Ras association domain-containing protein 1

Overview
NameRas association domain-containing protein 1
Smed IDSMED30013975
Length (bp)1791
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ras association domain-containing protein 1 (SMED30013975) t-SNE clustered cells

Violin plots show distribution of expression levels for Ras association domain-containing protein 1 (SMED30013975) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ras association domain-containing protein 1 (SMED30013975) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ras association domain-containing protein 1 (SMED30013975) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013975

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30013975SMESG000058880.1 SMESG000029653.1 SmedASXL_016389SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30013975SMESG000058880.1 SMESG000029653.1 SmedASXL_016388SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30013975SMESG000029652.1 dd_Smed_v4_5323_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30013975SMESG000029652.1 dd_Smed_v4_5323_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013975SMESG000029652.1 dd_Smed_v4_5323_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ras association domain-containing protein 1 vs. Ensembl Human
Match: RASSF1 (Ras association domain family member 1 [Source:HGNC Symbol;Acc:HGNC:9882])

HSP 1 Score: 98.5969 bits (244), Expect = 4.291e-23
Identity = 57/190 (30.00%), Postives = 112/190 (58.95%), Query Frame = 2
Query:  863 GKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCM 1432
            G ++V + L+RP+ +  + +PPS+ D  ++    + ++++R        F+LP+     +++ +++T   ++I  LL KF + ++P+KFAL+E       +V +RKL  ++ P ++ L   L G  +  ++     FVL+END G V WD F +PEL +FL+IL +EE+E   QI+++Y   +++++  +
Sbjct:   11 GFIKVQLKLVRPVSVPSSKKPPSLQD--ARRGPGRGTSVRR-----RTSFYLPKDAVKHLHV-LSRTRAREVIEALLRKFLVVDDPRKFALFERA-ERHGQVYLRKLLDDEQPLRLRL---LAGPSDKALS-----FVLKENDSGEVNWDAFSMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEAL 183          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Human
Match: RASSF1 (Ras association domain family member 1 [Source:HGNC Symbol;Acc:HGNC:9882])

HSP 1 Score: 98.5969 bits (244), Expect = 4.291e-23
Identity = 57/190 (30.00%), Postives = 112/190 (58.95%), Query Frame = 2
Query:  863 GKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCM 1432
            G ++V + L+RP+ +  + +PPS+ D  ++    + ++++R        F+LP+     +++ +++T   ++I  LL KF + ++P+KFAL+E       +V +RKL  ++ P ++ L   L G  +  ++     FVL+END G V WD F +PEL +FL+IL +EE+E   QI+++Y   +++++  +
Sbjct:   11 GFIKVQLKLVRPVSVPSSKKPPSLQD--ARRGPGRGTSVRR-----RTSFYLPKDAVKHLHV-LSRTRAREVIEALLRKFLVVDDPRKFALFERA-ERHGQVYLRKLLDDEQPLRLRL---LAGPSDKALS-----FVLKENDSGEVNWDAFSMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEAL 183          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Human
Match: RASSF1 (Ras association domain family member 1 [Source:HGNC Symbol;Acc:HGNC:9882])

HSP 1 Score: 98.2117 bits (243), Expect = 3.255e-22
Identity = 57/190 (30.00%), Postives = 112/190 (58.95%), Query Frame = 2
Query:  863 GKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCM 1432
            G ++V + L+RP+ +  + +PPS+ D  ++    + ++++R        F+LP+     +++ +++T   ++I  LL KF + ++P+KFAL+E       +V +RKL  ++ P ++ L   L G  +  ++     FVL+END G V WD F +PEL +FL+IL +EE+E   QI+++Y   +++++  +
Sbjct:   92 GFIKVQLKLVRPVSVPSSKKPPSLQD--ARRGPGRGTSVRR-----RTSFYLPKDAVKHLHV-LSRTRAREVIEALLRKFLVVDDPRKFALFERA-ERHGQVYLRKLLDDEQPLRLRL---LAGPSDKALS-----FVLKENDSGEVNWDAFSMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEAL 264          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Human
Match: RASSF1 (Ras association domain family member 1 [Source:HGNC Symbol;Acc:HGNC:9882])

HSP 1 Score: 98.9821 bits (245), Expect = 7.045e-22
Identity = 57/190 (30.00%), Postives = 112/190 (58.95%), Query Frame = 2
Query:  863 GKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCM 1432
            G ++V + L+RP+ +  + +PPS+ D  ++    + ++++R        F+LP+     +++ +++T   ++I  LL KF + ++P+KFAL+E       +V +RKL  ++ P ++ L   L G  +  ++     FVL+END G V WD F +PEL +FL+IL +EE+E   QI+++Y   +++++  +
Sbjct:  166 GFIKVQLKLVRPVSVPSSKKPPSLQD--ARRGPGRGTSVRR-----RTSFYLPKDAVKHLHV-LSRTRAREVIEALLRKFLVVDDPRKFALFERA-ERHGQVYLRKLLDDEQPLRLRL---LAGPSDKALS-----FVLKENDSGEVNWDAFSMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEAL 338          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Human
Match: RASSF1 (Ras association domain family member 1 [Source:HGNC Symbol;Acc:HGNC:9882])

HSP 1 Score: 98.5969 bits (244), Expect = 7.302e-22
Identity = 57/190 (30.00%), Postives = 112/190 (58.95%), Query Frame = 2
Query:  863 GKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCM 1432
            G ++V + L+RP+ +  + +PPS+ D  ++    + ++++R        F+LP+     +++ +++T   ++I  LL KF + ++P+KFAL+E       +V +RKL  ++ P ++ L   L G  +  ++     FVL+END G V WD F +PEL +FL+IL +EE+E   QI+++Y   +++++  +
Sbjct:  162 GFIKVQLKLVRPVSVPSSKKPPSLQD--ARRGPGRGTSVRR-----RTSFYLPKDAVKHLHV-LSRTRAREVIEALLRKFLVVDDPRKFALFERA-ERHGQVYLRKLLDDEQPLRLRL---LAGPSDKALS-----FVLKENDSGEVNWDAFSMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEAL 334          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Celegans
Match: rsf-1 (RASSF (Ras-association domain family) homolog [Source:UniProtKB/TrEMBL;Acc:Q58AA9])

HSP 1 Score: 101.679 bits (252), Expect = 2.085e-22
Identity = 71/230 (30.87%), Postives = 116/230 (50.43%), Query Frame = 2
Query:  755 DPYDSLELPRDLTDLIRVFNDNDQGLFI--EEANALIMGKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYE-----HTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELE 1423
            D Y  ++L R     I  +N   +G+ I   E      G + V +NL RPI ++    PP++ D  + +     +T  R   +    F+LPR T  V+ I+ +KTT   +I  LL KF + +NP+KFALYE        T     ++ +++ +  P +++L W        Q     +  VLQEND G + WD F +PEL++FL+IL  EE++   Q  ++Y+  +  L+
Sbjct:  266 DEYKEMDLERK----IHSYNSLAKGMEITLHEDGVNFGGHIHVNMNLSRPISVVQGVIPPTVYDVVNTAKSTAKTTSLRTITS----FFLPRNTAKVINID-SKTTARKMIVTLLKKFRVADNPRKFALYECEQITDEATCTLNRKLTRISDDACPLKVVLNW--------QSPHCGRALVLQENDTGDILWDAFEIPELENFLRILGMEEKQYVFQTQQKYQQYRYHLD 478          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Celegans
Match: rsf-1 (RASSF (Ras-association domain family) homolog [Source:UniProtKB/TrEMBL;Acc:Q58AA9])

HSP 1 Score: 101.679 bits (252), Expect = 2.085e-22
Identity = 71/230 (30.87%), Postives = 116/230 (50.43%), Query Frame = 2
Query:  755 DPYDSLELPRDLTDLIRVFNDNDQGLFI--EEANALIMGKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYE-----HTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELE 1423
            D Y  ++L R     I  +N   +G+ I   E      G + V +NL RPI ++    PP++ D  + +     +T  R   +    F+LPR T  V+ I+ +KTT   +I  LL KF + +NP+KFALYE        T     ++ +++ +  P +++L W        Q     +  VLQEND G + WD F +PEL++FL+IL  EE++   Q  ++Y+  +  L+
Sbjct:  266 DEYKEMDLERK----IHSYNSLAKGMEITLHEDGVNFGGHIHVNMNLSRPISVVQGVIPPTVYDVVNTAKSTAKTTSLRTITS----FFLPRNTAKVINID-SKTTARKMIVTLLKKFRVADNPRKFALYECEQITDEATCTLNRKLTRISDDACPLKVVLNW--------QSPHCGRALVLQENDTGDILWDAFEIPELENFLRILGMEEKQYVFQTQQKYQQYRYHLD 478          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Celegans
Match: rsf-1 (RASSF (Ras-association domain family) homolog [Source:UniProtKB/TrEMBL;Acc:Q58AA9])

HSP 1 Score: 101.293 bits (251), Expect = 3.285e-22
Identity = 71/230 (30.87%), Postives = 116/230 (50.43%), Query Frame = 2
Query:  755 DPYDSLELPRDLTDLIRVFNDNDQGLFI--EEANALIMGKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYE-----HTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELE 1423
            D Y  ++L R     I  +N   +G+ I   E      G + V +NL RPI ++    PP++ D  + +     +T  R   +    F+LPR T  V+ I+ +KTT   +I  LL KF + +NP+KFALYE        T     ++ +++ +  P +++L W        Q     +  VLQEND G + WD F +PEL++FL+IL  EE++   Q  ++Y+  +  L+
Sbjct:  327 DEYKEMDLERK----IHSYNSLAKGMEITLHEDGVNFGGHIHVNMNLSRPISVVQGVIPPTVYDVVNTAKSTAKTTSLRTITS----FFLPRNTAKVINID-SKTTARKMIVTLLKKFRVADNPRKFALYECEQITDEATCTLNRKLTRISDDACPLKVVLNW--------QSPHCGRALVLQENDTGDILWDAFEIPELENFLRILGMEEKQYVFQTQQKYQQYRYHLD 539          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Zebrafish
Match: rassf1 (Ras association domain family member 1 [Source:ZFIN;Acc:ZDB-GENE-040912-14])

HSP 1 Score: 93.2041 bits (230), Expect = 2.912e-20
Identity = 54/145 (37.24%), Postives = 88/145 (60.69%), Query Frame = 2
Query: 1010 FWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCMSKLA 1444
            F+LPR T   ++I+ + T   ++I  LL KF + +NP K++LYE +     +V +RKLA ++ P  + L+ C  G  E  ++L     VL+EN+ G V WD F  PEL++FL+IL +EE++   QIIRRY + + +++  M   +
Sbjct:  184 FYLPRDTVKHLHIS-SSTRAREVIQALLNKFTVVDNPAKYSLYERS-QRDNQVYLRKLADDECP--LFLRLCA-GPNEKVLSL-----VLKENETGEVNWDAFSFPELQNFLRILQREEEDHVRQIIRRYTLARDKMKEAMKNFS 318          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Zebrafish
Match: rassf3 (Ras association domain family member 3 [Source:ZFIN;Acc:ZDB-GENE-100422-9])

HSP 1 Score: 91.2781 bits (225), Expect = 3.600e-20
Identity = 56/148 (37.84%), Postives = 83/148 (56.08%), Query Frame = 2
Query: 1010 FWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCMSKLAAVR 1453
            F+LPRG+ N ++I+    T   +I  LL KF + +NP KFALY+   +   +V   KL+ E+ P  + L+           N     FVL+E   G V WD F +PEL++F++IL +EEQ++   I RRY   +++LE  M K AA R
Sbjct:  113 FYLPRGSINTLHIS-NSNTVRQVIEALLKKFTVADNPAKFALYKR-FSREDQVYTCKLSEEEHP--LFLRLVAGP------NTDTLSFVLKEQQTGEVMWDAFSIPELQNFIRILEKEEQDQMCSISRRYNTYREKLEEAM-KTAAGR 249          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Zebrafish
Match: rassf1 (Ras association domain family member 1 [Source:ZFIN;Acc:ZDB-GENE-040912-14])

HSP 1 Score: 92.0485 bits (227), Expect = 1.209e-19
Identity = 53/145 (36.55%), Postives = 85/145 (58.62%), Query Frame = 2
Query: 1010 FWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCMSKLA 1444
            F+LPR T   ++I+ + T   ++I  LL KF + +NP K++LYE +     +V +RKLA ++ P  + L+ C    E      K    VL+EN+ G V WD F  PEL++FL+IL +EE++   QIIRRY + + +++  M   +
Sbjct:  226 FYLPRDTVKHLHIS-SSTRAREVIQALLNKFTVVDNPAKYSLYERS-QRDNQVYLRKLADDECP--LFLRLCAGPNE------KVLSLVLKENETGEVNWDAFSFPELQNFLRILQREEEDHVRQIIRRYTLARDKMKEAMKNFS 360          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Zebrafish
Match: rassf1 (Ras association domain family member 1 [Source:ZFIN;Acc:ZDB-GENE-040912-14])

HSP 1 Score: 92.0485 bits (227), Expect = 1.209e-19
Identity = 53/145 (36.55%), Postives = 85/145 (58.62%), Query Frame = 2
Query: 1010 FWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCMSKLA 1444
            F+LPR T   ++I+ + T   ++I  LL KF + +NP K++LYE +     +V +RKLA ++ P  + L+ C    E      K    VL+EN+ G V WD F  PEL++FL+IL +EE++   QIIRRY + + +++  M   +
Sbjct:  226 FYLPRDTVKHLHIS-SSTRAREVIQALLNKFTVVDNPAKYSLYERS-QRDNQVYLRKLADDECP--LFLRLCAGPNE------KVLSLVLKENETGEVNWDAFSFPELQNFLRILQREEEDHVRQIIRRYTLARDKMKEAMKNFS 360          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Zebrafish
Match: rassf3 (Ras association domain family member 3 [Source:ZFIN;Acc:ZDB-GENE-100422-9])

HSP 1 Score: 88.1965 bits (217), Expect = 7.578e-19
Identity = 57/148 (38.51%), Postives = 84/148 (56.76%), Query Frame = 2
Query: 1010 FWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCMSKLAAVR 1453
            F+LPRG+ N ++I+    T   +I  LL KF + +NP KFALY+   +   +V   KL+ E+ P  + L   + G      N     FVL+E   G  EWD F +PEL++F++IL +EEQ++   I RRY   +++LE  M K AA R
Sbjct:  159 FYLPRGSINTLHIS-NSNTVRQVIEALLKKFTVADNPAKFALYKR-FSREDQVYTCKLSEEEHPLFLRL---VAGP-----NTDTLSFVLKEQQTG--EWDAFSIPELQNFIRILEKEEQDQMCSISRRYNTYREKLEEAM-KTAAGR 293          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Xenopus
Match: RASSF5 (microsomal glutathione S-transferase 3-like [Source:Xenbase;Acc:XB-GENE-5796437])

HSP 1 Score: 96.6709 bits (239), Expect = 6.536e-22
Identity = 71/222 (31.98%), Postives = 124/222 (55.86%), Query Frame = 2
Query:  782 RDLTDLIRVFNDNDQ-GLFIEEAN-ALIMGKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTI-QRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCMSK 1438
            +DL   I  FN   Q GL ++ A+     G ++V++ L R       A  P++     Q+  D +  + Q    NK+  F++P      ++I+ + TTT+++I  LL KF + ++P+KFAL++H +    +V ++KLA  + P  + L   L G E   ++     FVL+END G V+WD F VPEL++FL IL +EE++K  Q+ ++Y   ++ L+  +++
Sbjct:   47 QDLKQKIEAFNKMVQNGLIMKLADDETFTGFIKVHLKLRR-------ANKPNI-----QTPSDTLKELTQNKPANKQTPFYVPLDAMKQLHIS-SVTTTSEVIRGLLLKFQVADDPQKFALFKH-MHRDGQVLIQKLALTEHPLYLRL---LAGPETDVLS-----FVLKENDTGEVQWDAFTVPELQNFLLILEKEERDKVQQVHKKYAAFRQHLQDALAE 246          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Xenopus
Match: rassf3 (Ras association (RalGDS/AF-6) domain family member 3 [Source:NCBI gene;Acc:448113])

HSP 1 Score: 88.9669 bits (219), Expect = 3.239e-19
Identity = 62/197 (31.47%), Postives = 104/197 (52.79%), Query Frame = 2
Query:  845 ANALIMGKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCMS 1435
            ++ +  G ++V + L RPI    T R  +    +S  +              E  F+LP+G+ N+++I+ T  T  ++I  LL KF I +NP KFALY+       +V + KL+  + P  + L   + G      +L+   FVL+E++ G V W+ F +PEL++FL+IL +EE E+   + RRY   + +LE  +S
Sbjct:   80 SSGIYTGFIKVQMELRRPI----TVRGRAHSHAHSNGN--------------ETAFYLPKGSLNILHISST-NTVREVIEALLKKFLIADNPAKFALYKRC-QKEDQVYMCKLSDREHPLYLRL---VAGP-----SLEALSFVLREHETGDVMWEAFTLPELQNFLRILDKEEDEQLQSLKRRYTSYRAKLEEALS 248          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Xenopus
Match: RASSF1 (Ras association domain family member 1 [Source:NCBI gene;Acc:100497994])

HSP 1 Score: 88.5817 bits (218), Expect = 4.673e-19
Identity = 61/219 (27.85%), Postives = 110/219 (50.23%), Query Frame = 2
Query:  785 DLTDLIRVFNDN-DQGLFIE-EANALIMGKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCMS 1435
            +L   I+ +N      LF+    +    G ++V + L+RP+ +  + +P  + D+        I                          +  KT  +++I  LL KF + +NP+KFAL+E T     +V +RKL  E+ P ++ L   L+G  +  ++     FVL+EN+ G V WD F +PEL++FL+IL +EE+E   QI++RY   +++++  ++
Sbjct:   69 ELEQKIKAYNSQIKSNLFMSLNKDGSFTGFIKVQLKLVRPVSVPASKKPSCLQDRKGSGRSQPIKPP----------------------ASELKTPASEVIQALLRKFTVLDNPRKFALFERTEQE-GQVSLRKLTDEEEPLKLRL---LSGPCDKTLS-----FVLKENETGEVNWDAFSMPELQNFLRILQREEEEHMRQIVQRYTRCREKMQEALA 256          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Xenopus
Match: rassf3 (Ras association (RalGDS/AF-6) domain family member 3 [Source:NCBI gene;Acc:448113])

HSP 1 Score: 88.9669 bits (219), Expect = 5.670e-19
Identity = 62/197 (31.47%), Postives = 104/197 (52.79%), Query Frame = 2
Query:  845 ANALIMGKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCMS 1435
            ++ +  G ++V + L RPI    T R  +    +S  +              E  F+LP+G+ N+++I+ T  T  ++I  LL KF I +NP KFALY+       +V + KL+  + P  + L   + G      +L+   FVL+E++ G V W+ F +PEL++FL+IL +EE E+   + RRY   + +LE  +S
Sbjct:  120 SSGIYTGFIKVQMELRRPI----TVRGRAHSHAHSNGN--------------ETAFYLPKGSLNILHISST-NTVREVIEALLKKFLIADNPAKFALYKRC-QKEDQVYMCKLSDREHPLYLRL---VAGP-----SLEALSFVLREHETGDVMWEAFTLPELQNFLRILDKEEDEQLQSLKRRYTSYRAKLEEALS 288          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Xenopus
Match: RASSF1 (Ras association domain family member 1 [Source:NCBI gene;Acc:100497994])

HSP 1 Score: 89.3521 bits (220), Expect = 9.163e-19
Identity = 61/219 (27.85%), Postives = 110/219 (50.23%), Query Frame = 2
Query:  785 DLTDLIRVFNDN-DQGLFIE-EANALIMGKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCMS 1435
            +L   I+ +N      LF+    +    G ++V + L+RP+ +  + +P  + D+        I                          +  KT  +++I  LL KF + +NP+KFAL+E T     +V +RKL  E+ P ++ L   L+G  +  ++     FVL+EN+ G V WD F +PEL++FL+IL +EE+E   QI++RY   +++++  ++
Sbjct:  137 ELEQKIKAYNSQIKSNLFMSLNKDGSFTGFIKVQLKLVRPVSVPASKKPSCLQDRKGSGRSQPIKPP----------------------ASELKTPASEVIQALLRKFTVLDNPRKFALFERT-EQEGQVSLRKLTDEEEPLKLRL---LSGPCDKTLS-----FVLKENETGEVNWDAFSMPELQNFLRILQREEEEHMRQIVQRYTRCREKMQEALA 324          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Mouse
Match: Rassf1 (Ras association (RalGDS/AF-6) domain family member 1 [Source:MGI Symbol;Acc:MGI:1928386])

HSP 1 Score: 103.219 bits (256), Expect = 4.727e-24
Identity = 59/190 (31.05%), Postives = 110/190 (57.89%), Query Frame = 2
Query:  863 GKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCM 1432
            G ++V + L+RP+ +  + +PPS+ D        +  T +     +   F+LP+     +++ +++T   ++I  LL KF + ++P+KFAL+E T     +V +RKL+ ++ P ++ L   L G  E  ++     FVL+END G V WD F +PEL +FL+IL +EE+E   QI+++Y   +++++  +
Sbjct:   92 GFIKVQLKLVRPVSVPSSKKPPSLQDA-------RRGTGRSTAVKRRTSFYLPKDAIKHLHV-LSRTRAREVIEALLRKFMVVDDPRKFALFERT-ERHGQVYLRKLSDDEQPLKLRL---LAGPSEKALS-----FVLKENDSGEVNWDAFSMPELHNFLRILQREEEEHLRQILQKYSRCRQKIQEAL 264          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Mouse
Match: Rassf1 (Ras association (RalGDS/AF-6) domain family member 1 [Source:MGI Symbol;Acc:MGI:1928386])

HSP 1 Score: 103.219 bits (256), Expect = 1.389e-23
Identity = 59/190 (31.05%), Postives = 110/190 (57.89%), Query Frame = 2
Query:  863 GKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCM 1432
            G ++V + L+RP+ +  + +PPS+ D        +  T +     +   F+LP+     +++ +++T   ++I  LL KF + ++P+KFAL+E T     +V +RKL+ ++ P ++ L   L G  E  ++     FVL+END G V WD F +PEL +FL+IL +EE+E   QI+++Y   +++++  +
Sbjct:  162 GFIKVQLKLVRPVSVPSSKKPPSLQDA-------RRGTGRSTAVKRRTSFYLPKDAIKHLHV-LSRTRAREVIEALLRKFMVVDDPRKFALFERT-ERHGQVYLRKLSDDEQPLKLRL---LAGPSEKALS-----FVLKENDSGEVNWDAFSMPELHNFLRILQREEEEHLRQILQKYSRCRQKIQEAL 334          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Mouse
Match: Rassf1 (Ras association (RalGDS/AF-6) domain family member 1 [Source:MGI Symbol;Acc:MGI:1928386])

HSP 1 Score: 103.219 bits (256), Expect = 1.409e-23
Identity = 59/190 (31.05%), Postives = 110/190 (57.89%), Query Frame = 2
Query:  863 GKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCM 1432
            G ++V + L+RP+ +  + +PPS+ D        +  T +     +   F+LP+     +++ +++T   ++I  LL KF + ++P+KFAL+E T     +V +RKL+ ++ P ++ L   L G  E  ++     FVL+END G V WD F +PEL +FL+IL +EE+E   QI+++Y   +++++  +
Sbjct:  166 GFIKVQLKLVRPVSVPSSKKPPSLQDA-------RRGTGRSTAVKRRTSFYLPKDAIKHLHV-LSRTRAREVIEALLRKFMVVDDPRKFALFERT-ERHGQVYLRKLSDDEQPLKLRL---LAGPSEKALS-----FVLKENDSGEVNWDAFSMPELHNFLRILQREEEEHLRQILQKYSRCRQKIQEAL 338          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Mouse
Match: Rassf5 (Ras association (RalGDS/AF-6) domain family member 5 [Source:MGI Symbol;Acc:MGI:1926375])

HSP 1 Score: 97.4413 bits (241), Expect = 3.911e-22
Identity = 63/190 (33.16%), Postives = 107/190 (56.32%), Query Frame = 2
Query:  863 GKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCM 1432
            G ++V++ L RP+ +    RP S+ D   + +         A  +K   F+LP      ++I+ T TT +++I  LL KF + +NP+KFAL++  I    +V  +KL+   +P  + L   L G +   ++     FVL+EN+ G VEWD F +PEL++FL IL +EEQ+K  Q+ ++Y   +++LE  +
Sbjct:   85 GFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNP-------AATTDKRTSFYLPLDAIKQLHISST-TTVSEVIQGLLKKFMVVDNPQKFALFKR-IHKDGQVLFQKLSIADYPLYLRL---LAGPDTDVLS-----FVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIHQLQKKYNKFRQKLEEAL 257          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Mouse
Match: Rassf5 (Ras association (RalGDS/AF-6) domain family member 5 [Source:MGI Symbol;Acc:MGI:1926375])

HSP 1 Score: 96.6709 bits (239), Expect = 1.561e-21
Identity = 63/190 (33.16%), Postives = 107/190 (56.32%), Query Frame = 2
Query:  863 GKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCM 1432
            G ++V++ L RP+ +    RP S+ D   + +         A  +K   F+LP      ++I+ T TT +++I  LL KF + +NP+KFAL++  I    +V  +KL+   +P  + L   L G +   ++     FVL+EN+ G VEWD F +PEL++FL IL +EEQ+K  Q+ ++Y   +++LE  +
Sbjct:  133 GFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNPA-------ATTDKRTSFYLPLDAIKQLHISST-TTVSEVIQGLLKKFMVVDNPQKFALFKR-IHKDGQVLFQKLSIADYPLYLRL---LAGPDTDVLS-----FVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIHQLQKKYNKFRQKLEEAL 305          
BLAST of Ras association domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q99MK9|RASF1_MOUSE (Ras association domain-containing protein 1 OS=Mus musculus OX=10090 GN=Rassf1 PE=1 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 9.718e-23
Identity = 59/190 (31.05%), Postives = 110/190 (57.89%), Query Frame = 2
Query:  863 GKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCM 1432
            G ++V + L+RP+ +  + +PPS+ D        +  T +     +   F+LP+     +++ +++T   ++I  LL KF + ++P+KFAL+E T     +V +RKL+ ++ P ++ L   L G  E  ++     FVL+END G V WD F +PEL +FL+IL +EE+E   QI+++Y   +++++  +
Sbjct:  162 GFIKVQLKLVRPVSVPSSKKPPSLQDA-------RRGTGRSTAVKRRTSFYLPKDAIKHLHV-LSRTRAREVIEALLRKFMVVDDPRKFALFERT-ERHGQVYLRKLSDDEQPLKLRL---LAGPSEKALS-----FVLKENDSGEVNWDAFSMPELHNFLRILQREEEEHLRQILQKYSRCRQKIQEAL 334          
BLAST of Ras association domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q9NS23|RASF1_HUMAN (Ras association domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RASSF1 PE=1 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 3.383e-21
Identity = 57/190 (30.00%), Postives = 112/190 (58.95%), Query Frame = 2
Query:  863 GKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCM 1432
            G ++V + L+RP+ +  + +PPS+ D  ++    + ++++R        F+LP+     +++ +++T   ++I  LL KF + ++P+KFAL+E       +V +RKL  ++ P ++ L   L G  +  ++     FVL+END G V WD F +PEL +FL+IL +EE+E   QI+++Y   +++++  +
Sbjct:  166 GFIKVQLKLVRPVSVPSSKKPPSLQD--ARRGPGRGTSVRR-----RTSFYLPKDAVKHLHV-LSRTRAREVIEALLRKFLVVDDPRKFALFERA-ERHGQVYLRKLLDDEQPLRLRL---LAGPSDKALS-----FVLKENDSGEVNWDAFSMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEAL 338          
BLAST of Ras association domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q5EBH1|RASF5_MOUSE (Ras association domain-containing protein 5 OS=Mus musculus OX=10090 GN=Rassf5 PE=1 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 5.739e-20
Identity = 63/190 (33.16%), Postives = 107/190 (56.32%), Query Frame = 2
Query:  863 GKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCM 1432
            G ++V++ L RP+ +    RP S+ D   + +         A  +K   F+LP      ++I+ T TT +++I  LL KF + +NP+KFAL++  I    +V  +KL+   +P  + L   L G +   ++     FVL+EN+ G VEWD F +PEL++FL IL +EEQ+K  Q+ ++Y   +++LE  +
Sbjct:  233 GFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNPA-------ATTDKRTSFYLPLDAIKQLHISST-TTVSEVIQGLLKKFMVVDNPQKFALFKR-IHKDGQVLFQKLSIADYPLYLRL---LAGPDTDVLS-----FVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIHQLQKKYNKFRQKLEEAL 405          
BLAST of Ras association domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q8WWW0|RASF5_HUMAN (Ras association domain-containing protein 5 OS=Homo sapiens OX=9606 GN=RASSF5 PE=1 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 2.043e-19
Identity = 63/190 (33.16%), Postives = 107/190 (56.32%), Query Frame = 2
Query:  863 GKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCM 1432
            G ++V++ L RP+ +    RP S+ D   + +         A  +K   F+LP      ++I+ T TT +++I  LL KF + +NP+KFAL++  I    +V  +KL+    P  + L   L G +   ++     FVL+EN+ G VEWD F +PEL++FL IL +EEQ+K  Q+ ++Y+  +++LE  +
Sbjct:  238 GFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNLA-------ATTDKRTSFYLPLDAIKQLHISST-TTVSEVIQGLLKKFMVVDNPQKFALFKR-IHKDGQVLFQKLSIADRPLYLRL---LAGPDTEVLS-----FVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEAL 410          
BLAST of Ras association domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|O35141|RASF5_RAT (Ras association domain-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Rassf5 PE=1 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 5.787e-19
Identity = 62/190 (32.63%), Postives = 106/190 (55.79%), Query Frame = 2
Query:  863 GKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCM 1432
            G ++V++ L RP+ +    RP S+ D   + +         A  +K   F+LP      ++I+ + TT +++I  LL KF + +NP+KFAL++  I    +V  +KL+    P  + L   L G +   ++     FVL+EN+ G VEWD F +PEL++FL IL +EEQ+K  Q+ ++Y   +++LE  +
Sbjct:  233 GFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNPA-------ATTDKRTSFYLPLDAIKQLHIS-SSTTVSEVIQGLLKKFMVVDNPQKFALFKR-IHKDGQVLFQKLSIADCPLYLRL---LAGPDTDVLS-----FVLKENETGDVEWDAFSIPELQNFLTILEKEEQDKIHQLQKKYNKFRQKLEEAL 405          
BLAST of Ras association domain-containing protein 1 vs. TrEMBL
Match: W6V217 (Ras association domain-containing protein OS=Echinococcus granulosus OX=6210 GN=EGR_00266 PE=4 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 1.014e-38
Identity = 114/351 (32.48%), Postives = 175/351 (49.86%), Query Frame = 2
Query:  572 IDTYTFSTVDLSTIRQYGISIKKL-------------------PSIRIKTHQXXXXXXXXXXXXXXXXXXXXXXISAVPND---PYDSLELPRDLTDLIRVFNDNDQGLFIEEANAL----IMGKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKE------------------AIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNG-------------KEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCMSKLAAVR 1453
            + TY  S++D   IR+ GIS+ +L                   P + + +       A  T   T         ++  P +   P+  +EL R L     +FN ND GL  +    L      G+VRV+INL+RP++M+LTARPPS+ D     D D  ST + A+   +                    F LPRG++ +++++++ TT + +IS LL +FNI +NP+KFALYEHTI    +V VRKL  ++ P  ++L+W L+              +E +   L  KR VLQEN+ G +EW  F   EL++FL IL +EE + R +I  +Y++ K E+ R M+  A  R
Sbjct:  408 VGTYDISSLDRRDIRERGISVWQLSPAVASSLALSATVAANDAPPVVMSSRMQATGLAAVTGHQTGAEEITYTKVTIGPRNAALPWKPMELARRLN----IFNTNDFGLCAKMNPKLQPGDCEGQVRVHINLIRPVRMVLTARPPSIFDIVGGDDGDDPSTEEEAFTRAQQPKSARSVRLRSKTIGRITSFRLPRGSSKLLHVHLS-TTASQVISSLLDRFNIDDNPQKFALYEHTIFGEHDVSVRKLFEDESPLGLLLQWTLDSSAEGGGKAGEALNREHFNAILTVKRIVLQENETGDIEWSSFSEAELRTFLNILNREEADYRRRIELKYQIRKHEILRLMNLRARCR 753          
BLAST of Ras association domain-containing protein 1 vs. TrEMBL
Match: A0A068WCQ8 (Rassf1 OS=Echinococcus granulosus OX=6210 GN=EgrG_000785100 PE=4 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 1.066e-38
Identity = 114/351 (32.48%), Postives = 175/351 (49.86%), Query Frame = 2
Query:  572 IDTYTFSTVDLSTIRQYGISIKKL-------------------PSIRIKTHQXXXXXXXXXXXXXXXXXXXXXXISAVPND---PYDSLELPRDLTDLIRVFNDNDQGLFIEEANAL----IMGKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKE------------------AIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNG-------------KEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCMSKLAAVR 1453
            + TY  S++D   IR+ GIS+ +L                   P + + +       A  T   T         ++  P +   P+  +EL R L     +FN ND GL  +    L      G+VRV+INL+RP++M+LTARPPS+ D     D D  ST + A+   +                    F LPRG++ +++++++ TT + +IS LL +FNI +NP+KFALYEHTI    +V VRKL  ++ P  ++L+W L+              +E +   L  KR VLQEN+ G +EW  F   EL++FL IL +EE + R +I  +Y++ K E+ R M+  A  R
Sbjct:  384 VGTYDISSLDRRDIRERGISVWQLSPAVASSLALSATVAANDAPPVVMSSRMQATGLAAVTGHQTGAEEITYTKVTIGPRNAALPWKPMELARRLN----IFNTNDFGLCAKMNPKLQPGDCEGQVRVHINLIRPVRMVLTARPPSIFDIVGGDDGDDPSTEEEAFTRAQQPKSARSVRLRSKTIGRITSFRLPRGSSKLLHVHLS-TTASQVISSLLDRFNIDDNPQKFALYEHTIFGEHDVSVRKLFEDESPLGLLLQWTLDSSAEGGGKAGEALNREHFNAILTVKRIVLQENETGDIEWSSFSEAELRTFLNILNREEADYRRRIELKYQIRKHEILRLMNLRARCR 729          
BLAST of Ras association domain-containing protein 1 vs. TrEMBL
Match: A0A504YL93 (Rassf1 OS=Fasciola gigantica OX=46835 GN=FGIG_02684 PE=4 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 5.266e-38
Identity = 96/270 (35.56%), Postives = 142/270 (52.59%), Query Frame = 2
Query:  785 DLTDLIRVFNDNDQGLFIEEANAL----IMGKVRVYINLLRPIKMLLTARPPSMLD---------------------QYSQSDKDKISTIQRAYYN----------------------------KEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCMS 1435
            +L + +  FN N+ GL    A+ L      G+VR++INLLRPI+MLL  RP S+ D                       ++S+   ++  + A  N                            K ++FW+PRG+T V+++ ++ TT   +IS LL +F I++NP+KFALYEHTI    EV VRKL  ++ P  ++ +W  NG  ++   L  KR VLQEN+ G +EW  F +PEL  FL IL QEE + R +I  ++EV +KEL R M+
Sbjct:  359 ELDERVSSFNKNEFGLQALVASGLPDGDCEGQVRIHINLLRPIRMLLRPRPASIFDIVGKENEADEEIRDFSWCPPIGNAKSNAPSVNGPKSAVTNNAASFSTDSDVLLWHKFDGKGNQANNRTKSSMFWVPRGSTKVLHVRLS-TTAQKVISTLLDRFQIEDNPQKFALYEHTIEGDQEVSVRKLFDDESPLGLLFRWTENGPGQFNHLLGVKRLVLQENETGDIEWSGFSLPELTVFLGILNQEEADYRRRIEMKFEVRRKELLRLMA 627          
BLAST of Ras association domain-containing protein 1 vs. TrEMBL
Match: A0A0R3WAX2 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS7739 PE=4 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 3.271e-37
Identity = 108/344 (31.40%), Postives = 173/344 (50.29%), Query Frame = 2
Query:  578 TYTFSTVDLSTIRQYGISIKKL-------------------PSIRIKTHQXXXXXXXXXXXXXXXXXXXXXXISAVPND---PYDSLELPRDLTDLIRVFNDNDQGLFIEEANAL----IMGKVRVYINLLRPIKMLLTARPPSMLD---------------QYSQSDKDKISTIQRAYYNKEAI-----FWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLN-------------GKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCM 1432
            TY  S++D   IR+ GIS+ +L                   P + + +       A  T   T         ++  P +   P+  +EL R L     +FN ND GL  +    L      G+VRV+INL+RP++M+LTARPPS+ D               + + +   +  ++       + I     F LPRG++ +++++++ TT + +IS LL +FNI +NP+KFALYEHTI    +V VRKL  ++ P  ++L+W L+              +E + + L  KR VLQEN+ G +EW  F   EL++FL IL +EE + R +I  +Y++ K+E+ R M
Sbjct:  358 TYDISSLDQRDIRERGISVWQLIPAAASPLTSSSTVAATDAPPVVMSSRMQATRLAAVTGHQTGAEEVTYTKVTTGPRNGVLPWKPMELARRLD----IFNANDFGLCAKMTPKLQPGDCEGQVRVHINLIRPVRMVLTARPPSIFDIVGGGDDGGDDPSSGEEASNRTQQPESVSSVRLRGKTIGRITSFRLPRGSSKLLHVHLS-TTASQVISSLLARFNIDDNPQKFALYEHTIFGENDVSVRKLFDDESPLGLLLQWTLDPSVEVGGKAGEALHREHFNVLLAVKRIVLQENETGDIEWSCFSEAELRTFLSILNREEADYRRRIELKYQIRKREILRLM 696          
BLAST of Ras association domain-containing protein 1 vs. TrEMBL
Match: A0A5J4NRQ9 (Uncharacterized protein (Fragment) OS=Paragonimus westermani OX=34504 GN=DEA37_0006994 PE=4 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 1.091e-36
Identity = 97/279 (34.77%), Postives = 142/279 (50.90%), Query Frame = 2
Query:  788 LTDLIRVFNDNDQGLFIEEANAL----IMGKVRVYINLLRPIKMLLTARP------------------------PSMLDQYSQSD------------------KDKISTIQRAY-----------------YNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCMS 1435
            L + + VFN N+ GL      +L      G+VR++INLLRPI+MLLT RP                        PS  D  S +                   K  ++ +  A+                 + + + FWLPRG+T V+Y+ ++  T   +I+ LL +F I++NP+KFALYEHTI    EV VRKL  ++ P  + L+W  +G E +   L  KR VLQEN+ G +EW  F +PEL++FL IL QEE + R +I  +YE+ +KE+ R M+
Sbjct:  363 LLERLAVFNANEFGLHSRSVPSLTPGDCEGQVRIHINLLRPIRMLLTVRPVSIFDLVGKDCEADEEEGYGCAVHPSGDDTPSHAKLRENPPDVLVNGVQCNPPKSAVTAVTPAFSADCPVQRRLSKRLFGAHPQSSTFWLPRGSTKVLYVRLS-MTALKVITTLLGRFQIEDNPQKFALYEHTIEGEQEVSVRKLFDDESPLGLFLRWTEDGPERFNQLLGIKRLVLQENETGDIEWFGFSLPELQTFLGILNQEEADYRRRIELKYELRRKEVLRLMA 640          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Cavefish
Match: RASSF1 (Ras association domain family member 1 [Source:NCBI gene;Acc:103042507])

HSP 1 Score: 105.531 bits (262), Expect = 6.077e-25
Identity = 66/197 (33.50%), Postives = 116/197 (58.88%), Query Frame = 2
Query:  848 NALIMGKVRVYINLLRPIKMLLTARPPSMLDQYSQ--SDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCM 1432
            N    G ++V++ L+RP+ +     PP      SQ  ++  K ++++R        F+LP+ T   ++I+ +KT   ++I  LL KF + +NP KFAL+E T     +V +RKL+ ++ P  + L+ C +G  E  ++L     VL+EN+ G V WD F +PEL++FL+IL +EE+E   QI+RRY + ++ +++ +
Sbjct:   97 NGTYNGFIKVHLKLVRPVSV-----PPPRKGAASQGPANGKKGASVKR-----RTSFYLPKDTAKHLHIS-SKTCAKEVIQALLKKFTVIDNPAKFALFERT-ERHEQVYLRKLSDDECP--LYLRLC-SGPNEKALSL-----VLKENETGEVNWDAFSMPELQNFLRILQREEEEHVKQIVRRYTLARERIQQSL 273          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Cavefish
Match: RASSF1 (Ras association domain family member 1 [Source:NCBI gene;Acc:103042507])

HSP 1 Score: 105.145 bits (261), Expect = 3.916e-24
Identity = 66/197 (33.50%), Postives = 116/197 (58.88%), Query Frame = 2
Query:  848 NALIMGKVRVYINLLRPIKMLLTARPPSMLDQYSQ--SDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCM 1432
            N    G ++V++ L+RP+ +     PP      SQ  ++  K ++++R        F+LP+ T   ++I+ +KT   ++I  LL KF + +NP KFAL+E T     +V +RKL+ ++ P  + L+ C +G  E  ++L     VL+EN+ G V WD F +PEL++FL+IL +EE+E   QI+RRY + ++ +++ +
Sbjct:  186 NGTYNGFIKVHLKLVRPVSV-----PPPRKGAASQGPANGKKGASVKR-----RTSFYLPKDTAKHLHIS-SKTCAKEVIQALLKKFTVIDNPAKFALFERT-ERHEQVYLRKLSDDECP--LYLRLC-SGPNEKALSL-----VLKENETGEVNWDAFSMPELQNFLRILQREEEEHVKQIVRRYTLARERIQQSL 362          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Cavefish
Match: rassf1 (ras association domain-containing protein 1-like [Source:NCBI gene;Acc:103033109])

HSP 1 Score: 94.3597 bits (233), Expect = 2.681e-21
Identity = 51/145 (35.17%), Postives = 86/145 (59.31%), Query Frame = 2
Query: 1010 FWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCMSKLA 1444
            F+LPR     ++++ + T   ++I+ LL KF + +NP KFAL+E +     +V ++KL  E+ P Q+ L  C    E      K   FVL+EN+ G V W+ F +PELK+F++IL +EE++   QIIRRY + ++++   +   +
Sbjct:  121 FYLPRDAAKHLHVS-SHTQVREVITALLNKFTVVDNPAKFALFERS-ERHGQVYLKKLGDEECPLQLRL--CAGPSE------KSLSFVLKENETGEVNWEAFSLPELKNFMRILQKEEEDHVRQIIRRYSLAREKMREALKHFS 255          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Cavefish
Match: rassf1 (ras association domain-containing protein 1-like [Source:NCBI gene;Acc:103033109])

HSP 1 Score: 93.9745 bits (232), Expect = 1.991e-20
Identity = 51/145 (35.17%), Postives = 86/145 (59.31%), Query Frame = 2
Query: 1010 FWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCMSKLA 1444
            F+LPR     ++++ + T   ++I+ LL KF + +NP KFAL+E +     +V ++KL  E+ P Q+ L  C    E      K   FVL+EN+ G V W+ F +PELK+F++IL +EE++   QIIRRY + ++++   +   +
Sbjct:  219 FYLPRDAAKHLHVS-SHTQVREVITALLNKFTVVDNPAKFALFERS-ERHGQVYLKKLGDEECPLQLRL--CAGPSE------KSLSFVLKENETGEVNWEAFSLPELKNFMRILQKEEEDHVRQIIRRYSLAREKMREALKHFS 353          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Cavefish
Match: si:dkey-85p17.3 (Ras association domain family member 5 [Source:NCBI gene;Acc:103034359])

HSP 1 Score: 90.8929 bits (224), Expect = 4.217e-20
Identity = 63/194 (32.47%), Postives = 102/194 (52.58%), Query Frame = 2
Query:  863 GKVRVYINLLRPIKMLLT-ARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCMSKL 1441
            G ++V++ L RP+ +L    + P        SD+                F++P  T   ++I+ T TT  ++I  LL K+ +Q+NP+KFALY  T     ++ ++KLA  + P  + L   L G      +L+   FVL+EN+ G VEW  F VPEL++FL IL +EE+E+  Q+  RY   K +L   + ++
Sbjct:   86 GFIKVHLKLRRPVTILSPDGKAPGCSPAADVSDR-------------RTSFYMPSDTVKQLHISST-TTVNEVIQGLLKKYTVQDNPRKFALYRRTHRDGQDL-IQKLAGTEHPLFLRL---LAGP-----DLENLSFVLKENETGEVEWHAFSVPELQNFLTILEKEERERVKQVELRYTAYKNKLMEALQEV 256          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: rassf3 (Ras association domain family member 3 [Source:ZFIN;Acc:ZDB-GENE-100422-9])

HSP 1 Score: 99.7525 bits (247), Expect = 1.457e-23
Identity = 66/208 (31.73%), Postives = 111/208 (53.37%), Query Frame = 2
Query:  833 FIEEANALIMGKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKI-------STIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCMS 1435
             +++ N    G ++V +NL RP+ +    R  + L Q   +            ST +R        F+LPRGT   V+++ T  T  ++I  LL KF + +NP+KFAL++H+     +V  RKL  E+ P  + L   LNG ++  +     RFV+QEN+ G V W+ F VPEL++FL+IL +EE     ++  +Y+  +++L   ++
Sbjct:   84 MVQQENGTFTGFIKVQLNLQRPVSVADDGRAHNALLQPVATPGPAGGGGGTCESTARRT------TFYLPRGTEKQVHLSST-NTAREVIEALLRKFQVMDNPRKFALFQHS-GPDGQVSKRKLTDEENPLHLRL---LNGPDQTAM-----RFVMQENETGEVIWEAFTVPELQNFLRILKREEDAYVLKVQEKYDSYRQKLVEALA 275          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: rassf4a (Ras association domain family member 4a [Source:ZFIN;Acc:ZDB-GENE-050102-3])

HSP 1 Score: 56.225 bits (134), Expect = 6.740e-9
Identity = 45/163 (27.61%), Postives = 83/163 (50.92%), Query Frame = 2
Query:  974 TIQRAYYN-KEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGS------VEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCMSKL 1441
            +I   YYN K ++F    G+   V ++ +  T+ +++S LL KF ++NN   FALY    T     + R+L   +FP   ++   L+G  E     K  R  L E D G        ++ +F +P L+SF+  L +EE  +  ++ R+++ ++  +E+ + +L
Sbjct:  169 SINGHYYNHKTSVFTPTYGSVTSVRVS-SNMTSPEVVSSLLYKFRVENNSSDFALYIVRATG----EKRRLKVSEFP---LITRILHGPSE-----KIARLFLMEEDLGEEVTHDVAQYIQFEMPVLESFVSKLKEEEVREENKLKRKFDALRSVIEQRLQEL 318          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010718.1 (pep scaffold:Pmarinus_7.0:GL483921:10179:11239:1 gene:ENSPMAG00000009706.1 transcript:ENSPMAT00000010718.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.6766 bits (117), Expect = 9.967e-8
Identity = 34/121 (28.10%), Postives = 62/121 (51.24%), Query Frame = 2
Query:  785 DLTDLIRVFNDN-DQGLFIE-EANALIMGKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYE 1141
            DL   I  FN   D G+ I  +A+    G +RV+++L RPI +    RPPS+ +          + +      +   F+LP      ++++ + TT  ++I  LL KF + ++P+KFA+++
Sbjct:    1 DLKAKISEFNSQVDNGMVITLQADDSYTGFIRVHMSLSRPISVESGKRPPSIYEALRSGAGGGGAGL-----RRRTSFYLPHDAVKQLHVS-SATTAREVIEALLRKFMVLDSPRKFAIFQ 115          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO41731 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3I3])

HSP 1 Score: 103.99 bits (258), Expect = 5.488e-25
Identity = 73/215 (33.95%), Postives = 113/215 (52.56%), Query Frame = 2
Query:  752 NDPYD--SLELPRD-LTDLIRVFNDNDQGLFIEEANALIMGKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQI 1387
            N+P+   S +L +D +   I  FN    GL +        G VRV++NLLRPI ++   RP S+ +     +  KI   QR        F+LP GT   ++I+ T TT  ++I  LL KF + +NP+KFAL+E        + +R++A  + P  + L W   G +       K  F LQEN+ G + W+ F + EL++FL+IL +EE+E   Q+
Sbjct:   71 NEPFTLVSTQLQQDTMRQKIEEFNAKTTGLIMTMKEDAFQGFVRVHMNLLRPINIVAGERPLSIFEAVRSENSKKI---QRTS------FFLPLGTVKALHISST-TTVQEVIEALLKKFKVADNPRKFALFECYQEEDRHLILRRMADMERPLVLRLLW--GGGD------IKHSFSLQENETGDIVWEVFSLTELQNFLRILDKEEEELIEQV 267          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Medaka
Match: rassf1 (ras association domain-containing protein 1 [Source:NCBI gene;Acc:101161547])

HSP 1 Score: 102.449 bits (254), Expect = 1.691e-22
Identity = 67/224 (29.91%), Postives = 122/224 (54.46%), Query Frame = 2
Query:  779 PRDLTDLIRVFND--NDQGLFIEEANALIMGKVRVYINLLRPIKMLLTARPP-SMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCMSKL 1441
            P ++   ++ +N   N+    ++  +    G ++V+  L+RP+ +     PP        Q ++ +   ++R        F+LP+ +   ++I+ ++T   ++I  LL KF + +NP KFAL+E T    + V +RKL+ ++ P  + L+ C  G  E  + L     VL+END G V WD F  PEL +FL+IL +EE+E   QI+RRY + K+ +++ M+++
Sbjct:  363 PAEIQQRVKEYNAQINNNLYMVDNKDGSFTGFIKVHFQLVRPVSL-----PPLPQCQGLVQGEEQQGRCMKR-----RTSFYLPKDSAKHLHIS-SETRVREVIQALLNKFTVVDNPAKFALFERT-EKQSYVSMRKLSADERP--LHLRLC-AGPSETLLCL-----VLKENDTGDVNWDAFSFPELCNFLQILQREEEEHVRQIVRRYTLAKERIKQAMAQI 566          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Medaka
Match: RASSF1 (Ras association domain family member 1 [Source:NCBI gene;Acc:101169599])

HSP 1 Score: 92.8189 bits (229), Expect = 1.650e-20
Identity = 60/191 (31.41%), Postives = 106/191 (55.50%), Query Frame = 2
Query:  863 GKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCMS 1435
            G ++V   L RP+ +      P+       +   + S ++R        F+LP+  +  ++I+ ++T+  ++I  LL KF + +NP KFAL+E +     +V +RKL+ E+ P  + L+ C +G  E  ++     FVL+EN+ G V W  F +PELK+FL IL +EE+E   QII+RY + + ++   ++
Sbjct:  105 GFIKVQFKLARPVSV------PAPKKGSQDACGRRASGVKR-----RTSFYLPKDASKYLHIS-SRTSAREVIEALLKKFTVVDNPGKFALFERS-ERHDQVYIRKLSDEERP--LRLRLC-SGPSEKVLS-----FVLKENETGEVNWHAFSMPELKNFLLILQREEEEHVKQIIQRYALARTKMRDALA 274          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Medaka
Match: RASSF1 (Ras association domain family member 1 [Source:NCBI gene;Acc:101169599])

HSP 1 Score: 92.0485 bits (227), Expect = 9.134e-20
Identity = 60/186 (32.26%), Postives = 104/186 (55.91%), Query Frame = 2
Query:  863 GKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKEL 1420
            G ++V   L RP+ +      P+       +   + S ++R        F+LP+  +  ++I+ ++T+  ++I  LL KF + +NP KFAL+E +     +V +RKL+ E+ P  + L+ C +G  E  ++     FVL+EN+ G V W  F +PELK+FL IL +EE+E   QII+RY + + ++
Sbjct:  190 GFIKVQFKLARPVSV------PAPKKGSQDACGRRASGVKR-----RTSFYLPKDASKYLHIS-SRTSAREVIEALLKKFTVVDNPGKFALFERS-ERHDQVYIRKLSDEERP--LRLRLC-SGPSEKVLS-----FVLKENETGEVNWHAFSMPELKNFLLILQREEEEHVKQIIQRYALARTKM 354          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Medaka
Match: rassf3 (Ras association domain family member 3 [Source:NCBI gene;Acc:101166431])

HSP 1 Score: 86.6557 bits (213), Expect = 1.576e-18
Identity = 52/141 (36.88%), Postives = 82/141 (58.16%), Query Frame = 2
Query: 1001 EAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELE 1423
            E  F+LP+    +++I+ +  T   ++  LL KF + +NP K+ALY+       +V V KLA  + P  + L   L G ++  ++L     VL+E   G V WD F +PEL++FL IL +EEQE++  +IRRY + +K LE
Sbjct:  129 EEAFYLPQEVNMILHIS-SNHTARQVVGALLGKFKVVDNPAKYALYK-RCRREEQVYVCKLAEAECPLYLRL---LAGPDQDSLSL-----VLREQQTGEVMWDAFSIPELRNFLLILDKEEQEQKDALIRRYTLYRKRLE 259          
BLAST of Ras association domain-containing protein 1 vs. Ensembl Medaka
Match: rassf3 (Ras association domain family member 3 [Source:NCBI gene;Acc:101166431])

HSP 1 Score: 85.1149 bits (209), Expect = 3.947e-18
Identity = 52/146 (35.62%), Postives = 84/146 (57.53%), Query Frame = 2
Query: 1001 EAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCMSK 1438
            E  F+LP+    +++I+ +  T   ++  LL KF + +NP K+ALY+       +V V KLA  + P  + L   L G ++  ++L     VL+E   G V WD F +PEL++FL IL +EEQE++  +IRRY + +K LE  + +
Sbjct:  110 EEAFYLPQEVNMILHIS-SNHTARQVVGALLGKFKVVDNPAKYALYKR-CRREEQVYVCKLAEAECPLYLRL---LAGPDQDSLSL-----VLREQQTGEVMWDAFSIPELRNFLLILDKEEQEQKDALIRRYTLYRKRLEEAIRQ 245          
BLAST of Ras association domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000029652.1 (SMESG000029652.1)

HSP 1 Score: 878.241 bits (2268), Expect = 0.000e+0
Identity = 476/476 (100.00%), Postives = 476/476 (100.00%), Query Frame = 2
Query:   29 MSNLSPNDHSKEKKRSFFGRLFNFAXXXXXXXXXXXXXXXXXXXXXXXXLISKTDNDEIETCTFCDYCDKEIVAKFTGQNFICHRACRNDNITALDNSVAPNGLTSTDFASSRSLESELANGCGGGVGSTLSCSLGDLSIPYADDDTTLAADGSTAAGTYRCNRNTRTNSTMKANLILTSNIDTYTFSTVDLSTIRQYGISIKKLPSIRIKTHQXXXXXXXXXXXXXXXXXXXXXXISAVPNDPYDSLELPRDLTDLIRVFNDNDQGLFIEEANALIMGKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCMSKLAAVRF 1456
            MSNLSPNDHSKEKKRSFFGRLFNFASHSMKSNKKSIISKKKFKKSNDINLISKTDNDEIETCTFCDYCDKEIVAKFTGQNFICHRACRNDNITALDNSVAPNGLTSTDFASSRSLESELANGCGGGVGSTLSCSLGDLSIPYADDDTTLAADGSTAAGTYRCNRNTRTNSTMKANLILTSNIDTYTFSTVDLSTIRQYGISIKKLPSIRIKTHQIKAAAAIATATATSTSIKEKAAISAVPNDPYDSLELPRDLTDLIRVFNDNDQGLFIEEANALIMGKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCMSKLAAVRF
Sbjct:    1 MSNLSPNDHSKEKKRSFFGRLFNFASHSMKSNKKSIISKKKFKKSNDINLISKTDNDEIETCTFCDYCDKEIVAKFTGQNFICHRACRNDNITALDNSVAPNGLTSTDFASSRSLESELANGCGGGVGSTLSCSLGDLSIPYADDDTTLAADGSTAAGTYRCNRNTRTNSTMKANLILTSNIDTYTFSTVDLSTIRQYGISIKKLPSIRIKTHQIKAAAAIATATATSTSIKEKAAISAVPNDPYDSLELPRDLTDLIRVFNDNDQGLFIEEANALIMGKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCMSKLAAVRF 476          
BLAST of Ras association domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000029652.1 (SMESG000029652.1)

HSP 1 Score: 833.173 bits (2151), Expect = 0.000e+0
Identity = 427/427 (100.00%), Postives = 427/427 (100.00%), Query Frame = 2
Query:  176 LISKTDNDEIETCTFCDYCDKEIVAKFTGQNFICHRACRNDNITALDNSVAPNGLTSTDFASSRSLESELANGCGGGVGSTLSCSLGDLSIPYADDDTTLAADGSTAAGTYRCNRNTRTNSTMKANLILTSNIDTYTFSTVDLSTIRQYGISIKKLPSIRIKTHQXXXXXXXXXXXXXXXXXXXXXXISAVPNDPYDSLELPRDLTDLIRVFNDNDQGLFIEEANALIMGKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCMSKLAAVRF 1456
            LISKTDNDEIETCTFCDYCDKEIVAKFTGQNFICHRACRNDNITALDNSVAPNGLTSTDFASSRSLESELANGCGGGVGSTLSCSLGDLSIPYADDDTTLAADGSTAAGTYRCNRNTRTNSTMKANLILTSNIDTYTFSTVDLSTIRQYGISIKKLPSIRIKTHQIKAAAAIATATATSTSIKEKAAISAVPNDPYDSLELPRDLTDLIRVFNDNDQGLFIEEANALIMGKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCMSKLAAVRF
Sbjct:   22 LISKTDNDEIETCTFCDYCDKEIVAKFTGQNFICHRACRNDNITALDNSVAPNGLTSTDFASSRSLESELANGCGGGVGSTLSCSLGDLSIPYADDDTTLAADGSTAAGTYRCNRNTRTNSTMKANLILTSNIDTYTFSTVDLSTIRQYGISIKKLPSIRIKTHQIKAAAAIATATATSTSIKEKAAISAVPNDPYDSLELPRDLTDLIRVFNDNDQGLFIEEANALIMGKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELERCMSKLAAVRF 448          
BLAST of Ras association domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000021885.1 (SMESG000021885.1)

HSP 1 Score: 158.688 bits (400), Expect = 1.238e-41
Identity = 92/213 (43.19%), Postives = 125/213 (58.69%), Query Frame = 2
Query:  806 VFNDNDQGLFIE----EANALIMGKVRVYINLLRPIKMLLTARPPSMLD--QYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELER 1426
            +FN N+ GL  E         ++G VRVYINLLRPI+M  ++RP S+ D   Y  S     + I      K   FWLPRGT+  +Y+N + TTT ++I+ LL KF+I+ NPKKF LYEHTI     V VRKL   + P   +L W   G+++    +  KR VLQEN+ G +EW  F  PEL +FL IL +EEQE   +I  +Y ++K E+ R
Sbjct:  336 LFNKNNFGLTSELKQRGGEHFLLGTVRVYINLLRPIQMEFSSRPSSIFDVINYKDSQDSLDANI------KVETFWLPRGTSKRLYVNHS-TTTTEVINGLLKKFHIKANPKKFGLYEHTIEGERRVSVRKLMDIECPLGTLLMWT-EGQDKINETMLVKRLVLQENETGDIEWTGFSKPELNNFLLILDREEQENLNKIKLKYSILKNEILR 540          
BLAST of Ras association domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000021885.1 (SMESG000021885.1)

HSP 1 Score: 158.303 bits (399), Expect = 2.504e-41
Identity = 92/213 (43.19%), Postives = 125/213 (58.69%), Query Frame = 2
Query:  806 VFNDNDQGLFIE----EANALIMGKVRVYINLLRPIKMLLTARPPSMLD--QYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRYEVMKKELER 1426
            +FN N+ GL  E         ++G VRVYINLLRPI+M  ++RP S+ D   Y  S     + I      K   FWLPRGT+  +Y+N + TTT ++I+ LL KF+I+ NPKKF LYEHTI     V VRKL   + P   +L W   G+++    +  KR VLQEN+ G +EW  F  PEL +FL IL +EEQE   +I  +Y ++K E+ R
Sbjct:  363 LFNKNNFGLTSELKQRGGEHFLLGTVRVYINLLRPIQMEFSSRPSSIFDVINYKDSQDSLDANI------KVETFWLPRGTSKRLYVNHS-TTTTEVINGLLKKFHIKANPKKFGLYEHTIEGERRVSVRKLMDIECPLGTLLMWT-EGQDKINETMLVKRLVLQENETGDIEWTGFSKPELNNFLLILDREEQENLNKIKLKYSILKNEILR 567          
BLAST of Ras association domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000061902.1 (SMESG000061902.1)

HSP 1 Score: 98.9821 bits (245), Expect = 4.980e-22
Identity = 63/207 (30.43%), Postives = 108/207 (52.17%), Query Frame = 2
Query:  785 DLTDLIRVFNDNDQGL--FIEEANALIMGKVRVYINLLRPIKMLLTARPPSMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADLISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCLNGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKRTQIIRRY 1399
            D  ++I++FN N  G+  F  EAN  +   ++V+INL  P+KM      P+M+   +++                     PRG   ++ I+   +T  ++I  L  KF+IQ N   + L+EHTI    +V V++LA +      +++     K+ + I    KRFVLQEN+   + W +F   EL +FL+IL +EE++++ +II+ Y
Sbjct:  211 DYKEIIQIFNQNSLGMKMFENEANKTLHCNLKVFINLCEPVKMNF----PNMILSSNKT-------------------LFPRGGFELINIDRA-STCKEIIEHLFGKFHIQENYNNYGLFEHTIKDEQKVLVKRLAYDYSILGYIVEMVRFEKDNFPIYFHSKRFVLQENEKVQINWSKFSKSELWNFLRILEREEKDRKQKIIKFY 393          
The following BLAST results are available for this feature:
BLAST of Ras association domain-containing protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RASSF14.291e-2330.00Ras association domain family member 1 [Source:HGN... [more]
RASSF14.291e-2330.00Ras association domain family member 1 [Source:HGN... [more]
RASSF13.255e-2230.00Ras association domain family member 1 [Source:HGN... [more]
RASSF17.045e-2230.00Ras association domain family member 1 [Source:HGN... [more]
RASSF17.302e-2230.00Ras association domain family member 1 [Source:HGN... [more]
back to top
BLAST of Ras association domain-containing protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rsf-12.085e-2230.87RASSF (Ras-association domain family) homolog [So... [more]
rsf-12.085e-2230.87RASSF (Ras-association domain family) homolog [So... [more]
rsf-13.285e-2230.87RASSF (Ras-association domain family) homolog [So... [more]
back to top
BLAST of Ras association domain-containing protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ras association domain-containing protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rassf12.912e-2037.24Ras association domain family member 1 [Source:ZFI... [more]
rassf33.600e-2037.84Ras association domain family member 3 [Source:ZFI... [more]
rassf11.209e-1936.55Ras association domain family member 1 [Source:ZFI... [more]
rassf11.209e-1936.55Ras association domain family member 1 [Source:ZFI... [more]
rassf37.578e-1938.51Ras association domain family member 3 [Source:ZFI... [more]
back to top
BLAST of Ras association domain-containing protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RASSF56.536e-2231.98microsomal glutathione S-transferase 3-like [Sourc... [more]
rassf33.239e-1931.47Ras association (RalGDS/AF-6) domain family member... [more]
RASSF14.673e-1927.85Ras association domain family member 1 [Source:NCB... [more]
rassf35.670e-1931.47Ras association (RalGDS/AF-6) domain family member... [more]
RASSF19.163e-1927.85Ras association domain family member 1 [Source:NCB... [more]
back to top
BLAST of Ras association domain-containing protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rassf14.727e-2431.05Ras association (RalGDS/AF-6) domain family member... [more]
Rassf11.389e-2331.05Ras association (RalGDS/AF-6) domain family member... [more]
Rassf11.409e-2331.05Ras association (RalGDS/AF-6) domain family member... [more]
Rassf53.911e-2233.16Ras association (RalGDS/AF-6) domain family member... [more]
Rassf51.561e-2133.16Ras association (RalGDS/AF-6) domain family member... [more]
back to top
BLAST of Ras association domain-containing protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99MK9|RASF1_MOUSE9.718e-2331.05Ras association domain-containing protein 1 OS=Mus... [more]
sp|Q9NS23|RASF1_HUMAN3.383e-2130.00Ras association domain-containing protein 1 OS=Hom... [more]
sp|Q5EBH1|RASF5_MOUSE5.739e-2033.16Ras association domain-containing protein 5 OS=Mus... [more]
sp|Q8WWW0|RASF5_HUMAN2.043e-1933.16Ras association domain-containing protein 5 OS=Hom... [more]
sp|O35141|RASF5_RAT5.787e-1932.63Ras association domain-containing protein 5 OS=Rat... [more]
back to top
BLAST of Ras association domain-containing protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W6V2171.014e-3832.48Ras association domain-containing protein OS=Echin... [more]
A0A068WCQ81.066e-3832.48Rassf1 OS=Echinococcus granulosus OX=6210 GN=EgrG_... [more]
A0A504YL935.266e-3835.56Rassf1 OS=Fasciola gigantica OX=46835 GN=FGIG_0268... [more]
A0A0R3WAX23.271e-3731.40Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A5J4NRQ91.091e-3634.77Uncharacterized protein (Fragment) OS=Paragonimus ... [more]
back to top
BLAST of Ras association domain-containing protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RASSF16.077e-2533.50Ras association domain family member 1 [Source:NCB... [more]
RASSF13.916e-2433.50Ras association domain family member 1 [Source:NCB... [more]
rassf12.681e-2135.17ras association domain-containing protein 1-like [... [more]
rassf11.991e-2035.17ras association domain-containing protein 1-like [... [more]
si:dkey-85p17.34.217e-2032.47Ras association domain family member 5 [Source:NCB... [more]
back to top
BLAST of Ras association domain-containing protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rassf31.457e-2331.73Ras association domain family member 3 [Source:ZFI... [more]
rassf4a6.740e-927.61Ras association domain family member 4a [Source:ZF... [more]
ENSPMAT00000010718.19.967e-828.10pep scaffold:Pmarinus_7.0:GL483921:10179:11239:1 g... [more]
back to top
BLAST of Ras association domain-containing protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ras association domain-containing protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO417315.488e-2533.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ras association domain-containing protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rassf11.691e-2229.91ras association domain-containing protein 1 [Sourc... [more]
RASSF11.650e-2031.41Ras association domain family member 1 [Source:NCB... [more]
RASSF19.134e-2032.26Ras association domain family member 1 [Source:NCB... [more]
rassf31.576e-1836.88Ras association domain family member 3 [Source:NCB... [more]
rassf33.947e-1835.62Ras association domain family member 3 [Source:NCB... [more]
back to top
BLAST of Ras association domain-containing protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029652.10.000e+0100.00SMESG000029652.1[more]
SMESG000029652.10.000e+0100.00SMESG000029652.1[more]
SMESG000021885.11.238e-4143.19SMESG000021885.1[more]
SMESG000021885.12.504e-4143.19SMESG000021885.1[more]
SMESG000061902.14.980e-2230.43SMESG000061902.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013975 ID=SMED30013975|Name=Ras association domain-containing protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1791bp
TATAAATCTTATATGATATATATATTTTATGAGTAATTTATCGCCAAATG
ACCATTCAAAAGAAAAAAAGAGGTCATTTTTTGGAAGACTTTTTAATTTT
GCTAGTCATTCAATGAAGTCCAATAAAAAATCAATAATTAGCAAAAAAAA
GTTTAAAAAGTCTAATGATATTAATCTTATTTCGAAAACAGATAACGATG
AAATTGAAACATGCACATTTTGTGATTATTGTGATAAGGAAATTGTAGCC
AAATTTACAGGACAAAACTTTATTTGCCACAGAGCCTGCAGGAACGACAA
TATAACCGCTTTGGATAATTCAGTCGCTCCTAATGGACTAACTTCGACTG
ATTTTGCATCGTCACGTTCGCTGGAGAGTGAATTAGCAAACGGTTGTGGC
GGCGGCGTTGGTTCTACTTTGTCATGCAGCTTGGGCGACCTCTCAATCCC
ATATGCCGATGACGACACCACCCTTGCAGCCGATGGCAGCACCGCCGCCG
GCACCTATCGCTGCAATAGAAATACCAGGACCAATTCTACAATGAAGGCC
AATTTAATCTTGACTTCCAACATTGATACGTACACGTTTAGCACCGTAGA
CCTATCGACTATCAGGCAGTATGGAATCTCCATTAAAAAGCTGCCTTCCA
TCCGCATTAAAACCCACCAGATCAAAGCCGCCGCCGCCATCGCCACCGCC
ACCGCCACCAGCACGAGTATCAAGGAGAAAGCGGCAATATCTGCCGTGCC
AAACGACCCGTATGACTCACTAGAATTGCCCAGGGATTTGACAGATCTCA
TAAGGGTTTTTAATGACAATGATCAAGGCCTGTTTATTGAGGAAGCAAAT
GCTCTCATTATGGGCAAGGTGCGCGTTTATATCAATTTACTCAGACCCAT
CAAGATGTTGCTCACTGCACGGCCTCCTTCAATGCTCGATCAATATTCCC
AATCCGACAAAGACAAGATCAGCACTATACAAAGAGCTTATTACAACAAA
GAAGCAATATTCTGGTTGCCCAGGGGCACCACCAATGTGGTCTATATCAA
TGTAACAAAAACCACCACTGCTGACCTGATATCCATGCTACTAACCAAGT
TCAATATCCAGAACAATCCGAAGAAATTTGCACTTTATGAGCACACAATT
ACGTCACCGACTGAAGTGCAAGTGCGCAAGCTGGCACCGGAACAATTCCC
ATCTCAAATCATGCTCAAATGGTGCCTGAATGGTAAAGAAGAATATCAGA
TCAATTTGAAAAAAAAGAGATTTGTTTTACAAGAAAATGATCCCGGTTCA
GTCGAATGGGATGAATTCTGCGTTCCGGAATTGAAATCTTTCCTCAAGAT
TTTAATCCAGGAGGAGCAAGAGAAAAGAACTCAGATTATCCGCCGTTACG
AAGTAATGAAGAAAGAATTAGAAAGATGCATGTCCAAATTAGCAGCCGTT
CGTTTCTAGATATATTTGTTATTGTTACATATTGAGATGCGCTATTTTTT
TATGAATGCCAATTGTTGACTTTTTGTCCCGACCGAATAGTCCAGCTCAA
ATCCTCCAGGTTGTCAAATATTGCTATATTGCCAGTGCCTTAATAATATT
TATTATTATTATCATTATTATCATCATTATTATTATTATTACGTGATTGC
TCTTGCTAATCTATCTCAATCTTTATCAAAATCCGCTCAAATCATTCATT
TGTTATTGTTGAATTACTTCTTCATTTCAGCTTTAATTTATTGACAATAT
GATTTTATTATTATTATTATTATCCCAGATTTAAATTCCCA
back to top

protein sequence of SMED30013975-orf-1

>SMED30013975-orf-1 ID=SMED30013975-orf-1|Name=SMED30013975-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=477bp
MSNLSPNDHSKEKKRSFFGRLFNFASHSMKSNKKSIISKKKFKKSNDINL
ISKTDNDEIETCTFCDYCDKEIVAKFTGQNFICHRACRNDNITALDNSVA
PNGLTSTDFASSRSLESELANGCGGGVGSTLSCSLGDLSIPYADDDTTLA
ADGSTAAGTYRCNRNTRTNSTMKANLILTSNIDTYTFSTVDLSTIRQYGI
SIKKLPSIRIKTHQIKAAAAIATATATSTSIKEKAAISAVPNDPYDSLEL
PRDLTDLIRVFNDNDQGLFIEEANALIMGKVRVYINLLRPIKMLLTARPP
SMLDQYSQSDKDKISTIQRAYYNKEAIFWLPRGTTNVVYINVTKTTTADL
ISMLLTKFNIQNNPKKFALYEHTITSPTEVQVRKLAPEQFPSQIMLKWCL
NGKEEYQINLKKKRFVLQENDPGSVEWDEFCVPELKSFLKILIQEEQEKR
TQIIRRYEVMKKELERCMSKLAAVRF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR033614C-RASSF
IPR011524SARAH_dom
IPR000159RA_dom
IPR029071Ubiquitin-like_domsf
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0035556intracellular signal transduction
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 447..467
NoneNo IPR availableGENE3DG3DSA:1.20.5.110coord: 426..477
e-value: 1.4E-14
score: 55.6
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 250..424
e-value: 2.1E-27
score: 97.9
NoneNo IPR availablePANTHERPTHR22738:SF10RASSF (RAS-ASSOCIATION DOMAIN FAMILY) HOMOLOGcoord: 30..470
NoneNo IPR availableCDDcd01778RA_RASSF1_likecoord: 283..424
e-value: 5.15795E-31
score: 114.308
IPR000159Ras-associating (RA) domainPFAMPF00788RAcoord: 340..425
e-value: 5.1E-10
score: 39.9
IPR000159Ras-associating (RA) domainPROSITEPS50200RAcoord: 315..419
score: 11.16
IPR011524SARAH domainPFAMPF16517Nore1-SARAHcoord: 434..472
e-value: 1.6E-10
score: 40.7
IPR011524SARAH domainPROSITEPS50951SARAHcoord: 428..475
score: 11.778
IPR033614C-terminal RASSF familyPANTHERPTHR22738RASSFcoord: 30..470
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 346..417