SMED30013979

Overview
NameSMED30013979
Smed IDSMED30013979
Length (bp)1859
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30013979 (SMED30013979) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30013979 (SMED30013979) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30013979 (SMED30013979) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30013979 (SMED30013979) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013979

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30013979h1SMcG0021115 SmedASXL_012571SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30013979h1SMcG0021115 dd_Smed_v4_4151_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30013979h1SMcG0021115 dd_Smed_v4_4151_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013979h1SMcG0021115 dd_Smed_v4_4151_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30013979 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.004094:27618..29551 +8301
Homology
BLAST of SMED30013979 vs. TrEMBL
Match: A0A564YTW6 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS9512 PE=4 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 1.783e-12
Identity = 41/95 (43.16%), Postives = 59/95 (62.11%), Query Frame = 3
Query:  375 RQKISFLDKYEWRLIKNKYLERAKYPFIPREHPVGLDVPISRNKSIFIEIDEMKPEYIVPKEFDP-QLKPYVSWRAKLIKQDKLEPESLFSLTYG 656
            RQKI++   Y+W L  +K  +RA+YP+IPRE P    +    N  +  EI EM  E++VP   D  +LKPYV+WRA +++Q +L  ESLF + Y 
Sbjct:   23 RQKIAYATSYKWLLDVHKSRQRARYPWIPREPPTSCII----NGEVK-EIPEMHVEFVVPLNLDKCELKPYVTWRASVVQQPELTAESLFEIRYA 112          
BLAST of SMED30013979 vs. TrEMBL
Match: A0A430Q8E5 (Large subunit ribosomal protein L41 OS=Schistosoma bovis OX=6184 GN=DC041_0010175 PE=4 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 2.832e-12
Identity = 51/130 (39.23%), Postives = 75/130 (57.69%), Query Frame = 3
Query:  333 QHCRSFHVSIL-LERRQKISFLDKYEWRLIKNKYLERAKYPFIPREHPVGLDVPISRNKSIFIEIDEMKPEYIVPKEFDP-QLKPYVSWRAKLIKQDKLEPESLFSLTYGSKLP-----SVSSEEVEKFV 701
            Q  R+ +V++  L  RQKI+F  +Y W L   K   RAKYP+IPRE    ++  I   K IF    EM  ++IVP   D  +LKPYVSW++KLI+++ L  E LF+  Y  K+        S+EE+ +++
Sbjct:   17 QTIRTINVAMGPLRSRQKIAFKTRYHWMLDLKKSKARAKYPWIPREPTTSME--IYGQKIIF---PEMYLDFIVPNNLDKCELKPYVSWQSKLIEEEPLTAEVLFNNRYSQKITEMFKNGASNEEIMEYL 141          
BLAST of SMED30013979 vs. TrEMBL
Match: A0A094ZXJ0 (39S ribosomal protein L41, mitochondrial (Fragment) OS=Schistosoma haematobium OX=6185 GN=MS3_06259 PE=4 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 3.784e-12
Identity = 51/130 (39.23%), Postives = 74/130 (56.92%), Query Frame = 3
Query:  333 QHCRSFHVSIL-LERRQKISFLDKYEWRLIKNKYLERAKYPFIPREHPVGLDVPISRNKSIFIEIDEMKPEYIVPKEFDP-QLKPYVSWRAKLIKQDKLEPESLFSLTYGSKLP-----SVSSEEVEKFV 701
            Q  R+ +V++  L  RQKI+F  +Y W L   K   RAKYP+IPRE    ++  I   K IF    EM  ++IVP   D  +LKPYVSW++KLI++  L  E LF+  Y  K+        S+EE+ +++
Sbjct:   17 QSIRTINVAMGPLRSRQKIAFKTRYHWMLDLKKSKARAKYPWIPREPTTSME--IYGQKIIF---PEMYLDFIVPNNLDKCELKPYVSWQSKLIEEGPLTAEVLFNNRYSQKITEMFRNGASNEEIMEYL 141          
BLAST of SMED30013979 vs. TrEMBL
Match: A0A183KLD6 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS15850 PE=4 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 3.895e-12
Identity = 51/130 (39.23%), Postives = 74/130 (56.92%), Query Frame = 3
Query:  333 QHCRSFHVSIL-LERRQKISFLDKYEWRLIKNKYLERAKYPFIPREHPVGLDVPISRNKSIFIEIDEMKPEYIVPKEFDP-QLKPYVSWRAKLIKQDKLEPESLFSLTYGSKLP-----SVSSEEVEKFV 701
            Q  R+ +V++  L  RQKI+F  +Y W L   K   RAKYP+IPRE    ++  I   K IF    EM  ++IVP   D  +LKPYVSW++KLI++  L  E LF+  Y  K+        S+EE+ +++
Sbjct:   17 QSIRTINVAMGPLRSRQKIAFKTRYHWMLDLKKSKARAKYPWIPREPTTSME--IYGQKIIF---PEMYLDFIVPNNLDKCELKPYVSWQSKLIEEGPLTAEVLFNNRYSQKITEMFKNGASNEEIMEYL 141          
BLAST of SMED30013979 vs. TrEMBL
Match: A0A183L9N8 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS513 PE=4 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 5.679e-12
Identity = 49/130 (37.69%), Postives = 74/130 (56.92%), Query Frame = 3
Query:  333 QHCRSFHVSIL-LERRQKISFLDKYEWRLIKNKYLERAKYPFIPREHPVGLDVPISRNKSIFIEIDEMKPEYIVPKEFDP-QLKPYVSWRAKLIKQDKLEPESLFSLTYGSKLP-----SVSSEEVEKFV 701
            Q  R+ +V++  L  RQKI+F  +Y W L   K   RAKYP+IPRE    ++  I   K +F    EM  ++IVP   D  +LKPYVSW++KL+++  L  E LF+  Y  K+        S+EE+ +++
Sbjct:   17 QSIRTINVAMGPLRSRQKIAFKTRYHWMLDLKKSKARAKYPWIPREPTTSME--IYGQKIVF---PEMYLDFIVPNNLDKCELKPYVSWKSKLVEEGPLTAEVLFNNRYSQKITEMFKNGASNEEIMEYL 141          
BLAST of SMED30013979 vs. Planmine SMEST
Match: SMESG000035951.1 (SMESG000035951.1)

HSP 1 Score: 314.309 bits (804), Expect = 6.193e-105
Identity = 158/159 (99.37%), Postives = 158/159 (99.37%), Query Frame = 3
Query:  288 MIMKFLNISISKFCFQHCRSFHVSILLERRQKISFLDKYEWRLIKNKYLERAKYPFIPREHPVGLDVPISRNKSIFIEIDEMKPEYIVPKEFDPQLKPYVSWRAKLIKQDKLEPESLFSLTYGSKLPSVSSEEVEKFVDEYSHKKLPDSEILPLNKLRK 764
            MIMKFLNISISKFCFQH RSFHVSILLERRQKISFLDKYEWRLIKNKYLERAKYPFIPREHPVGLDVPISRNKSIFIEIDEMKPEYIVPKEFDPQLKPYVSWRAKLIKQDKLEPESLFSLTYGSKLPSVSSEEVEKFVDEYSHKKLPDSEILPLNKLRK
Sbjct:    1 MIMKFLNISISKFCFQHSRSFHVSILLERRQKISFLDKYEWRLIKNKYLERAKYPFIPREHPVGLDVPISRNKSIFIEIDEMKPEYIVPKEFDPQLKPYVSWRAKLIKQDKLEPESLFSLTYGSKLPSVSSEEVEKFVDEYSHKKLPDSEILPLNKLRK 159          
BLAST of SMED30013979 vs. Planmine SMEST
Match: SMESG000035951.1 (SMESG000035951.1)

HSP 1 Score: 310.842 bits (795), Expect = 1.250e-103
Identity = 156/157 (99.36%), Postives = 156/157 (99.36%), Query Frame = 3
Query:  294 MKFLNISISKFCFQHCRSFHVSILLERRQKISFLDKYEWRLIKNKYLERAKYPFIPREHPVGLDVPISRNKSIFIEIDEMKPEYIVPKEFDPQLKPYVSWRAKLIKQDKLEPESLFSLTYGSKLPSVSSEEVEKFVDEYSHKKLPDSEILPLNKLRK 764
            MKFLNISISKFCFQH RSFHVSILLERRQKISFLDKYEWRLIKNKYLERAKYPFIPREHPVGLDVPISRNKSIFIEIDEMKPEYIVPKEFDPQLKPYVSWRAKLIKQDKLEPESLFSLTYGSKLPSVSSEEVEKFVDEYSHKKLPDSEILPLNKLRK
Sbjct:    1 MKFLNISISKFCFQHSRSFHVSILLERRQKISFLDKYEWRLIKNKYLERAKYPFIPREHPVGLDVPISRNKSIFIEIDEMKPEYIVPKEFDPQLKPYVSWRAKLIKQDKLEPESLFSLTYGSKLPSVSSEEVEKFVDEYSHKKLPDSEILPLNKLRK 157          
BLAST of SMED30013979 vs. Planmine SMEST
Match: SMESG000061492.1 (SMESG000061492.1)

HSP 1 Score: 81.6481 bits (200), Expect = 7.255e-18
Identity = 37/48 (77.08%), Postives = 40/48 (83.33%), Query Frame = -2
Query:    2 MISNINYRGRCQVNRMKFQTGKPRHVMDRIGKYPILFIKSEKCRIMGC 145
            MISNINYRGRC+V  MKF  GKP+HV+DR GKYPIL  KS KCRIMGC
Sbjct:    1 MISNINYRGRCEVTGMKFPAGKPQHVVDRSGKYPILLFKSGKCRIMGC 48          
BLAST of SMED30013979 vs. Planmine SMEST
Match: SMESG000064388.1 (SMESG000064388.1)

HSP 1 Score: 85.8853 bits (211), Expect = 1.485e-17
Identity = 38/48 (79.17%), Postives = 42/48 (87.50%), Query Frame = -2
Query:    2 MISNINYRGRCQVNRMKFQTGKPRHVMDRIGKYPILFIKSEKCRIMGC 145
            MISNINYRGRC+V  MKF TGKP+HV+DR GKYPILF KS KCR+MGC
Sbjct:    1 MISNINYRGRCEVTGMKFPTGKPQHVVDRSGKYPILFFKSGKCRVMGC 48          
BLAST of SMED30013979 vs. Planmine SMEST
Match: SMESG000013399.1 (SMESG000013399.1)

HSP 1 Score: 79.7221 bits (195), Expect = 3.615e-17
Identity = 37/48 (77.08%), Postives = 41/48 (85.42%), Query Frame = -2
Query:    2 MISNINYRGRCQVNRMKFQTGKPRHVMDRIGKYPILFIKSEKCRIMGC 145
            MISNINYRGRC+V  MKF TGKP+HV++R GKYPILF K  KCRIMGC
Sbjct:    1 MISNINYRGRCEVTGMKFPTGKPQHVVNRSGKYPILFFKRGKCRIMGC 48          
The following BLAST results are available for this feature:
BLAST of SMED30013979 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013979 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013979 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013979 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013979 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013979 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013979 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013979 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564YTW61.783e-1243.16Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A430Q8E52.832e-1239.23Large subunit ribosomal protein L41 OS=Schistosoma... [more]
A0A094ZXJ03.784e-1239.2339S ribosomal protein L41, mitochondrial (Fragment... [more]
A0A183KLD63.895e-1239.23Uncharacterized protein OS=Schistosoma curassoni O... [more]
A0A183L9N85.679e-1237.69Uncharacterized protein OS=Schistosoma margrebowie... [more]
back to top
BLAST of SMED30013979 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013979 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013979 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013979 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013979 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013979 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035951.16.193e-10599.37SMESG000035951.1[more]
SMESG000035951.11.250e-10399.36SMESG000035951.1[more]
SMESG000061492.17.255e-1877.08SMESG000061492.1[more]
SMESG000064388.11.485e-1779.17SMESG000064388.1[more]
SMESG000013399.13.615e-1777.08SMESG000013399.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013979 ID=SMED30013979|Name=SMED30013979|organism=Schmidtea mediterranea sexual|type=transcript|length=1859bp
TGCAACCCATTATCCTGCATTTCTCACTCTTGATGAATAAGATTGGATAC
TTTCCAATTCTATCCATGACATGACGAGGTTTTCCAGTTTGGAACTTCAT
TCTATTTACTTGACATCTTCCTCTGTAATTAATATTGCTAATCATTTTCT
GCTATCATTCAAATTATAAACAAATTAAATTAAATTAAATTAATTAATTT
TTTCTTGAATTTAGTTAACATGTTAGTGAAAAATTTATTTTTGGAATTTG
TAAGATTTGCATTAAATGAAAATTTTATATTCAGAAAATGATCATGAAAT
TTTTAAATATTAGCATAAGTAAATTCTGTTTTCAACATTGTCGATCTTTC
CACGTTTCAATTTTATTGGAGAGAAGACAAAAAATAAGTTTTCTTGATAA
ATATGAATGGCGATTAATAAAGAACAAATATTTGGAAAGAGCAAAATATC
CTTTTATTCCGAGAGAACATCCTGTAGGTTTGGATGTACCAATCTCTAGA
AATAAGAGTATTTTTATAGAAATCGATGAAATGAAACCTGAATATATTGT
GCCTAAAGAATTCGATCCACAATTGAAACCTTATGTTAGTTGGCGGGCGA
AACTTATTAAACAAGATAAATTAGAACCGGAGAGTTTATTCTCTTTAACT
TATGGCAGCAAATTGCCATCTGTAAGCAGTGAGGAGGTTGAGAAATTTGT
CGATGAATATTCTCACAAAAAATTACCCGATAGTGAAATTTTGCCATTAA
ATAAATTGAGAAAATGATGTGTTTGTGTTTTATTAGGAATTAGTTGTTTT
AAAATCGGTTTTAAATCATTTTATTGTTGATGAAAAGGAGAATAGTTTTA
TTTCAATTAGTAGCTCTTCGTGTTGAATTGGCGAAATAACAATTATTTGC
GGTTGAAAGGAAGTATTTTATGAATGTTTGGTTGTATGTGTACCGAGACC
TGCAGGAGGATGTGTTGGATGGATCGTTTTAAAAATGTTTTTTCATTAAT
TTTGTATGCGTGGTAATAACAAATTTTGGTGGGTAATTCGCCAAAAAATT
CAATTTAAAAATTTTTTCTGTAGAAATTTATTTGGTGTTTTTTCATTGGT
TGAAATTATTATTTGTTTGTGATTTGGATTAATGAATTATTTCCATACAA
TTGCTTACCTTGACCTTGAACGGGAAGCAATAAATGGTACTACTTAATTC
CCATCGTTATATCCATGGTCACAGTTATTATGAGTGATGCTGAAAATGTA
CAATGAGGTTAAAAACAAATGAGCAGGTGAACTCTGTCACCATTTCATTC
TTACTTGCGGTTTTTTCGCTAACGAATGAAGGATTTAAGTCTTCGCTATC
ATTTCTTTTTTCATAACTGGGATTTCCTGATCTTGTTTCGCATGATTCAT
ATTATTGGATGTTTATCATTTCGAATTTTTGTGCAATGTTTTGGCTTATC
ATCAGTACTTTCAGCTTTTCTTTTTAGGAATAACTTCAATATCTTTTACA
AAACTTTGGCCACCGTCCCCTCCGCGTTTTAATGGCATTTTTGAACTGAA
TTTCCCCCGCTAATTATGTGATTTTGATGTCAATAAAGATTAAATTCATT
TAATACAATTTTAACAACATACTATTTTATACGAAGCTCTATGGTTAACT
CTACCTGAAGTTTTGTTTCATGGATACTGAATTTAAAGTGATGACAATCT
AGTTTCTATTTTTGCAAACGATATGTAAAAAACACTCTTTTCTGTGATCA
ATGAATTAGACAAGACTTAAATACCTTTCGGCACGCTATAACATTATTTG
TTTTTGTGTGCAATTTGAATTTCTCATTACCTCCGTTTTATAAAAGAGTA
ACGAGTACT
back to top

protein sequence of SMED30013979-orf-1

>SMED30013979-orf-1 ID=SMED30013979-orf-1|Name=SMED30013979-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=160bp
MIMKFLNISISKFCFQHCRSFHVSILLERRQKISFLDKYEWRLIKNKYLE
RAKYPFIPREHPVGLDVPISRNKSIFIEIDEMKPEYIVPKEFDPQLKPYV
SWRAKLIKQDKLEPESLFSLTYGSKLPSVSSEEVEKFVDEYSHKKLPDSE
ILPLNKLRK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR019189Ribosomal_L27/L41_mit
Vocabulary: cellular component
TermDefinition
GO:0005840ribosome