI PD F+ L  L  L L  NK+    R  F GL   +L L + N +  +  + F ++       +  N   ++    F  L   +  L + +NPF C CNL+WL   L  R   I  S        A+C  P R+  K+I  +  K F C +     I    D  + S  ++ + C    K     +V+  +  + T +PE      A L +
Sbjct:  279 SGSCPAMC---TCSNGIVDCRGKGLTAIPANLPET------------------------------MTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSLAKGTFTSL-RAIQTLHLAQNPFICDCNLKWLADFL--RTNPIETSG-------ARCASPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYQLNSECNSDVVCPH--KCRCEANVVECSSLKLTKIPERIPQSTAELRL 547          

HSP 2 Score: 63.5438 bits (153), Expect = 4.026e-9
Identity = 66/250 (26.40%), Postives = 102/250 (40.80%), Query Frame = 1
Query:  169 CPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKAL-HLQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCD 912
            CP   H+  C+  V+ C+   L +IP  + Q T ++ ++N   S    T   F         ++KI L   ++  I    F     +  L L+ N L  I    F+ L  L+ L L +N++   H  SF GL NV  LSL+D  +T +    F  +                         ++L  L +  NPFNC C L WL   L  RK+ I       +    +C  PD ++   + D+   DF C+
Sbjct:  513 CP---HKCRCEANVVECSSLKLTKIPERIPQSTAELRLNNNEISILEAT-GMFKKL----THLKKINLSNNKVSEIEDGAFEGAASVSELHLTANQLESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNQITTVSPGAFDTL-------------------------QSLSTLNLLANPFNCNCQLAWLGGWL--RKRKI-------VTGNPRCQNPDFLRQIPLQDVAFPDFRCE 720          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A5P8I4L0 (PXDN-like protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 964.526 bits (2492), Expect = 0.000e+0
Identity = 477/483 (98.76%), Postives = 479/483 (99.17%), Query Frame = 1
Query:  142 AKTSAHSNPCPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPEIQSSENASLSVLRKSRIDKYKCVIKNNNDYVTVVISIHWPVKRVNNASQSLNTLGVSPNDMIPYLPNANSTLHVRSVFYEKQFTLLEMIGGIVGTFTITMILFLCIYRHLAMTMKRNDKKKWYLSYETAIGSDSQTYDIPNNTAGLYFPGQLLTNPYSPARYLDYNSHTPQSSPNKVAAI 1590
            AKTSAH NPCPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCNLTELDFEVFSEISERLKKLILTNNKLNVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLIDVFMTSTSSAKLTCISEPKAHSSPDVIWM EH+NTYVPEIQS E ASLSVLRKSRIDKYKCVIKNNNDYVTVVISIHWPVKRVNNASQSLNTLGVSPNDMIPYLPNANSTLHVRSVFYEKQFTLLEMIGG+VGTFTITMILFLCIYRHLAMTMKRNDKKKWYLSYETAIGSDSQTYDIPNNTAGLYFPGQLLTNPYSPARYLDYNSHTPQSSPNKVAAI
Sbjct:   17 AKTSAHFNPCPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCNLTELDFEVFSEISERLKKLILTNNKLNVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMTEHKNTYVPEIQSIEKASLSVLRKSRIDKYKCVIKNNNDYVTVVISIHWPVKRVNNASQSLNTLGVSPNDMIPYLPNANSTLHVRSVFYEKQFTLLEMIGGVVGTFTITMILFLCIYRHLAMTMKRNDKKKWYLSYETAIGSDSQTYDIPNNTAGLYFPGQLLTNPYSPARYLDYNSHTPQSSPNKVAAI 499          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: I1ZIL5 (Slit-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 5.058e-68
Identity = 170/453 (37.53%), Postives = 243/453 (53.64%), Query Frame = 1
Query:  169 CPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLS---SSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYV----PEIQSSEN-ASLSVLRKSRIDKYKCVIKNNNDYVTVVISIHWPVKRVNNASQSLNTLGVSPNDMIPYLPNANST-----------LHVRSVFYEKQFTLLEMIGGIVGTFTITMILFLCIYRHLAMTMKRNDKKKWYLSYETAIGSDSQTYDIP 1470
            CP +C++ AC+  +L C   GLLQIP    +   K+I+SNQ F  P LTY+N S YG     ++K+ +  C L SI S  FSHL  L+ LDLS N L  I P+TFK+L L+ L LD N+ +Q  + SFRGL V  LS+ DC+L  L  E   +IS  L  L L +N+L  +   F +LF  L +L +  N FNC+C L+WL   L +R K  + S   S  R+ N   C YP  +KG  I +L +  F C  P+L+ ID+ +TS  +A+++CIS+  ++S   V W   +  + +    P+  S  N AS+ V +KS  D Y C+I N N   TV I I WP          +N+    PN +  +    N T           LHV +  + KQ+T +EM+  I GTF IT++ F+ +Y  +    K +  K     YE  + S+SQTYD+P
Sbjct:   35 CPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNLFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPV-CEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISCISDDMSNS--QVKWRYRYNLSPLFYRYPDQNSGVNQASIIVSKKSEFDFYSCLIINENGNATVDIKIKWPTLNKEYVESPINS---PPNTVNQFNLRNNITKSSVILKEFDKLHV-NYLWIKQYTFIEMVLAICGTFIITLVTFILLYVVINYRRKNSRSKNILKGYEVGVYSESQTYDVP 480          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A0R3TNY6 (Ig-like domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS9134 PE=4 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 4.955e-37
Identity = 142/459 (30.94%), Postives = 215/459 (46.84%), Query Frame = 1
Query:  193 ACQTGVLACTDGGLLQ-IPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCNLTELDFEVFSEI--SERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRI--------PNQAQ--CNYPDRVKGKQIADLDLKDFDCDSPRLKLIDVFMTS-------TSSAKLTCISEPKAHSSPD--VIWMAEHR--NTYVPEIQSSENASLSVLR----KSRIDK------------YKCVIKNNNDYVTVVISIHWPVKRVNNASQSLNTLGVSPNDM----IPYLPNAN---------STLHVRSVFYEKQFTLLEMIGGIVGTFTITMILFLCIYRHLAMTMKRNDKK 1410
             C  G ++C + G L  +P  L     K+I+ +QRF S  L+  N S+Y  P   I+++ +  C L +I S  FS L  L  LD+S N L  I  +TF  L L  LRLDDN+ +     +F  L V+ LS+ +C L  L FEVF  +  S  L  L LT+N L  +D RF   F NL  L + +NPF C C L WL+  L  +++  N  +   I        P+     C  P R++GKQI  L   DF C  P++K ++V  +S       T +     + +  A  SP+  + W    R  N  VP +  S++ S  V+     +S + K            + C+  +     +  +S+ WP      A Q  + +   P+D     +P   +A+          T  +   F+ K+FT+LE+IG +VGTFT T++LFL  Y  L M  ++   K
Sbjct:   37 GCIYGSISCQEAGRLHMLPNDLPPGIRKVIIVSQRFDSQFLSRQNISSYSLPGTVIQELTIMDCGLRAIESRTFSGLNSLTKLDVSKNSLSRIQGNTFSGLRLDLLRLDDNQGLTLDAEAFENLTVSSLSMQNCGLRSLSFEVFRPLLQSGTLTTLRLTSNSLTTLDIRFEPFFRNLSFLSLAKNPFTCDCKLMWLSRTLQRKRREDNDDAFPMINDDILLIEPDDDHPICESPSRLRGKQIVTLASTDFYCGPPQMKALEVDFSSFRVGGGETVNTTAGIVIKCAAQGSPEMQLAWFQRDRWGNGLVP-LSGSKHVSPGVVEVSISRSLLAKNSTGGSEELGELFTCMGIDTYGNTSADLSLRWP------AFQPTSIVPSQPSDKRNSPVPPAGDADYLEVDQKSFKTDRLDEFFFMKKFTVLELIGAVVGTFTATIMLFLMGYILLYMRHRQQYPK 488          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: W6U6F3 (Immunoglobulin superfamily member OS=Echinococcus granulosus OX=6210 GN=EGR_08348 PE=4 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 1.165e-36
Identity = 136/450 (30.22%), Postives = 214/450 (47.56%), Query Frame = 1
Query:  193 ACQTGVLACTDGGLLQ-IPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCNLTELDFEVFSEI--SERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKR--------IPNQAQ--CNYPDRVKGKQIADLDLKDFDCDSPRLKLI-----DVFMTSTSSAKLTCISEPK--AHSSPDVIWMAEHRNT------YVPEIQSSENASLSV-LRKSRIDK------------YKCVIKNNNDYVTVVISIHWPVKRVNNASQSLNTLGVSPNDMIP------YLPNANSTL---HVRSVFYEKQFTLLEMIGGIVGTFTITMILFLCIYRHLAMTMKR 1398
             C  G ++C +  LL  +P  L     K+I+ +QRF S  L+  N S+Y  P   I ++ +  C L +I +  FS L+ L  LDLS N L  I   TF  L L  LRLDDN+ +     +F  L V+ LS+ +C L  L +EVF  +  S  L  L LT+N L  +D RF   F NL  L +  NPF C C L WL+  L  +++A +  + +R        +P+     C  P+R++GKQI  L  +DF C  P+++ +     D+ +  + +  +T +   K  A  SP++      R+        +P ++   +  + V +  S + K            + C+  +     +  +S+ WP   + +   S  T   + N M P      YL N        H+   F+ K+FT+LE+IG +VGTFT T++LFL  Y  L M  ++
Sbjct:   37 GCTYGSISCQEADLLHMLPNDLPNGIEKVIIVSQRFDSQFLSRQNISSYTLPGVNIHELTIMHCGLRAIEAGTFSGLSSLTKLDLSKNSLSRIQGHTFSGLRLDLLRLDDNQGLTLDSEAFENLTVSSLSMQNCGLRSLSYEVFQPLVQSRSLTTLRLTSNSLTTLDARFEPFFRNLSFLSLARNPFVCDCKLVWLSQTLQRKRRADSDDAFRRLNDDRLLIVPDDDHPVCESPNRLRGKQIVSLSTRDFFCGPPQMRTLEVDFSDLRVGQSETFNMTGVVLIKCAAQGSPEMQLAWFRRDGRGDEPIRLPGLRQVASGVVEVSISHSLLAKNSNSETEDAGQLFTCLGVDTYGNTSADLSLRWPALPLLSPLPSSPTSN-NRNPMEPSSGDSKYLNNDKGYFQSDHLDEFFFMKKFTILELIGAVVGTFTATILLFLMGYILLYMRHRQ 485          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A0R3VU84 (Ig-like domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS857 PE=4 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 5.791e-36
Identity = 137/457 (29.98%), Postives = 216/457 (47.26%), Query Frame = 1
Query:  193 ACQTGVLACTDGGLL-QIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCNLTELDFEVFSEI--SERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKA--------INLSSSKRIPNQAQ--CNYPDRVKGKQIADLDLKDFDCDSPRLKLI-----DVFMTSTSSAKLTCISEPK--AHSSPD--VIWMAEHRN----TYVPEIQSSENASLSV-------LRKSRIDK------YKCVIKNNNDYVTVVISIHWPVKRVNNASQSLNTLGVSPNDMIPYLPNANSTLHVRS------------VFYEKQFTLLEMIGGIVGTFTITMILFLCIYRHLAMTMKRNDKK 1410
             C  G ++C +  LL  +P  L +   KII+ +QRF S  L+  N S Y  P   I+++ +  C L +I +  FS L+ L  LDLS N L  I   TF  L L  LRLDDN+ +     +F  L V+ LS+ +C L  L +E+F  +  S  L  L LT+N L  +D RF  LF NL  L +  NPF C C L WL+  L  +++A        IN      +P+     C  P+R++GKQI  L   DF C  P+++ +     D+ +  + +  +T +   K  A  SP+  ++W    R     T +P ++      + V        + S I+       + C+  +     +  +S+ WP   + +   S  T     N+  P  P++ ++ ++               F+ K+FT+LE+IG +VGTFT T++LFL  Y  L M  ++   K
Sbjct:   38 GCTYGSISCQEADLLYMLPNDLPKGIKKIIIVSQRFDSQFLSRQNISAYTLPGVNIQELTIMHCGLRAIEAGTFSGLSSLTKLDLSKNSLSRIQGHTFSGLRLHLLRLDDNQGLTLDSEAFENLTVSSLSMQNCGLRSLSYEIFRPLLRSRSLTTLRLTSNSLTTLDARFEPLFRNLSFLSLARNPFICDCKLIWLSRTLQRKRRADSDDAFPRINDDRLLSVPDDDHPVCESPNRLRGKQIVSLSTSDFFCGPPQMRALEVDFSDLRVGRSETFNMTGVVLIKCAAQGSPEMQLVWFRRDRRGGEPTRLPGLRQIAPGVVEVSISHSLLAKNSNIETGDAGELFTCLGMDTYGNTSADLSLRWPTLPLPSPLPSSPTS----NNRKPMEPSSGNSRNLDGDKGQFQSDRLDEFFFMKKFTILELIGAVVGTFTATILLFLMGYILLYMRHRQQYPK 490          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: pxdn (peroxidasin [Source:NCBI gene;Acc:103028918])

HSP 1 Score: 70.8626 bits (172), Expect = 2.135e-12
Identity = 60/233 (25.75%), Postives = 116/233 (49.79%), Query Frame = 1
Query:  466 IPPDTFKAL-HLQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRL--KLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPEIQSS------ENASLSVLRKSRIDK--YKCVIKN 1128
            IP   F+ L +L++L L  N++    R +F+GL ++ +L L   N+  L+ E F+ + +  +  +  N   ++    F  L + +  L+++ N  NC C L WL  +L    ++ N  ++      A C +P R++G+ +A L  ++ +C+ PR+  +  DV +TS ++   TC +E   +  P +IW+   RN     ++        E+ +L +      D+  Y+C+ KN
Sbjct:   97 IPRAAFEDLENLKYLYLYKNEIQSIDRQAFKGLVSLEQLYLHFNNIEALEPESFTHLPKLERLFLHNNRITHLTLGTFSHL-QAMKRLRLDSNTLNCDCELLWLADLLKQYAESGNAQAA------ATCEFPSRLQGRSVATLTAEELNCEVPRITSEPQDVDVTSGNTVYFTCRAE--GNPKPQIIWL---RNNNALNMRDDTRLNLLEDGTLMIQDTRETDQGVYQCMAKN 317          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lrig1 (leucine rich repeats and immunoglobulin like domains 1 [Source:NCBI gene;Acc:103023104])

HSP 1 Score: 68.5514 bits (166), Expect = 1.012e-11
Identity = 72/303 (23.76%), Postives = 129/303 (42.57%), Query Frame = 1
Query:  307 HLTYSNFSNYGPPNY----KIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALH-LQFLRLDDNKM---IQFHRFSFRGLN-VAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLIDVFMTSTSS-----AKLTCISEPKAHSSPDVIWMAEHRNTYVPEIQ------SSENASLSV-----LRKSRID---KYKCVIKNN 1131
            HL+ ++ S++ P  +    ++ ++ L    L  +    F+ L +L+ L LSHN +  I    F+ L  L+ L LD N +   I+    +F GL+ + +L+LF   +  +    F  +       +  N+  +++ + F  + +NL  L+I  + F C C L W    +V+R     +        QA C +P+ +KG  I  +  + F CD      I V    T+       +LTC +   + S     W  +       E++      SS+   +       LR    D   +Y+CVI N+
Sbjct:  284 HLSNNSISSFNPEGWGFCERLRELHLVHNNLSKLTEGSFAKLVNLQTLRLSHNTISHIAEGAFRGLSSLRLLELDHNDISGTIEDTNGAFAGLDSLRKLTLFGNRIKSVAKRAFLGLEGLEHLNLGENSIRSILPEAFSKM-KNLRSLEILSDSFLCDCQLHWFPEWVVNRGLQAEV--------QATCAHPESLKGTSIFQVPAQSFVCDDLPKPQITVHPVQTAGVVGKDVRLTCTAASSSSSPMTFTWRKDQEPLRQAEVENFAHVRSSDGGVMEYTTVLHLRDITFDHEGRYQCVISNH 577          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000025613.2 (leucine-rich repeat transmembrane protein FLRT1 [Source:NCBI gene;Acc:103040256])

HSP 1 Score: 68.1662 bits (165), Expect = 1.210e-11
Identity = 52/174 (29.89%), Postives = 75/174 (43.10%), Query Frame = 1
Query:  394 IASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQFHRFSFRGLN-VAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCD 912
            IA + FS L++L  L L  N L + PP    + HLQ L L DN +I   R S  G+  +  L L   NLT L   +F ++                         E+L  L +  NP++C CNLRWL   L ++   I +           C  P+RV+   + DL  +  DC+
Sbjct:  229 IADDTFSRLSNLTELSLVRNSL-QTPPLNLPSAHLQRLSLQDNALIHMPRGSLDGMRRLQRLDLSGNNLTTLPRGLFRDL-------------------------ESLGQLLVRGNPWHCGCNLRWLYDWLEAKGNTITVRG-------LTCQSPERVRDMPLRDLTSQMDDCE 369          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lrig1 (leucine rich repeats and immunoglobulin like domains 1 [Source:NCBI gene;Acc:103023104])

HSP 1 Score: 65.0846 bits (157), Expect = 1.292e-10
Identity = 70/300 (23.33%), Postives = 121/300 (40.33%), Query Frame = 1
Query:  307 HLTYSNFSNYGPPNY----KIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALH-LQFLRLDDNKMIQFHRFSFRGLNVAE-LSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLIDVFMTSTSS-----AKLTCISEPKAHSSPDVIWMAEHRNTYVPEIQ------SSENASLSV-----LRKSRID---KYKCVIKNN 1131
            HL+ ++ S++ P  +    ++ ++ L    L  +    F+ L +L+ L LSHN +  I    F+ L  L+ L L  N++    + +F GL   E L+L + ++  +  E FS++                         +NL  L+I  + F C C L W    +V+R     +        QA C +P+ +KG  I  +  + F CD      I V    T+       +LTC +   + S     W  +       E++      SS+   +       LR    D   +Y+CVI N+
Sbjct:  284 HLSNNSISSFNPEGWGFCERLRELHLVHNNLSKLTEGSFAKLVNLQTLRLSHNTISHIAEGAFRGLSSLRLLTLFGNRIKSVAKRAFLGLEGLEHLNLGENSIRSILPEAFSKM-------------------------KNLRSLEILSDSFLCDCQLHWFPEWVVNRGLQAEV--------QATCAHPESLKGTSIFQVPAQSFVCDDLPKPQITVHPVQTAGVVGKDVRLTCTAASSSSSPMTFTWRKDQEPLRQAEVENFAHVRSSDGGVMEYTTVLHLRDITFDHEGRYQCVISNH 550          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lgi1a (leucine-rich glioma-inactivated protein 1-like [Source:NCBI gene;Acc:103024095])

HSP 1 Score: 63.5438 bits (153), Expect = 2.635e-10
Identity = 56/206 (27.18%), Postives = 87/206 (42.23%), Query Frame = 1
Query:  340 PPNYKIEKIALQFCE--LVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKAL-HLQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDC---DSPRLKLID 936
            P ++  + I+L F +     I    F H   L +L  + N    I  D F  L HL++L +++N++     F+FRGL ++  LSL + NL  L  ++F  +                         E L  + +  N FNC C L+WL   +      ++         Q  CN P   +GK+I DL  + FDC   D   LK +D
Sbjct:   51 PRSFPPDVISLSFVKSGFTEIPKESFIHTPALHLLLFTANTFDSINEDAFLGLPHLEYLFIENNQIKSISPFAFRGLKSLIHLSLANNNLESLPKDLFKGM-------------------------EALTKVDLRGNLFNCDCKLKWLVDWIYHTNATVD---------QIYCNGPAAYQGKRINDLTPQSFDCITTDFSMLKSLD 222          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: islr2 (immunoglobulin superfamily containing leucine-rich repeat 2 [Source:ZFIN;Acc:ZDB-GENE-050320-95])

HSP 1 Score: 64.6994 bits (156), Expect = 3.039e-11
Identity = 54/187 (28.88%), Postives = 84/187 (44.92%), Query Frame = 1
Query:  382 ELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKAL-HLQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQ---INENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKL 930
            ELVSI     + L  LR LDLS+N L +   +  + L  LQ L+L++N +++  R +F        +L D     L   +F+ I E                      FENL  L    + ENP  C+C  RWL + L     +I++ S + I     C  PD +KG+ +    + D +C +P ++L
Sbjct:   89 ELVSIEKGTLAGLVQLRNLDLSNNQLADFSWEDLRNLTALQVLKLNNNNLVRLPRDAFE-------TLTDLRSLRLHHNLFATIEEGT--------------------FENLHALSHLLLYENPLRCSCKARWLPAWL--NTTSIDIPSKENI----ACAEPDELKGQAVQ--QMPDVECVAPTVRL 240          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: pxdn (peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2])

HSP 1 Score: 60.077 bits (144), Expect = 9.837e-10
Identity = 62/262 (23.66%), Postives = 124/262 (47.33%), Query Frame = 1
Query:  370 LQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALH-LQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRL--KLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPEIQSS---ENASLSVLRKSRIDK--YKCVIKN 1128
            L+F  +  I    F  L +L  L L++N +  IP   F+ L  L++L L  N++    R +F+GL ++ +L +   ++  L+   F ++ +  +  +  N    +    F  L  +L  L+++ N   C C L WL  +L +       + S      A C +P R++G+ ++ +  ++F C+SPR+  +  DV +T  ++  L C +E   +  P +IW+       + E +     ++ +L +      D+  Y+C+ +N
Sbjct:    6 LRFNRIREIPPGAFKKLKNLNTLLLNNNHIKRIPRRAFEDLESLKYLYLYKNEIQSIDRHAFKGLVSLEQLYIHFNHIEVLEPNTFVDLPKLERLFLHNNRLSRIATGTFTQL-SSLRRLRLDSNRLVCDCELVWLAELLRA------FAGSGGTLAAATCEHPRRLQGRSVSSITAQEFHCESPRITSEPHDVDVTPGNTVYLRCRAE--GNPKPAIIWLHNSNEIAMAEDERRNLLQDGTLMIRDTRHTDQGTYQCMARN 258          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000079.1 (pep scaffold:Pmarinus_7.0:GL476403:206014:206980:-1 gene:ENSPMAG00000000071.1 transcript:ENSPMAT00000000079.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.6102 bits (135), Expect = 2.960e-9
Identity = 69/259 (26.64%), Postives = 107/259 (41.31%), Query Frame = 1
Query:  145 KTSAHSNPCPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLT--------------YSN----FSNYGPPNYK----------------------IEKIALQFCELVS--IASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQFHRFSFRGLN-VAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSR 792
            +T+A S  CP+VC    C +G + C D GL  +P  L +    I + N R ++  L               Y N    F  + PPN +                      +EK+ L    + S  I    F     L++L LS N L  +P    + L  + LRLDDN++ +     F  L  ++ L+L D  ++ L   VF  + +  +  +  N   ++    F  L E+L  L    NP++C C L WL + L SR
Sbjct:    5 ETAADS--CPAVCR---CNSGFIYCNDRGLTAVPSGLPRDATTIYLQNNRITNAGLPAMLQALSSVEVLYLYDNQLEEFPAHLPPNLRELHLQENNIEVVPGAVLERTPFLEKLHLNDNSVSSAGIEPATFHGTPRLKLLFLSRNHLSSVPRGLPRGL--EELRLDDNRISRIPDRIFGQLTYLSRLALDDNQISRLPPGVFYGLKQLQRIDLSGNGLRSLSQGSFNGL-ESLSHLSACNNPWHCDCGLTWLRNWLRSR 255          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: tlr7 (toll-like receptor 7 [Source:ZFIN;Acc:ZDB-GENE-040219-11])

HSP 1 Score: 55.0694 bits (131), Expect = 3.892e-8
Identity = 52/170 (30.59%), Postives = 77/170 (45.29%), Query Frame = 1
Query:  394 IASNCFSHLTDLRVLDLSHNLLGEIPPDTFKAL-HLQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRIL-FENLPDLQINENPFNCTCN----LRWLNSVLVSRKKAINLSSSKRIPNQAQCNYP-DRVKGKQIA 882
            + ++ F HL  L+VL++SHN L  IP D    L HLQ L L  N + Q    S    ++ +L + + N+  +  +    +       I  NN      +RF I   ++L  LQ++ NPF CTC+    L W+NS  V   K         +    +C YP D   GK I 
Sbjct:  556 LKNSVFVHLKKLKVLNISHNRLTRIPWDELAKLEHLQQLDLSYNHLTQLSDVS-NSTSITKLIMHNNNIAFISADFVKSMRRLTVLDIRRNNLTAESQERFSIHNMKHLEGLQLSGNPFLCTCSNVWCLSWINSTTVIIPK---------LATNVKCKYPLDTFSGKNIG 715          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: LGI1 (leucine rich glioma inactivated 1 [Source:HGNC Symbol;Acc:HGNC:6572])

HSP 1 Score: 54.299 bits (129), Expect = 4.143e-8
Identity = 50/194 (25.77%), Postives = 78/194 (40.21%), Query Frame = 1
Query:  340 PPNYKIEKIALQF--CELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKAL-HLQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDC 909
            P N  ++  +L F   +   IA+  FSHL  L VL L  +    I  D FK L  L +L +++N + +  R +FRGL  +  LSL +  L  L  +VF  +                         + + D+ +  N  +C C ++WL S L S   ++         +   C  P    G+    L   DF C
Sbjct:   46 PRNLPLDATSLTFDDADFNQIANGTFSHLPTLHVLLLGSSSF-SIRDDAFKGLVKLHYLFIENNIIDEISRNAFRGLKTLTHLSLANNKLRSLPRDVFKGL-------------------------DAMTDVDLRGNALHCDCKMKWLVSWLHSTNASV---------HDITCASPPEFAGRSTRSLSASDFSC 204          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO47109 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNB0])

HSP 1 Score: 65.0846 bits (157), Expect = 3.749e-11
Identity = 59/221 (26.70%), Postives = 96/221 (43.44%), Query Frame = 1
Query:  424 DLRVLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQF-HRFSFRGLNVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVP----EIQSSENA 1071
            ++ +LDL  NLL     D F  L L+ LRLD NK+ +    F+  G  + EL +    L E+  +   ++    +  +  NN   +     R + + L  + ++ NP +C C L WL  VL SR+  ++LSS    P    C  P  VKG+    LD + F C   +            +    C +E + ++  ++    E  NT+      E + SEN 
Sbjct:  215 NITLLDLGDNLLEVFEVDAFDGLSLRKLRLDGNKLDEIPEAFAKVGHFLQELDMSGNYLHEITSDQLLDLHAIERLDLNENNISKIRIGALRGM-KKLRQISLSGNPLSCDCRLVWLKHVLDSRQDQLHLSS----PQSTTCASPASVKGQTFLGLDARSFLCTCAQCVAESERCFGRQNTSCRCDTEWRGNTCTNICARGEIVNTFCAYIAGECRCSENC 430          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO48179 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK32])

HSP 1 Score: 53.5286 bits (127), Expect = 2.094e-7
Identity = 50/192 (26.04%), Postives = 87/192 (45.31%), Query Frame = 1
Query:  355 IEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALH-LQFLRLDDNKM---IQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDS 915
            + K+ L+   L  I    F HL  L+VL+L++N +  I   +F  L  L+ L L +N +   ++     FRGL N+A L L    +T +    F  +       +  N   ++ +  F+ + + L  L +N +   C C ++W  S L SR        S R   +A+C +P  +  K + ++    F CD+
Sbjct:  348 LRKLNLERNRLSHIQDTTFKHLLALKVLNLANNRIYHISQGSFSDLRSLEGLDLSNNDISWTVEEMNGPFRGLTNLASLRLDGNRITAIAATAFLGLENIKYLNLSANIITSIQENSFQGM-DKLQKLWLNTSQLMCDCKIKWFGSWLRSRP-------STRHTVRARCLHPQTLYMKSVFNITPDAFVCDT 531          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO31669 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXA1])

HSP 1 Score: 51.6026 bits (122), Expect = 6.728e-7
Identity = 64/278 (23.02%), Postives = 113/278 (40.65%), Query Frame = 1
Query:  385 LVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALH-LQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCD------SPRLKLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPEIQSS------ENASLSVLRKSRIDKYKCVIKNNNDYVTVVISIHWPVK 1176
            L  +  + FS L  LR L L  N + +I P TF +L  L  L LD N++    R +  GL NV ++ ++   L  +  + F    +    L      +  + +R R  F N+       N  +C CN  W    L+S     +++          C  P R+KG  + +L+  D  CD      SP+ KL+  +     S +L C      ++     W        + ++ +       + AS+S LR   + +Y C+ +N   +    + ++  V+
Sbjct:  179 LTGLTRSMFSGLKSLRELYLQRNQIQDIEPWTFTSLKSLASLYLDSNQLTVISRDTLLGLTNVKDIHVYFNKLRYVARDAFKPNPQ----LTRIVWDVPALFRRTRPEFANMVG-----NMLHCDCNALWFRDWLISHAYTRDVT----------CQTPPRLKGVLLGNLNDSDIKCDPVVVTVSPKKKLVREW----ESVELYC----NVNTGAVYTWTVNGSAVVLDDLHTINPLGTLQIASVSKLRD--VGEYVCIARNAAGFGAASLELYIGVR 427          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: flrt1b (leucine-rich repeat transmembrane protein FLRT1 [Source:NCBI gene;Acc:105354870])

HSP 1 Score: 67.0106 bits (162), Expect = 2.782e-11
Identity = 50/176 (28.41%), Postives = 76/176 (43.18%), Query Frame = 1
Query:  394 IASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSP 918
            IA + FS L++L  L L  N L + PP    + HL  L L DN M    R +  G+ ++ +L L   NLT L   +F +                          E+L  L +  NP+ C+CNL WL++ L  R  A+ +           C  PD V+G+ + D+      C++P
Sbjct:  231 IADDTFSRLSNLTELSLVRNAL-QSPPVNLPSAHLVRLHLQDNGMTHIPRGTLDGMRHLQKLDLSGNNLTTLPRGLFRDA-------------------------ESLEMLLLRGNPWYCSCNLHWLHAWLHGRGSAVTVRG-------LTCQGPDSVRGQAVKDITSLMEQCEAP 373          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: pxdn (peroxidasin [Source:NCBI gene;Acc:101162089])

HSP 1 Score: 66.6254 bits (161), Expect = 4.684e-11
Identity = 55/223 (24.66%), Postives = 110/223 (49.33%), Query Frame = 1
Query:  493 HLQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRL--KLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPEIQSS------ENASLSVLRKSRIDK--YKCVIKN 1128
            +L++L L  N++    R +F+GL ++ +L L   N+  L+ E FS + +  +  +  N    ++   F  L   +  L+++ N  NC C + WL  +L    ++ N  ++      A C++P R++G+ +A L  ++ +C+ PR+  +  DV +T  ++   TC +E   +  P +IW+   RN     ++        E+ +L +      D+  Y+C+ KN
Sbjct:  109 NLKYLYLYKNEIQSIDRQAFKGLVSLEQLYLHFNNIESLEPESFSHLPKLERLFLHNNRITQLVPGTFSHL-SAMKRLRLDSNALNCNCEVLWLADLLKLYAESGNAQAA------ATCDHPSRLQGRSVATLTAEELNCELPRITSEPQDVDVTLGNTVYFTCRAE--GNPKPQIIWL---RNNNALNMRDDSRLNLLEDGTLMIQDTRETDQGVYQCMAKN 319          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: adgra2 (adhesion G protein-coupled receptor A2 [Source:NCBI gene;Acc:101174752])

HSP 1 Score: 65.0846 bits (157), Expect = 1.350e-10
Identity = 50/181 (27.62%), Postives = 80/181 (44.20%), Query Frame = 1
Query:  382 ELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKAL-HLQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSP 918
            ++ ++ +  F  LT L  LDL HNL+  I P  F+ L  L+ L L +N++       F+GL N+A+L+L    ++ LD EVF E+                          +L  +  N +   C C LRW+ + L SR        S +I ++  C YP  ++ + +  L      CD P
Sbjct:   99 KIQTLKNGSFVGLTALERLDLKHNLISTIMPGAFQGLSELRRLDLSNNRIGCLTGNMFQGLTNLAKLNLSGNIISTLDSEVFEEL-------------------------PSLKRVNFNSDYLTCDCGLRWVPNFLQSR--------SVQIGSETLCAYPSTLRREPLNRLKESQLSCDGP 246          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: slit1a (slit guidance ligand 1 [Source:NCBI gene;Acc:101164917])

HSP 1 Score: 65.0846 bits (157), Expect = 1.371e-10
Identity = 68/257 (26.46%), Postives = 108/257 (42.02%), Query Frame = 1
Query:  151 SAHSNP-CPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALH-LQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCD 912
            + +S+P CP  C    C++ V+ C++  L +IP  +   T ++ ++N   +S     + F N      +++KI L   ++  I    F   + +  L L+ N +  +    F+ L  L+ L L +NK+   H  SF GL NV  LSL+D  LT +    F  +                         + L  L +  N FNC C L WL   L SRK          +    +C  P  +K   + D+ L DF CD
Sbjct:  508 ACNSDPVCPPKCR---CESNVVDCSNLKLTKIPEHIPSSTSELRLNNNEITSLDANGA-FKNLA----QLKKINLSNNKITEIEDGTFEGASAVIELHLTANQIDSVRSGMFRGLEGLRMLMLRNNKISCVHNDSFTGLHNVRLLSLYDNQLTTITPGAFDTL-------------------------QTLSTLNLLANSFNCDCRLAWLGDWLRSRKI---------VTGNPRCQRPAFLKEIPLQDVALPDFRCD 722          

HSP 2 Score: 60.8474 bits (146), Expect = 2.998e-9
Identity = 74/306 (24.18%), Postives = 116/306 (37.91%), Query Frame = 1
Query:  151 SAHSNPCPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALH-LQFLRLDDNKMIQFHRFSFRG-LNVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLI----DVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPE 1050
            S     CP++C    C   ++ C   GL  IP  L     +I                         ++E+  ++     S+    FS    LR +DLS+N + EI PD F+ L  L  L L  NK+    +  F G   +  L L    +  +    F ++       +  N    +    F  L   +  L + +NPF C CNL+WL   L  R   I  S        A+C  P R+  K+I  +  K F C +    +I    DV +    ++   C   PK     +V+  +  + T +PE
Sbjct:  278 SIGGGSCPAMC---TCSNNIVDCRGKGLTAIPANLPDNMAEI-------------------------RLEQNGIK-----SVPPGAFSSYKKLRRIDLSNNQISEIAPDAFQGLRSLNSLVLYGNKITDLPKGVFDGLYALQLLLLNANKIHCIRANTFQDLQNLSLLSLYDNKIQTLAKGTFTSL-RAIQTLHLAQNPFICDCNLKWLADYL--RSNPIETSG-------ARCASPRRLANKRIGQIKSKKFRCSAKEQYVIPGTEDVRLNDACNSDPVC--PPKCRCESNVVDCSNLKLTKIPE 538          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: slit1a (slit guidance ligand 1 [Source:NCBI gene;Acc:101164917])

HSP 1 Score: 65.0846 bits (157), Expect = 1.419e-10
Identity = 68/257 (26.46%), Postives = 108/257 (42.02%), Query Frame = 1
Query:  151 SAHSNP-CPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALH-LQFLRLDDNKMIQFHRFSFRGL-NVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCD 912
            + +S+P CP  C    C++ V+ C++  L +IP  +   T ++ ++N   +S     + F N      +++KI L   ++  I    F   + +  L L+ N +  +    F+ L  L+ L L +NK+   H  SF GL NV  LSL+D  LT +    F  +                         + L  L +  N FNC C L WL   L SRK          +    +C  P  +K   + D+ L DF CD
Sbjct:  509 ACNSDPVCPPKCR---CESNVVDCSNLKLTKIPEHIPSSTSELRLNNNEITSLDANGA-FKNLA----QLKKINLSNNKITEIEDGTFEGASAVIELHLTANQIDSVRSGMFRGLEGLRMLMLRNNKISCVHNDSFTGLHNVRLLSLYDNQLTTITPGAFDTL-------------------------QTLSTLNLLANSFNCDCRLAWLGDWLRSRKI---------VTGNPRCQRPAFLKEIPLQDVALPDFRCD 723          

HSP 2 Score: 58.9214 bits (141), Expect = 1.059e-8
Identity = 76/308 (24.68%), Postives = 116/308 (37.66%), Query Frame = 1
Query:  151 SAHSNPCPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALH-LQFLRLDDNKMIQFHRFSFRG-LNVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCD------SPRLKLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPE 1050
            S     CP++C    C   ++ C   GL  IP  L     +I                         ++E+  ++     S+    FS    LR +DLS+N + EI PD F+ L  L  L L  NK+    +  F G   +  L L    +  +    F ++       +  N    +    F  L   +  L + +NPF C CNL+WL   L  R   I  S        A+C  P R+  K+I  +  K F C       SP L   DV +    ++   C   PK     +V+  +  + T +PE
Sbjct:  278 SIGGGSCPAMC---TCSNNIVDCRGKGLTAIPANLPDNMAEI-------------------------RLEQNGIK-----SVPPGAFSSYKKLRRIDLSNNQISEIAPDAFQGLRSLNSLVLYGNKITDLPKGVFDGLYALQLLLLNANKIHCIRANTFQDLQNLSLLSLYDNKIQTLAKGTFTSL-RAIQTLHLAQNPFICDCNLKWLADYL--RSNPIETSG-------ARCASPRRLANKRIGQIKSKKFRCSGSILTFSP-LGTEDVRLNDACNSDPVC--PPKCRCESNVVDCSNLKLTKIPE 539          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000026559.1 (SMESG000026559.1)

HSP 1 Score: 975.696 bits (2521), Expect = 0.000e+0
Identity = 483/483 (100.00%), Postives = 483/483 (100.00%), Query Frame = 1
Query:  142 AKTSAHSNPCPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPEIQSSENASLSVLRKSRIDKYKCVIKNNNDYVTVVISIHWPVKRVNNASQSLNTLGVSPNDMIPYLPNANSTLHVRSVFYEKQFTLLEMIGGIVGTFTITMILFLCIYRHLAMTMKRNDKKKWYLSYETAIGSDSQTYDIPNNTAGLYFPGQLLTNPYSPARYLDYNSHTPQSSPNKVAAI 1590
            AKTSAHSNPCPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCNLTELDFEVFSEISERLKKLILTNNKLNVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPEIQSSENASLSVLRKSRIDKYKCVIKNNNDYVTVVISIHWPVKRVNNASQSLNTLGVSPNDMIPYLPNANSTLHVRSVFYEKQFTLLEMIGGIVGTFTITMILFLCIYRHLAMTMKRNDKKKWYLSYETAIGSDSQTYDIPNNTAGLYFPGQLLTNPYSPARYLDYNSHTPQSSPNKVAAI
Sbjct:   17 AKTSAHSNPCPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCNLTELDFEVFSEISERLKKLILTNNKLNVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPEIQSSENASLSVLRKSRIDKYKCVIKNNNDYVTVVISIHWPVKRVNNASQSLNTLGVSPNDMIPYLPNANSTLHVRSVFYEKQFTLLEMIGGIVGTFTITMILFLCIYRHLAMTMKRNDKKKWYLSYETAIGSDSQTYDIPNNTAGLYFPGQLLTNPYSPARYLDYNSHTPQSSPNKVAAI 499          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000035909.1 (SMESG000035909.1)

HSP 1 Score: 263.077 bits (671), Expect = 3.572e-81
Identity = 176/462 (38.10%), Postives = 260/462 (56.28%), Query Frame = 1
Query:  169 CPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLIDVFMTSTSSAKLTCISEPKAHSSPDVIWM---AEHRNTYVPEIQSSENASLSVLRKSRIDKYKCVIKNNNDYVTVVISIHWPVKRVNNASQSLNTLGVSPNDMIPYLPNANSTLHVRSVFYEKQFTLLEMIGGIVGTFTITMILFLCIYRHLAMTMKRNDKKKWYLSYETAIGSDSQTYDIPNNTAGLYFPGQLLTNPYSPARYLDY 1545
            CPSVC EMAC+TG+L C DGGL  IP  L   T K+++    F +P ++ +NF+ Y    + I K+ L  C + SI    F  +T L+ LDLS N +  I P TF  L L FLRLD+NK I+  + SF GL V +LSL DC+L +L+++ F+++   L++L LT N L VID +F  +F +L +L++N NP +C+C+++WL+ VL  R +       K+  N A+C  P  +  K I  L+   + C +P L  +D+F+ S  SAKL+C++    +S   ++W     E        +    N+++ + RK + DKY C   N N   T+ I I WP        Q  +     P  +   LP+ +   + +  F+++QFTLLEMIGG+VGTFT T++LFL IYR      ++  +K+    YET I SDSQTYDIP+     Y+P        SPA YLD+
Sbjct:   60 CPSVCQEMACKTGILTCPDGGLKSIPEFLPASTTKVLLVGHIFDNPQISGANFTKYAV--FNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNIELRKNSFSGLKVKKLSLNDCDLNDLNYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVL--RHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVELDLFILSNDSAKLSCVTARNQNSR--IMWHFFDTEGYRILQNSMSQMYNSTIKIKRKYQTDKYFCSAHNLNGNSTIEIRIKWP--------QLYHKTTYYPTGVNKKLPHPS---YDKDFFFQRQFTLLEMIGGVVGTFTGTLLLFLLIYRCFIQKHRKESRKRKL--YETVIYSDSQTYDIPHQP---YYPIHAYQT--SPAHYLDF 497          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000033458.1 (SMESG000033458.1)

HSP 1 Score: 253.832 bits (647), Expect = 9.367e-78
Identity = 171/453 (37.75%), Postives = 244/453 (53.86%), Query Frame = 1
Query:  169 CPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLS---SSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYV----PEIQSSEN-ASLSVLRKSRIDKYKCVIKNNNDYVTVVISIHWPVKRVNNASQSLNTLGVSPNDMIPYLPNANST-----------LHVRSVFYEKQFTLLEMIGGIVGTFTITMILFLCIYRHLAMTMKRNDKKKWYLSYETAIGSDSQTYDIP 1470
            CP +C++ AC+  +L C   GLLQIP    +   K+I+SNQ F  P LTY+N S YG     ++K+ +  C L SI S  FSHL  L+ LDLS N L  I P+TFK+L L+ L LD N+ +Q  + SFRGL V  LS+ DC+L  L  E   +IS  L  L L +N+L  +   F +LF  L +L +  NPFNC+C L+WL   L +R K  + S   S  R+ N   C YP  +KG  I +L +  F C  P+L+ ID+ +TS  +A+++CIS+  ++S   V W   +  + +    P+  S  N AS+ V +KS  D Y C+I N N   TV I I WP     N     + +   PN +  +    N T           LHV +  + KQ+T +EM+  I GTF IT++ F+ +Y  +    K +  K     YE  + S+SQTYD+P
Sbjct:   35 CPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPV-CEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISCISDDMSNS--QVKWRYRYNLSPLFYRYPDQNSGLNQASIIVSKKSEFDFYSCLIINENGNATVDIKIKWPTL---NKEYVESPIKSPPNTVNQFNLRNNITKSSVILKEFDKLHV-NYLWIKQYTFIEMVLAICGTFIITLVTFILLYVVINYRRKNSRSKNILKGYEVGVYSESQTYDVP 480          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000026986.1 (SMESG000026986.1)

HSP 1 Score: 237.654 bits (605), Expect = 8.644e-72
Identity = 162/451 (35.92%), Postives = 238/451 (52.77%), Query Frame = 1
Query:  169 CPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPE-----IQSSENASLSVLRKSRIDKYKCVIKNNNDYVTVVISIHWPVKRVNNASQSLNTLG--------VSPNDMIPYLPNANSTLHVRSVFYEKQFTLLEMIGGIVGTFTITMILF----LCIYRHLAMTMKRNDKKKWYLSYETAIGSDSQTYDIP 1470
            CP +C++ +C  G L C D GL  IP     KT ++IV NQ F +P L Y N S YG     ++ + +Q C L  I S  FSHL  L  +DLS N L  I P TFKAL+L+ L+L+ N++++    SF+GL V+ LSL +C L  L+F+   EI+  L +  L+ N L  ++ RF +LF+ L ++Q+  N   C C ++WLN +L S+ +     S   I +  +C+ P  ++GK I+ L+   F C  P LK I V + ST SA L C S P  +S   V W   +   Y        I++  NAS+ V + S+ D + C++KN N  V+V ++I WP     N S++L   G         S N     +P   + L++      KQFT LEMI  I  TF +T I F    LC+ R L +++ +    K  + Y+  I SD+Q YD P
Sbjct:   21 CPVLCNQNSCTYGFLFCVDIGLEMIPENPPPKTTQVIVKNQIFKNPILGYKNLSRYGTEEILLKVLTIQNCGLTEIESESFSHLVHLMEMDLSFNQLQMIYPRTFKALNLKSLKLNGNRLLKLTGNSFQGLVVSSLSLANCGLDSLEFDSIKEIAGHLIRFDLSQNDLKSLNFRFYLLFKRLEEIQLGGNQLKCDCRIKWLNRILKSKNQ-----SKASIESLIKCSQPYEIRGKAISQLEESQFLCSKPNLKAISVDI-STRSAILYCSSSP--NSDTQVSWHLRNAVNYSLHKLEDLIETPFNASIKVNKNSQSDMFSCIVKNENGNVSVDLNIKWP----ENTSETLTDKGHPILLFSTPSNNSSTSIIPQTTNYLYI------KQFTFLEMIISIGSTFVVTTITFSLIYLCLSRRLNISIGKQSPCK--IGYQGGIYSDTQIYDSP 451          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000025920.1 (SMESG000025920.1)

HSP 1 Score: 229.18 bits (583), Expect = 2.153e-68
Identity = 162/431 (37.59%), Postives = 236/431 (54.76%), Query Frame = 1
Query:  169 CPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFS-SPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCNLTELDFEVFSEISERXXXXXXXXXXXXVIDKRFRILFENLPDLQINENPFNCT-CNLRWLNSVLVSRKKAINLSSSKRIPNQA---QCNYPDRVKGKQIADLDLKDFDCDSPRLKLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPEIQSSENASLSVLRKS--RIDKYKCVIKNNNDYVTVVISIHWPVKRVNNASQSLNTLGVSPNDMIPYLPNANSTLHVRSVFYEKQFTLLEMIGGIVGTFTITMILFLCIYRHLAMTMKRNDKKKWYLSYETAI 1440
            CP+ C++ AC  GVL+C+  GL  IP VL      + + NQ FS +  LTYSN S+YGPP +KI KI +Q C LV IA   FSHL  L +LDLS+N L +I P TF++L+L+FLRLD N  ++FH  SF+   +  LSL +C+L  LDF     I   LKKLIL++N L  ID R+  LF  L  L+++ N FNC  C L+WL   L +R K  N S  K+I       +CN P  +  + +  +D ++F C +P +K ID+ + +     L+C S+ K   +  V+W  + +      I+ S  A  +++  S     + KC+I N N  ++  I+I WP  R     +  +T  VSP D      N+N     + V +  QF+LLE++  I GTF I   +F+C+ R+L      N K+  Y+ Y   I
Sbjct:   28 CPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYSNISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESLNLKFLRLDGNMNLKFHCSSFQKSIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYDFLFNRLLVLRLDNNLFNCADCRLKWLAKTLSTRFKNYNFSIEKKIQIDKVFPKCNRPTFLAERFLHQIDEQEFSCRTPSIKSIDLKIENIEKLILSCHSQSK---NDYVMWYQDSK------IEDSNRAQSNIVLHSGKAYRQLKCLINNPNGNISTKINIGWP--RFVQIDEPEST--VSPPDE----TNSN-----KGVLHIPQFSLLELLAAIFGTFMIFFFIFVCVIRYLL-----NRKENHYVQYPVII 431          
The following BLAST results are available for this feature:
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PXDN5.599e-1224.53peroxidasin [Source:HGNC Symbol;Acc:HGNC:14966][more]
PXDN6.821e-1224.53peroxidasin [Source:HGNC Symbol;Acc:HGNC:14966][more]
SLIT11.161e-1125.48slit guidance ligand 1 [Source:HGNC Symbol;Acc:HGN... [more]
SLIT12.002e-1125.48slit guidance ligand 1 [Source:HGNC Symbol;Acc:HGN... [more]
PXDN4.399e-1125.41peroxidasin [Source:HGNC Symbol;Acc:HGNC:14966][more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pxn-11.053e-825.00Peroxidasin homolog [Source:UniProtKB/Swiss-Prot;... [more]
slt-11.157e-626.07Slit homolog 1 protein [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sli7.993e-1325.70gene:FBgn0264089 transcript:FBtr0330730[more]
sli8.147e-1325.70gene:FBgn0264089 transcript:FBtr0330729[more]
sli8.147e-1325.70gene:FBgn0264089 transcript:FBtr0330732[more]
kek31.041e-1225.67gene:FBgn0028370 transcript:FBtr0300848[more]
kek31.041e-1225.67gene:FBgn0028370 transcript:FBtr0080752[more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pxdn5.566e-1425.10peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2][more]
pxdn5.158e-1326.18peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2][more]
pxdn5.311e-1326.18peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2][more]
pxdn5.543e-1326.18peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2][more]
lrig11.658e-1223.51leucine-rich repeats and immunoglobulin-like domai... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
polr1e6.509e-1325.27polymerase (RNA) I polypeptide E [Source:Xenbase;A... [more]
polr1e6.648e-1324.63polymerase (RNA) I polypeptide E [Source:Xenbase;A... [more]
polr1e7.254e-1324.63polymerase (RNA) I polypeptide E [Source:Xenbase;A... [more]
lgi12.468e-1227.84leucine-rich, glioma inactivated 1 [Source:NCBI ge... [more]
lgi13.018e-1227.84leucine-rich, glioma inactivated 1 [Source:NCBI ge... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pxdn1.007e-1224.91peroxidasin [Source:MGI Symbol;Acc:MGI:1916925][more]
Slit14.790e-1225.08slit guidance ligand 1 [Source:MGI Symbol;Acc:MGI:... [more]
Slit16.312e-1225.08slit guidance ligand 1 [Source:MGI Symbol;Acc:MGI:... [more]
Slit18.777e-1225.08slit guidance ligand 1 [Source:MGI Symbol;Acc:MGI:... [more]
Pxdn5.208e-1024.59peroxidasin [Source:MGI Symbol;Acc:MGI:1916925][more]
back to top
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A4IGL7|PXDN_XENTR3.257e-1224.63Peroxidasin OS=Xenopus tropicalis OX=8364 GN=pxdn ... [more]
sp|Q3UQ28|PXDN_MOUSE7.046e-1224.91Peroxidasin homolog OS=Mus musculus OX=10090 GN=Px... [more]
sp|Q92626|PXDN_HUMAN3.275e-1124.53Peroxidasin homolog OS=Homo sapiens OX=9606 GN=PXD... [more]
sp|Q80TR4|SLIT1_MOUSE6.139e-1125.08Slit homolog 1 protein OS=Mus musculus OX=10090 GN... [more]
sp|O75093|SLIT1_HUMAN9.614e-1125.48Slit homolog 1 protein OS=Homo sapiens OX=9606 GN=... [more]
back to top
BLAST of Ig-like domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5P8I4L00.000e+098.76PXDN-like protein OS=Schmidtea mediterranea OX=793... [more]
I1ZIL55.058e-6837.53Slit-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=... [more]
A0A0R3TNY64.955e-3730.94Ig-like domain-containing protein OS=Rodentolepis ... [more]
W6U6F31.165e-3630.22Immunoglobulin superfamily member OS=Echinococcus ... [more]
A0A0R3VU845.791e-3629.98Ig-like domain-containing protein OS=Taenia asiati... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pxdn2.135e-1225.75peroxidasin [Source:NCBI gene;Acc:103028918][more]
lrig11.012e-1123.76leucine rich repeats and immunoglobulin like domai... [more]
ENSAMXT00000025613.21.210e-1129.89leucine-rich repeat transmembrane protein FLRT1 [S... [more]
lrig11.292e-1023.33leucine rich repeats and immunoglobulin like domai... [more]
lgi1a2.635e-1027.18leucine-rich glioma-inactivated protein 1-like [So... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
islr23.039e-1128.88immunoglobulin superfamily containing leucine-rich... [more]
pxdn9.837e-1023.66peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2][more]
ENSPMAT00000000079.12.960e-926.64pep scaffold:Pmarinus_7.0:GL476403:206014:206980:-... [more]
tlr73.892e-830.59toll-like receptor 7 [Source:ZFIN;Acc:ZDB-GENE-040... [more]
LGI14.143e-825.77leucine rich glioma inactivated 1 [Source:HGNC Sym... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO471093.749e-1126.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481792.094e-726.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316696.728e-723.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flrt1b2.782e-1128.41leucine-rich repeat transmembrane protein FLRT1 [S... [more]
pxdn4.684e-1124.66peroxidasin [Source:NCBI gene;Acc:101162089][more]
adgra21.350e-1027.62adhesion G protein-coupled receptor A2 [Source:NCB... [more]
slit1a1.371e-1026.46slit guidance ligand 1 [Source:NCBI gene;Acc:10116... [more]
slit1a1.419e-1026.46slit guidance ligand 1 [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026559.10.000e+0100.00SMESG000026559.1[more]
SMESG000035909.13.572e-8138.10SMESG000035909.1[more]
SMESG000033458.19.367e-7837.75SMESG000033458.1[more]
SMESG000026986.18.644e-7235.92SMESG000026986.1[more]
SMESG000025920.12.153e-6837.59SMESG000025920.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013984 ID=SMED30013984|Name=Ig-like domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1631bp
TATCAATTTATTATATGACAATTTTTTAAGTTAATTAAATATTTCAAACT
TGGATTTAAAAATGGATCAAAATTGATACAGATTGGATCAATAATGAAGA
TCCCATTCCTTCTGCCAATGTTATTATTCATATTATTCCTAGCGAAGACT
TCAGCTCATTCTAACCCTTGTCCTTCCGTTTGTCATGAAATGGCTTGTCA
AACTGGAGTTTTAGCTTGTACAGATGGCGGACTTTTGCAAATTCCACCGG
TTCTTCATCAGAAAACGCATAAAATCATTGTATCAAATCAGCGGTTTTCC
TCACCACATTTGACATACTCAAACTTTTCCAATTACGGACCACCAAATTA
CAAAATTGAAAAGATTGCCCTCCAATTTTGTGAACTTGTCAGCATTGCCT
CGAACTGTTTTTCACATTTAACGGATCTGAGAGTCTTAGATCTATCCCAT
AACCTTCTCGGAGAAATTCCTCCTGACACTTTCAAAGCGTTGCATTTGCA
ATTTCTTCGCCTTGACGACAACAAAATGATTCAATTTCACAGATTTTCAT
TTCGTGGACTCAATGTGGCAGAATTGAGCTTATTCGACTGCAATCTCACA
GAATTAGATTTCGAAGTTTTTAGTGAAATTTCCGAGAGGCTTAAGAAACT
CATCTTGACCAACAATAAACTAAACGTTATAGACAAGCGTTTTAGAATAT
TGTTTGAAAATCTACCTGATCTGCAAATAAATGAAAACCCATTTAATTGT
ACTTGTAACCTTCGATGGCTGAATTCGGTCCTCGTTTCACGCAAGAAGGC
GATCAATTTGTCATCCTCCAAACGTATACCGAACCAAGCTCAATGTAATT
ATCCGGATCGTGTCAAAGGAAAGCAAATTGCTGACTTAGATTTGAAAGAT
TTTGATTGTGATTCTCCTAGATTAAAGTTGATAGATGTCTTTATGACATC
GACCTCATCCGCAAAACTCACCTGTATCTCAGAACCGAAAGCTCATTCAT
CTCCCGACGTGATCTGGATGGCTGAACATAGAAACACATACGTCCCTGAA
ATCCAATCTAGCGAGAACGCAAGCTTATCAGTTTTACGGAAGTCCCGAAT
AGATAAATATAAATGTGTTATCAAAAATAATAACGATTACGTAACGGTTG
TGATTTCGATACATTGGCCTGTAAAACGTGTTAATAACGCTTCACAATCT
CTTAATACACTCGGTGTTTCACCCAATGATATGATTCCATACTTACCTAA
TGCCAACAGTACTCTACACGTACGTTCAGTTTTCTATGAGAAACAATTTA
CTCTTCTTGAAATGATCGGCGGAATTGTAGGAACATTCACAATCACCATG
ATCCTATTTCTCTGTATATATCGCCATCTTGCCATGACAATGAAACGAAA
TGATAAGAAAAAGTGGTACCTATCATATGAAACAGCGATTGGATCGGATA
GCCAGACGTACGATATTCCAAATAATACAGCTGGGCTTTATTTTCCTGGA
CAGTTGCTGACAAATCCTTACAGCCCAGCTCGGTATCTAGATTATAACAG
TCACACCCCGCAATCATCCCCGAATAAGGTAGCGGCCATCTAGACTATGC
TCCATCAACTCCAGATGTGTACAGATTTATC
back to top

protein sequence of SMED30013984-orf-1

>SMED30013984-orf-1 ID=SMED30013984-orf-1|Name=SMED30013984-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=500bp
MKIPFLLPMLLFILFLAKTSAHSNPCPSVCHEMACQTGVLACTDGGLLQI
PPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVS
IASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQFHR
FSFRGLNVAELSLFDCNLTELDFEVFSEISERLKKLILTNNKLNVIDKRF
RILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQ
CNYPDRVKGKQIADLDLKDFDCDSPRLKLIDVFMTSTSSAKLTCISEPKA
HSSPDVIWMAEHRNTYVPEIQSSENASLSVLRKSRIDKYKCVIKNNNDYV
TVVISIHWPVKRVNNASQSLNTLGVSPNDMIPYLPNANSTLHVRSVFYEK
QFTLLEMIGGIVGTFTITMILFLCIYRHLAMTMKRNDKKKWYLSYETAIG
SDSQTYDIPNNTAGLYFPGQLLTNPYSPARYLDYNSHTPQSSPNKVAAI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000483Cys-rich_flank_reg_C
IPR003591Leu-rich_rpt_typical-subtyp
IPR032675LRR_dom_sf
IPR001611Leu-rich_rpt
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000483Cysteine-rich flanking region, C-terminalSMARTSM00082lrrct1coord: 215..273
e-value: 1.9E-9
score: 47.4
IPR003591Leucine-rich repeat, typical subtypeSMARTSM00369LRR_typ_2coord: 109..132
e-value: 3.7E-4
score: 29.8
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 149..274
e-value: 1.4E-18
score: 68.7
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 21..148
e-value: 2.1E-18
score: 68.0
IPR001611Leucine-rich repeatPFAMPF13855LRR_8coord: 89..144
e-value: 2.2E-11
score: 43.4
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 111..132
score: 8.066
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 134..155
score: 4.909
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 206..227
score: 4.601
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 182..203
score: 5.44
NoneNo IPR availablePANTHERPTHR24373SLIT RELATED LEUCINE-RICH REPEAT NEURONAL PROTEINcoord: 90..320
coord: 10..211
NoneNo IPR availablePANTHERPTHR24373:SF320LD45603P-RELATEDcoord: 90..320
coord: 10..211
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.93
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 36..277
NoneNo IPR availableTMHMMTMhelixcoord: 408..430
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 275..357
score: 8.647