Innexin

Overview
NameInnexin
Smed IDSMED30013974
Length (bp)1474
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Innexin (SMED30013974) t-SNE clustered cells

Violin plots show distribution of expression levels for Innexin (SMED30013974) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Innexin (SMED30013974) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Innexin (SMED30013974) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013974

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30013974SMESG000053556.1 SMESG000050555.1 SMESG000011795.1 Contig5415newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013974SMESG000053556.1 SMESG000050555.1 SMESG000011795.1 Contig5415uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013974SMESG000078146.1 Contig5415newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013974SMESG000078146.1 Contig5415uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
head regionSMED30013974 SmedASXL_013469SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30013974 SmedASXL_072238SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30013974 dd_Smed_v6_16023_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30013974 dd_Smed_v6_21227_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30013974 OX_Smed_1.0.19092ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 275.404 bits (703), Expect = 3.502e-88
Identity = 140/387 (36.18%), Postives = 233/387 (60.21%), Query Frame = 2
Query:  206 IFKLGRLFKTPYGGEGVDFIDQLNYQFTSGLMIIFIAIISVRQYVGKPIQCWVPQEFTRSWEEYAENFCWISNTYFLLPNEQIPTEDIDRLKKRYICYYQWVAIVLAGQALLSWVPHVFWRVCSH-----RLPLLLKSAKEAAIPDRELRLKAVSCLVATLEEQYEAYSRFIRKRSFIHRCACGIAPNLRLTVLFIGVRCLFLANSVGQIYLMKRFVGANSTLFGLDLISDLLSDKEWQITGHFPRVTFCTIKVRKMGQQQPASYTLQCVLPINHFVEKIYIFLWFWFLILASLTFLSTLQWIVNTLIPMRRVQYIKQYLKALKMVSSTEERDCARFVNINLGPDGVFILQLVSKIASDLIALDVTATLWKNF----RQAKITGTEE 1339
            ++ L  +FK  +     DF+D+LNY +TS ++  F  I+S +QYVG PIQCWVP +FT +WE+Y EN+CW+ NTY+L      P E  DR + R I YYQWV  VLA +AL  ++P + WR   H      +  L + A +A + D + R   V  +   +E+  E   R +   S +  C      N  +T+L++ ++ L+L N V Q++++  F+G ++  +G  ++ DLL+ +EW+++G+FPRVT C  +VR +G      +T+QCVL IN F EKI++FLWFW+ ++A ++ +S   WI+ + +P + +++I++YL+A  +  +T+ +   +FV+  LG DGVF ++++S  A D++A ++   LW NF    R+ +   TE 
Sbjct:    3 LYYLAAIFKGLHPRVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDR-RARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEI-QREVTDVSGM--CVQKRWANY-VTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVH--HHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDL--ATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFNDRVRKIQFNSTES 380          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 275.404 bits (703), Expect = 3.502e-88
Identity = 140/387 (36.18%), Postives = 233/387 (60.21%), Query Frame = 2
Query:  206 IFKLGRLFKTPYGGEGVDFIDQLNYQFTSGLMIIFIAIISVRQYVGKPIQCWVPQEFTRSWEEYAENFCWISNTYFLLPNEQIPTEDIDRLKKRYICYYQWVAIVLAGQALLSWVPHVFWRVCSH-----RLPLLLKSAKEAAIPDRELRLKAVSCLVATLEEQYEAYSRFIRKRSFIHRCACGIAPNLRLTVLFIGVRCLFLANSVGQIYLMKRFVGANSTLFGLDLISDLLSDKEWQITGHFPRVTFCTIKVRKMGQQQPASYTLQCVLPINHFVEKIYIFLWFWFLILASLTFLSTLQWIVNTLIPMRRVQYIKQYLKALKMVSSTEERDCARFVNINLGPDGVFILQLVSKIASDLIALDVTATLWKNF----RQAKITGTEE 1339
            ++ L  +FK  +     DF+D+LNY +TS ++  F  I+S +QYVG PIQCWVP +FT +WE+Y EN+CW+ NTY+L      P E  DR + R I YYQWV  VLA +AL  ++P + WR   H      +  L + A +A + D + R   V  +   +E+  E   R +   S +  C      N  +T+L++ ++ L+L N V Q++++  F+G ++  +G  ++ DLL+ +EW+++G+FPRVT C  +VR +G      +T+QCVL IN F EKI++FLWFW+ ++A ++ +S   WI+ + +P + +++I++YL+A  +  +T+ +   +FV+  LG DGVF ++++S  A D++A ++   LW NF    R+ +   TE 
Sbjct:    3 LYYLAAIFKGLHPRVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDR-RARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEI-QREVTDVSGM--CVQKRWANY-VTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVH--HHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDL--ATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFNDRVRKIQFNSTES 380          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 273.863 bits (699), Expect = 6.244e-87
Identity = 137/375 (36.53%), Postives = 228/375 (60.80%), Query Frame = 2
Query:  206 IFKLGRLFKTPYGGEGVDFIDQLNYQFTSGLMIIFIAIISVRQYVGKPIQCWVPQEFTRSWEEYAENFCWISNTYFLLPNEQIPTEDIDRLKKRYICYYQWVAIVLAGQALLSWVPHVFWRVCSH-----RLPLLLKSAKEAAIPDRELRLKAVSCLVATLEEQYEAYSRFIRKRSFIHRCACGIAPNLRLTVLFIGVRCLFLANSVGQIYLMKRFVGANSTLFGLDLISDLLSDKEWQITGHFPRVTFCTIKVRKMGQQQPASYTLQCVLPINHFVEKIYIFLWFWFLILASLTFLSTLQWIVNTLIPMRRVQYIKQYLKALKMVSSTEERDCARFVNINLGPDGVFILQLVSKIASDLIALDVTATLWKNFRQ 1315
            ++ L  +FK  +     DF+D+LNY +TS ++  F  I+S +QYVG PIQCWVP +FT +WE+Y EN+CW+ NTY+L      P E  DR + R I YYQWV  VLA +AL  ++P + WR   H      +  L + A +A + D + R   V  +   +E+  E   R +   S +  C      N  +T+L++ ++ L+L N V Q++++  F+G ++  +G  ++ DLL+ +EW+++G+FPRVT C  +VR +G      +T+QCVL IN F EKI++FLWFW+ ++A ++ +S   WI+ + +P + +++I++YL+A  +  +T+ +   +FV+  LG DGVF ++++S  A D++A ++   LW NF  
Sbjct:    3 LYYLAAIFKGLHPRVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDR-RARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEI-QREVTDVSGM--CVQKRWANY-VTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVH--HHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDL--ATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFND 368          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-9 (Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O01393])

HSP 1 Score: 270.011 bits (689), Expect = 5.905e-86
Identity = 139/369 (37.67%), Postives = 221/369 (59.89%), Query Frame = 2
Query:  257 DFIDQLNYQFTSGLMIIFIAIISVRQYVGKPIQCWVPQEFTRSWEEYAENFCWISNTYFLLPNEQIPTEDIDRLKKRYICYYQWVAIVLAGQALLSWVPHVFWRVCSHRLPL----LLKSAKEAAIPDRELRLKAVSCLVATLEEQYEAYSRFI--RKRSFIHRCACGIAPNLRLTVLFIGVRCLFLANSVGQIYLMKRFVGANSTLFGLDLISDLLSDKEWQITGHFPRVTFCTIKVRKMGQQQPASYTLQCVLPINHFVEKIYIFLWFWFLILASLTFLSTLQWIVNTLIPMRRVQYIKQYLKALKMVSSTEERDCARFVNINLGPDGVFILQLVSKIASDLIALDVTATLWKNFRQAKITGTEEDV 1345
            D ID+LNY +T+ ++ +F  ++S +QYVG PIQCWVP  FT   E+Y EN+CW+ NTYFL  ++ IP    +R + R I YYQWV  VLA +ALL +VP + WR+ S +  +    L++ A ++ + D E R +A+  +   +EE      + +   +   ++   C  +    +T L+I V+ L+  N VGQI+L+  F+G  S  +GL +++DL++ +EW+ +GHFPRVT C  +V+ +G      +T+QCVL IN F EKI++FLWFW+ +LA  T  S   WI  +++P R++ ++ +YL  ++     + +   RFV   L  DGVF+L++V+  A +L   ++  TLW N+   K  G   DV
Sbjct:   22 DIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTEPMEQYTENYCWVQNTYFLPLHDYIPHNYAER-ENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLGNVH--RHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNYCDNK-EGKMHDV 386          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-13 (Innexin [Source:UniProtKB/TrEMBL;Acc:O44887])

HSP 1 Score: 264.233 bits (674), Expect = 1.009e-83
Identity = 142/379 (37.47%), Postives = 214/379 (56.46%), Query Frame = 2
Query:  206 IFKLGRLFKTPYGGEGVDFIDQLNYQFTSGLMIIFIAIISVRQYVGKPIQCWVPQEFTRSWEEYAENFCWISNTYFLLPNEQIPTEDIDRLKKRYICYYQWVAIVLAGQALLSWVPHVFWRVCSHRLPLLLK----SAKEAAIPDRELRLKAVSCLVATLEEQYEAYSRFIRKRSFIHRCACGIAPNLRLTVLFIGVRCLFLANSVGQIYLMKRFVGANSTLFGLDLISDLLSDKEWQITGHFPRVTFCTIKVRKMGQQQPASYTLQCVLPINHFVEKIYIFLWFWFLILASLTFLSTLQWIVNTLIPMRRVQYIKQYLKALKMVSSTEERDCA---RFVNINLGPDGVFILQLVSKIASDLIALDVTATLWKNFRQAK 1321
            +F L    K  +     D ID+LNY +T  L++IF   +S +QYVG+PIQCW+P +FT +WE+Y+EN+C++ NTYF+ P++ IP  +IDR +   I YYQWV  +L  QA+L ++P +FWR+ +    + LK     AK+A   D + R +A     A L E     SRF +  S              LT L++ V+ L+L   V Q  ++  F+G + T +GL ++SD+L+ +EW+ +GHFPRVT C  +VR +G +    +T+QCVL IN F EK+Y+FLWFW +I+   TFL+ + W    +    R  +IK YL+     S    R+     +FV+  L  DGVFI  L+      + + DV   +W  F Q +
Sbjct:    1 MFFLDAFLKGLHKQGDDDSIDRLNYYWTPMLLVIFALTLSAKQYVGQPIQCWIPAQFTGAWEQYSENYCFVQNTYFISPDKYIPDSEIDR-EGAEIGYYQWVPFILGLQAILFYLPSLFWRLMNFNSGVALKKMLFGAKKADRVDEKARNEAAKSTGAHLYESLTLQSRFAKYTSAFTYGGS------YLTYLYLFVKFLYLVQIVFQFIILNNFLGTSYTFWGLGILSDILNGREWEESGHFPRVTMCDFEVRVLGNKH--RHTVQCVLMINMFNEKVYVFLWFWLVIVGVATFLNLVNWTRKLMFRSARKAHIKSYLQIEDNFSDDNSRNGQILDKFVDYKLKSDGVFITHLIDNNGGSVFSHDVIVDMWDRFLQDE 370          
BLAST of Innexin vs. Ensembl Fly
Match: shakB (gene:FBgn0085387 transcript:FBtr0112571)

HSP 1 Score: 99.7525 bits (247), Expect = 1.547e-22
Identity = 79/275 (28.73%), Postives = 120/275 (43.64%), Query Frame = 2
Query:  269 QLNYQFTSGLMIIFIAIISVRQYVGKPIQCWVPQEFTRSWEEYAENFCWISNTYFL-----------LPNEQIPTEDIDRLKKRYICYYQWVAIVLAGQALLSWVPHVFWRVCSHRLPLLLKSAKEAAIPDRELRLKAVSCLVATLEEQYEAYSRFIRKRSFIHRCACGIAPNLRLTVLFIGVRCLFLANSVGQIYLMKRFVGANSTLFGLDLISDLLSDKEWQITGH---FPRVTFCTIKVRKMGQQQPASYTLQCVLPINHFVEKIYIFLWFW 1051
            +L+Y  T  +++ F  II+ RQYVG PI C   ++     E+    +CWI +TY L           +P   I   D D   K++  YYQWV   L  QA+L + P   W           KS +   I    + L    C  A  +++ +    ++ +    H               +     L L N +GQ++LM RF       FGL +I  + +D+E ++      FPR+T CT   +     +   +   C+LP+N   EKIYIFLWFW
Sbjct:   25 RLHYSITVMILMSFSLIITTRQYVGNPIDCVHTKDIP---EDVLNTYCWIQSTYTLKSLFLKKQGVSVPYPGIGNSDGDPADKKHYKYYQWVCFCLFFQAILFYTPRWLW-----------KSWEGGKIHALIMDLDIGICSEAEKKQKKKLLLDYLWENLRYHNW---------WAYRYYVCELLALINVIGQMFLMNRFFDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTF-FKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFW 275          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0301860)

HSP 1 Score: 95.1301 bits (235), Expect = 4.668e-21
Identity = 87/323 (26.93%), Postives = 139/323 (43.03%), Query Frame = 2
Query:  269 QLNYQFTSGLMIIFIAIISVRQYVGKPIQCWVPQEFTRSWEEYAENFCWISNTY-------------FLLPNEQIPTEDIDRLKKRYICYYQWVAIVLAGQALLSWVPHVFWRVC-SHRLPLLLKSAKEAAIPDRELRLKAVSCLVATLEEQYEAYSRFIRKRSFIHRCACGIAPNLRLTVLFIGVRCLFLANSVGQIYLMKRFVGANSTLFGLDLI--SDLLSDKEWQITGH-FPRVTFCTI-KVRKMGQQQPASYTLQCVLPINHFVEKIYIFLWFWFLILASLTFLSTLQWIVNTLIPMRRVQYIKQYLKALKMVSSTEE 1183
            +++Y+ T  ++I F  +++ RQY+G PI C V +      + Y    CWI +T+              + P      E  D +K  Y  YYQWV  VL  QA+L +VP   W+     RL +L+       + D                       +  RK+  +      +  +      F     L   N +GQIY +  F+    + +G D++  ++L  D+        FP+VT CT  K    G  Q  ++   CVLP+N   EKIY+FLWFWF+IL+ ++ +S +  I     P  R       L+A   ++ +EE
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGVMDTY----CWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVK--YHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIVNDE---------------------CKNDRKKILVDYFIGNLNRHNFYAFRFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQ--THDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLR----HLLLRARSRLAESEE 314          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071005)

HSP 1 Score: 95.1301 bits (235), Expect = 4.668e-21
Identity = 87/323 (26.93%), Postives = 139/323 (43.03%), Query Frame = 2
Query:  269 QLNYQFTSGLMIIFIAIISVRQYVGKPIQCWVPQEFTRSWEEYAENFCWISNTY-------------FLLPNEQIPTEDIDRLKKRYICYYQWVAIVLAGQALLSWVPHVFWRVC-SHRLPLLLKSAKEAAIPDRELRLKAVSCLVATLEEQYEAYSRFIRKRSFIHRCACGIAPNLRLTVLFIGVRCLFLANSVGQIYLMKRFVGANSTLFGLDLI--SDLLSDKEWQITGH-FPRVTFCTI-KVRKMGQQQPASYTLQCVLPINHFVEKIYIFLWFWFLILASLTFLSTLQWIVNTLIPMRRVQYIKQYLKALKMVSSTEE 1183
            +++Y+ T  ++I F  +++ RQY+G PI C V +      + Y    CWI +T+              + P      E  D +K  Y  YYQWV  VL  QA+L +VP   W+     RL +L+       + D                       +  RK+  +      +  +      F     L   N +GQIY +  F+    + +G D++  ++L  D+        FP+VT CT  K    G  Q  ++   CVLP+N   EKIY+FLWFWF+IL+ ++ +S +  I     P  R       L+A   ++ +EE
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGVMDTY----CWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVK--YHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIVNDE---------------------CKNDRKKILVDYFIGNLNRHNFYAFRFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQ--THDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLR----HLLLRARSRLAESEE 314          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0332314)

HSP 1 Score: 95.1301 bits (235), Expect = 4.668e-21
Identity = 87/323 (26.93%), Postives = 139/323 (43.03%), Query Frame = 2
Query:  269 QLNYQFTSGLMIIFIAIISVRQYVGKPIQCWVPQEFTRSWEEYAENFCWISNTY-------------FLLPNEQIPTEDIDRLKKRYICYYQWVAIVLAGQALLSWVPHVFWRVC-SHRLPLLLKSAKEAAIPDRELRLKAVSCLVATLEEQYEAYSRFIRKRSFIHRCACGIAPNLRLTVLFIGVRCLFLANSVGQIYLMKRFVGANSTLFGLDLI--SDLLSDKEWQITGH-FPRVTFCTI-KVRKMGQQQPASYTLQCVLPINHFVEKIYIFLWFWFLILASLTFLSTLQWIVNTLIPMRRVQYIKQYLKALKMVSSTEE 1183
            +++Y+ T  ++I F  +++ RQY+G PI C V +      + Y    CWI +T+              + P      E  D +K  Y  YYQWV  VL  QA+L +VP   W+     RL +L+       + D                       +  RK+  +      +  +      F     L   N +GQIY +  F+    + +G D++  ++L  D+        FP+VT CT  K    G  Q  ++   CVLP+N   EKIY+FLWFWF+IL+ ++ +S +  I     P  R       L+A   ++ +EE
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGVMDTY----CWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVK--YHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIVNDE---------------------CKNDRKKILVDYFIGNLNRHNFYAFRFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQ--THDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLR----HLLLRARSRLAESEE 314          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071006)

HSP 1 Score: 95.1301 bits (235), Expect = 4.668e-21
Identity = 87/323 (26.93%), Postives = 139/323 (43.03%), Query Frame = 2
Query:  269 QLNYQFTSGLMIIFIAIISVRQYVGKPIQCWVPQEFTRSWEEYAENFCWISNTY-------------FLLPNEQIPTEDIDRLKKRYICYYQWVAIVLAGQALLSWVPHVFWRVC-SHRLPLLLKSAKEAAIPDRELRLKAVSCLVATLEEQYEAYSRFIRKRSFIHRCACGIAPNLRLTVLFIGVRCLFLANSVGQIYLMKRFVGANSTLFGLDLI--SDLLSDKEWQITGH-FPRVTFCTI-KVRKMGQQQPASYTLQCVLPINHFVEKIYIFLWFWFLILASLTFLSTLQWIVNTLIPMRRVQYIKQYLKALKMVSSTEE 1183
            +++Y+ T  ++I F  +++ RQY+G PI C V +      + Y    CWI +T+              + P      E  D +K  Y  YYQWV  VL  QA+L +VP   W+     RL +L+       + D                       +  RK+  +      +  +      F     L   N +GQIY +  F+    + +G D++  ++L  D+        FP+VT CT  K    G  Q  ++   CVLP+N   EKIY+FLWFWF+IL+ ++ +S +  I     P  R       L+A   ++ +EE
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGVMDTY----CWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVK--YHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIVNDE---------------------CKNDRKKILVDYFIGNLNRHNFYAFRFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQ--THDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLR----HLLLRARSRLAESEE 314          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|O01393|UNC9_CAEEL (Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN=unc-9 PE=1 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 7.511e-85
Identity = 139/369 (37.67%), Postives = 221/369 (59.89%), Query Frame = 2
Query:  257 DFIDQLNYQFTSGLMIIFIAIISVRQYVGKPIQCWVPQEFTRSWEEYAENFCWISNTYFLLPNEQIPTEDIDRLKKRYICYYQWVAIVLAGQALLSWVPHVFWRVCSHRLPL----LLKSAKEAAIPDRELRLKAVSCLVATLEEQYEAYSRFI--RKRSFIHRCACGIAPNLRLTVLFIGVRCLFLANSVGQIYLMKRFVGANSTLFGLDLISDLLSDKEWQITGHFPRVTFCTIKVRKMGQQQPASYTLQCVLPINHFVEKIYIFLWFWFLILASLTFLSTLQWIVNTLIPMRRVQYIKQYLKALKMVSSTEERDCARFVNINLGPDGVFILQLVSKIASDLIALDVTATLWKNFRQAKITGTEEDV 1345
            D ID+LNY +T+ ++ +F  ++S +QYVG PIQCWVP  FT   E+Y EN+CW+ NTYFL  ++ IP    +R + R I YYQWV  VLA +ALL +VP + WR+ S +  +    L++ A ++ + D E R +A+  +   +EE      + +   +   ++   C  +    +T L+I V+ L+  N VGQI+L+  F+G  S  +GL +++DL++ +EW+ +GHFPRVT C  +V+ +G      +T+QCVL IN F EKI++FLWFW+ +LA  T  S   WI  +++P R++ ++ +YL  ++     + +   RFV   L  DGVF+L++V+  A +L   ++  TLW N+   K  G   DV
Sbjct:   22 DIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTEPMEQYTENYCWVQNTYFLPLHDYIPHNYAER-ENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLGNVH--RHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNYCDNK-EGKMHDV 386          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q03412|UNC7_CAEEL (Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN=unc-7 PE=1 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 5.363e-77
Identity = 136/393 (34.61%), Postives = 225/393 (57.25%), Query Frame = 2
Query:  206 IFKLGRLFKTPYGGEGVDFIDQLNYQFTSGLMIIFIAIISVRQYVGKPIQCWVPQEFTRSWEEYAENFCWISNTYFLLPNEQIPTEDIDRLKKRYICYYQWVAIVLAGQALLSWVPHVFWRVCSH-----RLPLLLKSAKEAAIPDRELRLKAVSCLVATLEEQYEAYSRFIRKRSFIHRC--------ACGIAPNLRLTVLFIGVRCLFLANSVGQIYLMKRFVGANSTLFGLDLISDLLSDKEWQITGHFPRVTFCTIKVRKMGQQQPASYTLQCVLPINHFVEKIYIFLWFWFLILASLTFLSTLQWIVNTLIPMRRVQYIKQYLKALKMVSS---TEERDCARFVNINLGPDGVFILQLVSKIASDLIALDVTATLWKNFRQAKITGTE 1336
            ++ L   F+  Y     DF+D+LNY +T+ ++  F  ++S +QYVG PIQCWVP  FT + E+Y EN+CW+ NTY++   E IP E   R + R I YYQWV  +LA +ALL +VP + WR   +      L  L++ A +A + D E++ + V  +   ++++ +  +  I ++     C         CG      +T+L+IG++ L+ AN + Q +L+   +G+N   +G  L+ DL+   EW+ TG FPRVT C  +VR +G      +T+QCVL IN F EKI++FLWFWFL    +T  +T+ WI+   IP + + ++++YL+ L    +    ++    +F N  L  DGVF+L+++S  A +L++ ++   LW++F     + T+
Sbjct:  123 LYYLASAFRALYPRLDDDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDAMEQYTENYCWVQNTYWVPMQEDIPREIYSR-RNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTN--IDRQGHSRSCFSNLQLGANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDFEVRVLGNIH--RHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQDFNNVDRSPTQ 510          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q19746|INX3_CAEEL (Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx-3 PE=1 SV=2)

HSP 1 Score: 225.713 bits (574), Expect = 1.921e-67
Identity = 125/353 (35.41%), Postives = 194/353 (54.96%), Query Frame = 2
Query:  257 DFIDQLNYQFTSGLMIIFIAIISVRQYVGKPIQCWVPQEFTRSWEEYAENFCWISNTYFLLPNEQIPTEDIDRLKKRYICYYQWVAIVLAGQALLSWVPHVFW----RVCSHRLPLLLKSAKEAAIPDRELRLKAVSCLVATLEEQYEAYSRFIRKRSFIHRCACGIAPNLRLTVLFIGVRCLFLANSVGQIYLMKRFVGANSTLFGLDLISDLLSDKEWQITGHFPRVTFCTIKVRKMGQQQPASYTLQCVLPINHFVEKIYIFLWFWFLILASLTFLSTLQWIVNTLIPMRRVQYIKQYLKALKMVSSTEERDCARFVNINLGPDGVFILQLVSKIASDLIALDVTATLWK 1303
            D +D+L+Y  T+ L+  F  ++S +QYVG  IQCW+P EF   WE+YAE++C+I NT+F+    +IP +  DR +K  I YYQWV IVLA QA + ++P   W    + C    P ++  A+     D E R K V+ LV  + +  +  S+    R + +R   G+      ++L+I ++ ++LAN   Q  ++ +F+G  + L+G    +DL + +EWQ +G FPRVT C   VRK+       YT+QCVL IN F EKIY+F+WFWF+ +   TF++TL  I        R  YI+  L         E+   A F N  L  DGV +++ +   A  ++  ++   L+K
Sbjct:   22 DAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKGGWEQYAEDYCFIQNTFFIPERSEIPGDVEDR-QKAEIGYYQWVPIVLAIQAFMFYLPSWIWSSLYKQCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGDILDTRSKNEYGRFYCYRFGKGLGS--MTSMLYICIKLMYLANVFVQFIILNKFLGNETFLWGFHTFADLYAGREWQDSGVFPRVTLCDFSVRKLANVH--RYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSGPVNNFKDEKAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICEELFK 369          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q23157|INX11_CAEEL (Innexin-11 OS=Caenorhabditis elegans OX=6239 GN=inx-11 PE=3 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 7.508e-61
Identity = 125/378 (33.07%), Postives = 203/378 (53.70%), Query Frame = 2
Query:  248 EGVDFIDQLNYQFTSGLMIIFIAIISVRQYVGKPIQCWVPQEFTRSWEEYAENFCWISNTYFLLPNEQIPTEDIDRLKK-------RYICYYQWVAIVLAGQALLSWVPHVFWRVCSH----RLPLLLKSAKEAAIPDRELRLKAVSCLVATLEEQYEAYSRFIRKRSFIHRCACGIAPNLRLTVLFIG-----VRCLFLANSVGQIYLMKRFVGAN-STLFGLDLISDLLSDKEWQITGHFPRVTFCTIKVRKMGQQQPASYTLQCVLPINHFVEKIYIFLWFWFLILASLTFLSTLQWIVNTLIPMRRVQYIKQYLKALKMV-------SSTEERDCARFVNINLGPDGVFILQLVSKIASDLIALDVTATLWKNF 1309
            E  D+ D+LNY  T  +++ F  +IS +Q+ G+PI+C  P +F  SWE+YAEN+CW  +TYF+      PT+D+  LKK       R + YYQWV   L  QA     P   W+  S+    R+  +++ AK++A  + E+R K +  L   L       +   RK+  +H+    +  N + +  FI       + L+  N   Q+YLM  F+G N    +G  ++ D++  + W+ +G+FPR   C  +VR++   Q   Y++QCVL IN F EKI++ LWFW++IL   + +S +QW +  + P     ++KQ+L AL  +       S  E+ D ++FV   L  DGVF+L++VS  A  + A D+   L++ +
Sbjct:   18 EDDDWSDRLNYLMTPNILLAFSVLISFKQFGGRPIECMFPNKFPGSWEQYAENYCWSQDTYFVE-----PTQDVSLLKKEERYTPDRQLSYYQWVPFFLLLQAAFFRAPSYLWKYFSNHSGIRIHEVVEKAKDSANVEEEVREKNILILKRHLSSALRFQANMERKKVQVHKTVTFL--NFQYSSGFISWIYLFTKVLYFLNVFAQLYLMNYFLGTNRHHWYGFGVVQDIVQGEPWERSGYFPRAAVCDFEVRQVANIQ--RYSVQCVLVINIFNEKIFVLLWFWYVILLLSSTVSLVQWFIVLVFPCFSKWFVKQHL-ALSTLQNFNQRNSRREDSDVSKFVTQYLHKDGVFVLRMVSSHAGIIFATDLVQALYEAY 385          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|A8WVX4|INX19_CAEBR (Innexin-19 OS=Caenorhabditis briggsae OX=6238 GN=inx-19 PE=3 SV=3)

HSP 1 Score: 204.527 bits (519), Expect = 3.753e-59
Identity = 129/410 (31.46%), Postives = 214/410 (52.20%), Query Frame = 2
Query:  215 LGRLFKTPYGGEGVD-FIDQLNYQFTSGLMIIFIAIISVRQYVGKPIQCWVPQEFTRSWEEYAENFCWISNTYFLLPNEQIPTEDIDRLKKRYICYYQWVAIVLAGQALLSWVPHVFWRVCSHRLPLLLKSAKEAAI--------PDRELRLKAVSC-LVATLEEQYEAYSRFIRKRSFIHRCACG-IAPNLRLTVLFIGVRCLFLANSVGQIYLMKRFVGANS-TLFGLDLISDLLSDKEWQITGHFPRVTFCTIKVRKMGQQQPASYTLQCVLPINHFVEKIYIFLWFWFLILASLTFLSTLQWIVNTLIPMRRVQYIKQYLKALKMVSSTE-------ERDCA----------------RFVNINLGPDGVFILQLVSKIASDLIALDVTATLWKNFRQAKITGTEE 1339
            L R F +     G D  +D+LNY +T  ++ +   +IS +QY G PI+CWV      S EEY E++CWI NTY++   E +P +   R +K+ I YYQWV  +L  +AL+  +P +FWR+CS +  L +++   AA          DR+  ++A++C  V  L+ Q  + +  IR R +I R           +++++   + L+  N V Q +++   + ++    FG  ++SD+ + + W  TGHFPRVT C  +VR +       YT+QC L IN   EK++ FLW W++ILA +T  S + WI N+ I   +V Y+   +K +++  S+E       E+D                   FV+  L  DG+ +L+++S  A D+I + +   LW+ +R+      EE
Sbjct:    7 LARSFISALSVRGDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVNPHSRESMEEYIESYCWIQNTYWIPMYENVPDDHTAREEKQ-IGYYQWVPFILIAEALMFSLPCIFWRLCSFQSGLNIQTLINAACDAQALLDYSDRQKAVEAITCNFVDNLDLQ--SPNGRIRARGWIARIKFSRFLSGQCISIVYSFTKLLYSVNVVAQFFILNACLKSSEFVFFGFQVLSDIWAGRPWTETGHFPRVTLCDFEVRYLANLN--RYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYV---MKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLDSFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLWQEYRERNWREFEE 408          
BLAST of Innexin vs. TrEMBL
Match: A0A4E0RM26 (Innexin OS=Fasciola hepatica OX=6192 GN=inx PE=3 SV=1)

HSP 1 Score: 671.774 bits (1732), Expect = 0.000e+0
Identity = 314/404 (77.72%), Postives = 357/404 (88.37%), Query Frame = 2
Query:  167 MTRGAPGIFDGGFIFKLGRLFKTPYGGEGVDFIDQLNYQFTSGLMIIFIAIISVRQYVGKPIQCWVPQEFTRSWEEYAENFCWISNTYFLLPNEQIPTEDIDRLKKRYICYYQWVAIVLAGQALLSWVPHVFWRVCSHRLPLLLKSAKEAAIPDRELRLKAVSCLVATLEEQYEAYSRFIRKRSFIHRCACGIAPNLRLTVLFIGVRCLFLANSVGQIYLMKRFVGANSTLFGLDLISDLLSDKEWQITGHFPRVTFCTIKVRKMGQQQPASYTLQCVLPINHFVEKIYIFLWFWFLILASLTFLSTLQWIVNTLIPMRRVQYIKQYLKALKMVSSTEERDCARFVNINLGPDGVFILQLVSKIASDLIALDVTATLWKNFRQAKITGTEEDVNRLLEFNNRSA 1378
            M RGA G+ DGGF+FKLGRLF+TPYGGEGVDF+DQLNYQFT GLMIIFIAIIS+RQYVGKPIQCWVPQEFT+SWEEYAEN CW+SNTYFLLPNE+IPT+ +D  K ++I YYQWV IVLAGQA+++WVPH+ WRV S RLPLLLKSA+EAAIPDRELRLKAVSCLVATLEEQ E+ SRF R +S + RC CG+ PN RLT+LF+ VR LF+ANSVGQIYLMKRF G NST+FGL L+ DL +  EW+ TGHFPRVT+CTIKVRKMGQ +PASYTLQCVLPIN+F EKIY+FLWFWF+IL  LT L+TLQW +NT++PMRRV YIKQYLKAL+++SSTEERDCARFVN  LG DGVFIL +VSKIASDLIALDVTATLWKN+RQAKITGTEEDVNRLLE  NR +
Sbjct:    1 MARGAGGLLDGGFVFKLGRLFRTPYGGEGVDFVDQLNYQFTGGLMIIFIAIISLRQYVGKPIQCWVPQEFTKSWEEYAENLCWVSNTYFLLPNEEIPTDQVDYEKVKFIGYYQWVVIVLAGQAMMAWVPHLLWRVGSRRLPLLLKSAREAAIPDRELRLKAVSCLVATLEEQAESQSRFRRIKSLLSRCLCGVTPNARLTMLFLFVRTLFVANSVGQIYLMKRFTGFNSTVFGLRLLQDLSAGVEWERTGHFPRVTYCTIKVRKMGQTKPASYTLQCVLPINNFTEKIYVFLWFWFVILGVLTTLNTLQWALNTMLPMRRVHYIKQYLKALRLISSTEERDCARFVNNTLGADGVFILHVVSKIASDLIALDVTATLWKNYRQAKITGTEEDVNRLLETVNRGS 404          
BLAST of Innexin vs. TrEMBL
Match: A0A4S2LXE0 (Innexin OS=Opisthorchis felineus OX=147828 GN=inx PE=3 SV=1)

HSP 1 Score: 671.003 bits (1730), Expect = 0.000e+0
Identity = 314/404 (77.72%), Postives = 357/404 (88.37%), Query Frame = 2
Query:  167 MTRGAPGIFDGGFIFKLGRLFKTPYGGEGVDFIDQLNYQFTSGLMIIFIAIISVRQYVGKPIQCWVPQEFTRSWEEYAENFCWISNTYFLLPNEQIPTEDIDRLKKRYICYYQWVAIVLAGQALLSWVPHVFWRVCSHRLPLLLKSAKEAAIPDRELRLKAVSCLVATLEEQYEAYSRFIRKRSFIHRCACGIAPNLRLTVLFIGVRCLFLANSVGQIYLMKRFVGANSTLFGLDLISDLLSDKEWQITGHFPRVTFCTIKVRKMGQQQPASYTLQCVLPINHFVEKIYIFLWFWFLILASLTFLSTLQWIVNTLIPMRRVQYIKQYLKALKMVSSTEERDCARFVNINLGPDGVFILQLVSKIASDLIALDVTATLWKNFRQAKITGTEEDVNRLLEFNNRSA 1378
            M RGA G+ DGGF+FKLGRLF+TPYGGEGVDFIDQLNYQ+T GLMIIFIAIIS+RQYVGKPIQCWVPQEFT+SWEEYAEN CW+SNTYFLLPNE+IPT+ +D  K ++I YYQWV IV+AGQALLSWVPH+ WRV S RLPLLLKSA+EAAIPDRELRLKAVSCLVATLEEQ E+ SRF R +S ++RC CG+ PN RLT LF+ VR LF+ANSVGQIY+MKRF G NSTLFG+ L+ DL +  EW+ TGHFPRVT+CTIKVRKMGQ +PASYTLQCVLPIN+F EKIY+FLWFWF IL  LT L+TLQW +NT++P+RRV YIKQYLKAL+++SSTEERDCARFVN  LG DGVFIL +VSKIASDLIALDVTATLW+N+RQAKITGTEEDVNRLLE  NRS+
Sbjct:    1 MARGAGGLLDGGFVFKLGRLFRTPYGGEGVDFIDQLNYQYTGGLMIIFIAIISLRQYVGKPIQCWVPQEFTKSWEEYAENLCWVSNTYFLLPNEEIPTDQVDYEKVKFIGYYQWVVIVMAGQALLSWVPHLLWRVGSRRLPLLLKSAREAAIPDRELRLKAVSCLVATLEEQAESQSRFRRIKSLLNRCLCGVTPNARLTTLFLLVRMLFVANSVGQIYMMKRFTGFNSTLFGMKLLQDLSAGVEWERTGHFPRVTYCTIKVRKMGQTKPASYTLQCVLPINNFTEKIYVFLWFWFAILGILTTLNTLQWAMNTILPVRRVNYIKQYLKALRLISSTEERDCARFVNNTLGADGVFILHVVSKIASDLIALDVTATLWRNYRQAKITGTEEDVNRLLETVNRSS 404          
BLAST of Innexin vs. TrEMBL
Match: A0A5K4F4I8 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 660.603 bits (1703), Expect = 0.000e+0
Identity = 317/404 (78.47%), Postives = 357/404 (88.37%), Query Frame = 2
Query:  167 MTRGAPGIFDGGFIFKLGRLFKTPYGGEGVDFIDQLNYQFTSGLMIIFIAIISVRQYVGKPIQCWVPQEFTRSWEEYAENFCWISNTYFLLPNEQIPTEDIDRLKKRYICYYQWVAIVLAGQALLSWVPHVFWRVCSHRLPLLLKSAKEAAIPDRELRLKAVSCLVATLEEQYEAYSRFIRKRSFIHRCACGIAPNLRLTVLFIGVRCLFLANSVGQIYLMKRFVGANSTLFGLDLISDLLSDKEWQITGHFPRVTFCTIKVRKMGQQQPASYTLQCVLPINHFVEKIYIFLWFWFLILASLTFLSTLQWIVNTLIPMRRVQYIKQYLKALKMVSSTEERDCARFVNINLGPDGVFILQLVSKIASDLIALDVTATLWKNFRQAKITGTEEDVNRLLEFNNRSA 1378
            M RGA G+ DGGF+FKLGRLFKTPYGGEGVDFIDQLNYQFT GLM+IFIAIIS RQYVGKPIQCWVPQEFT+SWEEYAEN CW+SNTYFLLPNE+IPT+ +D  K ++I YYQWVAIVLAGQA++SWVPH+ WRV S RLPLLLKSA+EAAIPDRELRLKAVSCLVATLEEQ E+ SRF R +S + RC CG+ PN RLT+LF+ VR LF+ANSVGQIYLMKRF G NST+FGL L+ DL +  EW+ TGHFPRVT+CTIKVRKMGQ +PASYTLQCVLPIN+F EKIY+FLWFWF IL  LT L+TLQW +NT++P RRV+YIKQYLKAL+++SSTEERDCARFVN NLG DGVFIL +VSKIASDLIALDVTATLWKN+RQAKITGTEEDVNRLLE  NR +
Sbjct:    1 MARGAGGLLDGGFVFKLGRLFKTPYGGEGVDFIDQLNYQFTGGLMVIFIAIISFRQYVGKPIQCWVPQEFTKSWEEYAENLCWVSNTYFLLPNEEIPTDQVDYEKVKFIGYYQWVAIVLAGQAMMSWVPHLLWRVGSRRLPLLLKSAREAAIPDRELRLKAVSCLVATLEEQAESQSRFRRIKSILTRCLCGVTPNARLTMLFLFVRALFVANSVGQIYLMKRFTGFNSTVFGLRLLQDLSAGVEWERTGHFPRVTYCTIKVRKMGQTKPASYTLQCVLPINNFTEKIYVFLWFWFAILGLLTTLNTLQWALNTILPSRRVRYIKQYLKALRLISSTEERDCARFVNNNLGADGVFILHVVSKIASDLIALDVTATLWKNYRQAKITGTEEDVNRLLETVNRGS 404          
BLAST of Innexin vs. TrEMBL
Match: A0A158QU82 (Innexin OS=Mesocestoides corti OX=53468 GN=inx PE=3 SV=1)

HSP 1 Score: 642.114 bits (1655), Expect = 0.000e+0
Identity = 307/404 (75.99%), Postives = 356/404 (88.12%), Query Frame = 2
Query:  167 MTRGAPGIFDGGFIFKLGRLFKTPYGGEGVDFIDQLNYQFTSGLMIIFIAIISVRQYVGKPIQCWVPQEFTRSWEEYAENFCWISNTYFLLPNEQIPTEDIDRLKKRYICYYQWVAIVLAGQALLSWVPHVFWRVCSHRLPLLLKSAKEAAIPDRELRLKAVSCLVATLEEQYEAYSRFIRKRSFIHRCACGIAPNLRLTVLFIGVRCLFLANSVGQIYLMKRFVGANSTLFGLDLISDLLSDKEWQITGHFPRVTFCTIKVRKMGQQQPASYTLQCVLPINHFVEKIYIFLWFWFLILASLTFLSTLQWIVNTLIPMRRVQYIKQYLKALKMVSSTEERDCARFVNINLGPDGVFILQLVSKIASDLIALDVTATLWKNFRQAKITGTEEDVNRLLEFNNRSA 1378
            M RGA G+ DGGF+FKLGRLF+TPYGGEGVDFIDQLNYQFT GL++IFI IIS+RQYVGKPIQCWVP EFTR+WEEY EN+CW+SNTYFLLP+E IP E+++  K ++I YYQW++IVLAGQA++SWVPH+ WRVCS RLPLLLKSAKEA+IPDRELRLKAVSCLVATLEEQ E+ SRF R +SF++RC CGIAPN RLTVLF+ VR LF+ANS+GQIYLMK F G NST FGL L+ DL   +EW  +GHFPRVT+C IKVR MGQ +PASY+LQCVLPIN+FVEKIYIFLWFWF+IL SLT +ST+QW +NTLIP+RRV YIKQYLKAL+++SSTEERDC RFVN +LG DG+FIL +VSK+ASDLIALDVTATLWKN+RQAKITGTEEDVNRLLE  NR +
Sbjct:    1 MARGAGGLLDGGFVFKLGRLFRTPYGGEGVDFIDQLNYQFTGGLILIFIIIISLRQYVGKPIQCWVPPEFTRAWEEYTENYCWVSNTYFLLPHEDIPVEELEYEKIKFIGYYQWMSIVLAGQAMMSWVPHLLWRVCSRRLPLLLKSAKEASIPDRELRLKAVSCLVATLEEQAESQSRFRRMKSFVNRCLCGIAPNARLTVLFLFVRGLFIANSLGQIYLMKCFTGFNSTFFGLHLLQDLTKGEEWDTSGHFPRVTYCNIKVRVMGQPKPASYSLQCVLPINNFVEKIYIFLWFWFVILCSLTIMSTIQWTINTLIPVRRVYYIKQYLKALRLISSTEERDCTRFVNQSLGADGIFILHIVSKVASDLIALDVTATLWKNYRQAKITGTEEDVNRLLETVNRGS 404          
BLAST of Innexin vs. TrEMBL
Match: A0A158QHF3 (Innexin OS=Rodentolepis nana OX=102285 GN=inx PE=3 SV=1)

HSP 1 Score: 641.343 bits (1653), Expect = 0.000e+0
Identity = 306/404 (75.74%), Postives = 355/404 (87.87%), Query Frame = 2
Query:  167 MTRGAPGIFDGGFIFKLGRLFKTPYGGEGVDFIDQLNYQFTSGLMIIFIAIISVRQYVGKPIQCWVPQEFTRSWEEYAENFCWISNTYFLLPNEQIPTEDIDRLKKRYICYYQWVAIVLAGQALLSWVPHVFWRVCSHRLPLLLKSAKEAAIPDRELRLKAVSCLVATLEEQYEAYSRFIRKRSFIHRCACGIAPNLRLTVLFIGVRCLFLANSVGQIYLMKRFVGANSTLFGLDLISDLLSDKEWQITGHFPRVTFCTIKVRKMGQQQPASYTLQCVLPINHFVEKIYIFLWFWFLILASLTFLSTLQWIVNTLIPMRRVQYIKQYLKALKMVSSTEERDCARFVNINLGPDGVFILQLVSKIASDLIALDVTATLWKNFRQAKITGTEEDVNRLLEFNNRSA 1378
            M RGA G+ DGGF+FKLGRLF+TPYGGEGVDFIDQLNYQFT GL++IFI IIS+RQYVGKPIQCWVP EFTR+WEEY EN+CW+SNTYFLLP+E IP E+++  K ++I YYQW++IVLAGQA++SWVPH+ WRVCS RLPLLLKSAKEA+IPDRELRLKAVSCLVATLEEQ E+ SRF R +SF++RC CGIAPN RLTVLF+ VR LF+AN +GQIYLMK F G NST FGL L+ DL   +EW  +GHFPRVT+C IKVR MGQ +PASY+LQCVLPIN+FVEKIYIFLWFWF+IL SLT ++TLQW +NT++P+RRV YIKQYLKAL+++SSTEERDC RFVN NLG DG+FIL +VSKIASDLIALDVTATLWKN+RQAKITGTEEDVNRLLE  NR +
Sbjct:    1 MARGAGGLLDGGFVFKLGRLFRTPYGGEGVDFIDQLNYQFTGGLILIFIIIISLRQYVGKPIQCWVPPEFTRAWEEYTENYCWVSNTYFLLPHEDIPAEELEYEKIKFIGYYQWMSIVLAGQAMMSWVPHLLWRVCSRRLPLLLKSAKEASIPDRELRLKAVSCLVATLEEQAESQSRFRRMKSFVNRCLCGIAPNARLTVLFLFVRALFIANCLGQIYLMKCFTGFNSTFFGLQLLQDLTKGEEWDTSGHFPRVTYCNIKVRVMGQPKPASYSLQCVLPINNFVEKIYIFLWFWFVILCSLTIMNTLQWTINTMLPVRRVYYIKQYLKALRLISSTEERDCTRFVNQNLGADGIFILHIVSKIASDLIALDVTATLWKNYRQAKITGTEEDVNRLLETVNRGS 404          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000068735.1 (SMESG000068735.1)

HSP 1 Score: 608.986 bits (1569), Expect = 0.000e+0
Identity = 271/397 (68.26%), Postives = 343/397 (86.40%), Query Frame = 2
Query:  188 IFDGGFIFKLGRLFKTPYGGEGVDFIDQLNYQFTSGLMIIFIAIISVRQYVGKPIQCWVPQEFTRSWEEYAENFCWISNTYFLLPNEQIPTEDIDRLKKRYICYYQWVAIVLAGQALLSWVPHVFWRVCSHRLPLLLKSAKEAAIPDRELRLKAVSCLVATLEEQYEAYSRFIRKRSFIHRCACGIAPNLRLTVLFIGVRCLFLANSVGQIYLMKRFVGANSTLFGLDLISDLLSDKEWQITGHFPRVTFCTIKVRKMGQQQPASYTLQCVLPINHFVEKIYIFLWFWFLILASLTFLSTLQWIVNTLIPMRRVQYIKQYLKALKMVSSTEERDCARFVNINLGPDGVFILQLVSKIASDLIALDVTATLWKNFRQAKITGTEEDVNRLLEFNNRSA 1378
            + + GF+FK+GRLFKTPYGGEGVDF DQLNYQFTSGL++IFI I+S+RQYVGKPIQCWVPQEFT++WEEYAEN CW+SNTYFLL +++IP +D +    +YI YYQW+ IVLAGQALLSWVPH+ WRV S RLP+LL+SA+EA +PDR+LR+KAVSC+VA+LEEQ +A  R  R +    RC  G+ PN RLTVLFI VR +F+ N+VGQIYLM++FVG+N+ +FG  L+ DLL+ ++W++TG+FPRVT+CTI VR+MGQ + ASYTLQCVLPINHF+EK+Y+FLWFWF+++A +T LSTLQW+ NTL+PM+RV Y++QYLKA+++++STEERDC+RFVN NLGPDGVF+L +VS  ASDLI+LDVTATLWKNFRQAKITGTEED++RLLE  NR+ 
Sbjct:   11 LMESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIPVDDKEFKNVKYISYYQWIVIVLAGQALLSWVPHLAWRVASRRLPVLLRSAREAVLPDRDLRVKAVSCMVASLEEQADATMRARRVKGIFRRCLGGLPPNTRLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGNFPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERDCSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWKNFRQAKITGTEEDLSRLLETYNRAG 407          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000033444.1 (SMESG000033444.1)

HSP 1 Score: 548.51 bits (1412), Expect = 0.000e+0
Identity = 254/395 (64.30%), Postives = 329/395 (83.29%), Query Frame = 2
Query:  194 DGGFIFKLGRLFKTPYGGEGVDFIDQLNYQFTSGLMIIFIAIISVRQYVGKPIQCWVPQEFTRSWEEYAENFCWISNTYFLLPNEQIPTEDIDRLKKRYICYYQWVAIVLAGQALLSWVPHVFWRVCSHRLPLLLKSAKEAAIPDRELRLKAVSCLVATLEEQYEAYSRFIRKRSFIHRCACGIAPNLRLTVLFIGVRCLFLANSVGQIYLMKRFVGANSTLFGLDLISDLLSDKEWQITGHFPRVTFCTIKVRKMGQQQPASYTLQCVLPINHFVEKIYIFLWFWFLILASLTFLSTLQWIVNTLIPMRRVQYIKQYLKALKMVSSTEERDCARFVNINLGPDGVFILQLVSKIASDLIALDVTATLWKNFRQAKITGTEEDVNRLLEFNNRSA 1378
            + G  F++G+LF+ PYGGEGVDF+DQLNYQFTSGL+I+FI II +RQYVGKPIQCWVPQEFTRSWEEYAEN CW+ NTYFLLP+E +P  D +  K RYI YYQWVAIVLAGQA++SWVPH+ WRV S R+P+LL+SA+EA+ PDRE+R KA+SCLVA LEEQ E+ +RF + +    +C  G+ P  R+T+LFI VR LF+AN+VGQI++MK+F+G N T FG+ +  DLL+  E QI+  FPRVT+CTIKVRKMGQ +P SYTLQCVLPIN+FVEK+Y+FLWFWF+IL+ LT L+T+QW +N  +P+RRVQ+++QYLKALK+++ST+ERDC RFV  NLG DG+F+LQ VS+I+SDLIALDVT TLW N+++AK+ G E+D++R+++  NRS+
Sbjct:    2 ESGIFFRIGQLFRVPYGGEGVDFVDQLNYQFTSGLLIVFIIIIGIRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRVPILLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIKGIFGKCLGGVNPTARVTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFRDLLNGNEGQISETFPRVTYCTIKVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYKRAKLAGNEDDIHRIIDSVNRSS 396          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000051126.1 (SMESG000051126.1)

HSP 1 Score: 493.041 bits (1268), Expect = 4.692e-173
Identity = 228/385 (59.22%), Postives = 298/385 (77.40%), Query Frame = 2
Query:  212 KLGRLFKTPYGGEGVDFIDQLNYQFTSGLMIIFIAIISVRQYVGKPIQCWVPQEFTRSWEEYAENFCWISNTYFLLPNEQIPTEDIDRLKKRYICYYQWVAIVLAGQALLSWVPHVFWRVCSHRLPLLLKSAKEAAIPDRELRLKAVSCLVATLEEQYEAYSRFIRKRS--FIHRCACGIAPNLRLTVLFIGVRCLFLANSVGQIYLMKRFVGANSTLFGLDLISDLLSDKEWQITGHFPRVTFCTIKVRKMGQQQPASYTLQCVLPINHFVEKIYIFLWFWFLILASLTFLSTLQWIVNTLIPMRRVQYIKQYLKALKMVSSTEERDCARFVNINLGPDGVFILQLVSKIASDLIALDVTATLWKNFRQAKITGTEEDVNRLLE 1360
            K+G+ F T YGG  +DF+DQLNYQ+++GL+ IFI+II  RQYVGKPIQCWVPQ+FT+SWEEYAEN CWI +TY LL NE IP +D +    +YI YYQWVAIV+ GQA++S++PH+ WR+ S RLP+LLK+A+EA+IPDRE+R KA+ C+V  LEE  EA  R+ R     F         P+ RLT+LF+ VR LF+ N++GQIYLMK F+  N+T FG+ +ISDLL   EW+  G+FPR+T+CTI VRK GQ + AS+T QCVLPINHFVEKIY+FLW WF +LA LT L+TLQW +   +P ++ Q+I++YLKALK++S++E R+C RFV  NLG DG+F+LQ VSK++SDLIALDVTATLW N+RQAK+ G E+D+ R +E
Sbjct:    8 KIGKHFHTAYGGNDIDFVDQLNYQYSTGLLFIFISIIGFRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKLLDNEDIPEDDFEIHSLKYISYYQWVAIVMGGQAIMSYLPHLIWRLWSKRLPILLKTAREASIPDREMRAKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFCFNPSTRLTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGNFPRITYCTINVRKFGQIKQASHTFQCVLPINHFVEKIYVFLWLWFTLLAVLTTLNTLQWGLIVCLPWKQTQFIQRYLKALKLISNSEGRECQRFVARNLGCDGIFVLQAVSKVSSDLIALDVTATLWTNYRQAKLNGAEDDITRYME 392          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000027007.1 (SMESG000027007.1)

HSP 1 Score: 489.96 bits (1260), Expect = 7.861e-172
Identity = 226/394 (57.36%), Postives = 296/394 (75.13%), Query Frame = 2
Query:  194 DGGFIFKLGRLFKTPYGGEGVDFIDQLNYQFTSGLMIIFIAIISVRQYVGKPIQCWVPQEFTRSWEEYAENFCWISNTYFLLPNEQIPTEDIDRLKKRYICYYQWVAIVLAGQALLSWVPHVFWRVCSHRLPLLLKSAKEAAIPDRELRLKAVSCLVATLEEQYEAYSRFIRKRSFIHRCACGIAPNLRLTVLFIGVRCLFLANSVGQIYLMKRFVGANSTLFGLDLISDLLSDKEWQITGHFPRVTFCTIKVRKMGQQQPASYTLQCVLPINHFVEKIYIFLWFWFLILASLTFLSTLQWIVNTLIPMRRVQYIKQYLKALKMVSSTEERDCARFVNINLGPDGVFILQLVSKIASDLIALDVTATLWKNFRQAKITGTEEDVNRLLEFNNRS 1375
            + G   K+ R FK PYGG  VDF+DQLNYQFTSGL+ +F+ II  RQY+GKPIQCWVPQEFT++WEEYAEN CW+ NTYFL P E IP  D++  K +YI YYQWVAIVL+GQAL+SW+P++ WR+ S ++ +LL SAKEA+IPD  +R KAVS LV  LEEQ +  ++F +++  + R    I P  R+T +FI VR LF+ N  GQI +M+ F+G++  +FG ++   LL + +WQI+  FPRVT+CT+KVRK+GQ +P SYTLQCVLP+N+FVEK+Y+FLWFWF+IL  LT +ST QWI N  IP  RVQ+I+QYLKALK++S  EE+DC RFVN  LG DG+F+L  VSK++SDLIALDV   LW+NF+ AK  G E D+N L++  +R 
Sbjct:    2 NAGIFLKIIRFFKVPYGGADVDFVDQLNYQFTSGLLAVFVIIIGFRQYMGKPIQCWVPQEFTKAWEEYAENLCWVQNTYFLSPEEDIPRTDVELNKMKYISYYQWVAIVLSGQALMSWIPYLVWRLFSQKVIVLLNSAKEASIPDWSVRRKAVSYLVNALEEQSQINNQFYKRKGIVRRYLTEINPAYRITFIFIVVRILFVTNCFGQIIIMRIFIGSSDFMFGYNVFQYLLRNHQWQISETFPRVTYCTVKVRKLGQLRPGSYTLQCVLPVNYFVEKVYVFLWFWFIILGVLTTISTAQWIANVCIPPWRVQFIRQYLKALKVISGPEEKDCNRFVNKKLGCDGIFLLHSVSKLSSDLIALDVAGHLWQNFKMAKSQGNEVDLNNLIQSIHRG 395          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000032206.1 (SMESG000032206.1)

HSP 1 Score: 466.463 bits (1199), Expect = 9.056e-163
Identity = 208/384 (54.17%), Postives = 281/384 (73.18%), Query Frame = 2
Query:  194 DGGFIFKLGRLFKTPYGGEGVDFIDQLNYQFTSGLMIIFIAIISVRQYVGKPIQCWVPQEFTRSWEEYAENFCWISNTYFLLPNEQIPTEDIDRLKKRYICYYQWVAIVLAGQALLSWVPHVFWRVCSHRLPLLLKSAKEAAIPDRELRLKAVSCLVATLEEQYEAYSRFIRKRSFIHRCACGIAPNLRLTVLFIGVRCLFLANSVGQIYLMKRFVGANSTLFGLDLISDLLSDKEWQITGHFPRVTFCTIKVRKMGQQQPASYTLQCVLPINHFVEKIYIFLWFWFLILASLTFLSTLQWIVNTLIPMRRVQYIKQYLKALKMVSSTEERDCARFVNINLGPDGVFILQLVSKIASDLIALDVTATLWKNFRQAKITGTEEDV 1345
            D   I KLGR+F++P GG+GV FID LNYQ++S ++++FIAII  RQY+GKPIQCWVPQEFTR+WE+YAEN CW+ NTYFL P + +P  D++     +I YYQW+ IV+  QA+L ++P + WRV S R P+LL+++KEA +PDRELR KAV+CLVA LEEQ     RF +  S I++  CG+ P   L                 Q+YLM+ F+G N T FG+ +  D+L+  +W+++GHFPRVTFC +++RKMGQ +PA YTLQCVLPIN+FVEKIY FLWFWF+ LA  T  +TLQW ++  +  R+V ++  YLKALK +SSTEERDC RFV + LG DG+F+L+ V+ +ASDL+ALDVT  +W+N++ AK+TGTEED+
Sbjct:    2 DSDSILKLGRIFRSPLGGDGVSFIDVLNYQYSSAVLVVFIAIIGTRQYIGKPIQCWVPQEFTRAWEDYAENICWVQNTYFLPPEKAVPDSDVELHSAEFISYYQWIVIVMGAQAVLCYLPQIIWRVGSRRFPVLLRNSKEAILPDRELRRKAVACLVAALEEQAIRNCRFRKNNSTIYKLLCGLGPGAELR----------------QLYLMRDFLGTNHTTFGVMIFQDILAGHDWKVSGHFPRVTFCPVEIRKMGQIKPAIYTLQCVLPINYFVEKIYAFLWFWFVSLACATSFNTLQWFIDLFVKNRQVVFVSNYLKALKQLSSTEERDCGRFVEVVLGNDGIFLLRAVANVASDLMALDVTGIMWRNYKHAKVTGTEEDM 369          
The following BLAST results are available for this feature:
BLAST of Innexin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inx-13.502e-8836.18Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-13.502e-8836.18Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-16.244e-8736.53Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
unc-95.905e-8637.67Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O0... [more]
inx-131.009e-8337.47Innexin [Source:UniProtKB/TrEMBL;Acc:O44887][more]
back to top
BLAST of Innexin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shakB1.547e-2228.73gene:FBgn0085387 transcript:FBtr0112571[more]
Inx24.668e-2126.93gene:FBgn0027108 transcript:FBtr0301860[more]
Inx24.668e-2126.93gene:FBgn0027108 transcript:FBtr0071005[more]
Inx24.668e-2126.93gene:FBgn0027108 transcript:FBtr0332314[more]
Inx24.668e-2126.93gene:FBgn0027108 transcript:FBtr0071006[more]
back to top
BLAST of Innexin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O01393|UNC9_CAEEL7.511e-8537.67Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q03412|UNC7_CAEEL5.363e-7734.61Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q19746|INX3_CAEEL1.921e-6735.41Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx... [more]
sp|Q23157|INX11_CAEEL7.508e-6133.07Innexin-11 OS=Caenorhabditis elegans OX=6239 GN=in... [more]
sp|A8WVX4|INX19_CAEBR3.753e-5931.46Innexin-19 OS=Caenorhabditis briggsae OX=6238 GN=i... [more]
back to top
BLAST of Innexin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RM260.000e+077.72Innexin OS=Fasciola hepatica OX=6192 GN=inx PE=3 S... [more]
A0A4S2LXE00.000e+077.72Innexin OS=Opisthorchis felineus OX=147828 GN=inx ... [more]
A0A5K4F4I80.000e+078.47Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A158QU820.000e+075.99Innexin OS=Mesocestoides corti OX=53468 GN=inx PE=... [more]
A0A158QHF30.000e+075.74Innexin OS=Rodentolepis nana OX=102285 GN=inx PE=3... [more]
back to top
BLAST of Innexin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068735.10.000e+068.26SMESG000068735.1[more]
SMESG000033444.10.000e+064.30SMESG000033444.1[more]
SMESG000051126.14.692e-17359.22SMESG000051126.1[more]
SMESG000027007.17.861e-17257.36SMESG000027007.1[more]
SMESG000032206.19.056e-16354.17SMESG000032206.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013974 ID=SMED30013974|Name=Innexin|organism=Schmidtea mediterranea sexual|type=transcript|length=1474bp
GATCTCAAAAATATTAATTGTGAATAAATCTCAAATTTGTTTCATCTTGT
TTAGTTGATGTGAAAGAGTTGTTTTTTAATCTATCGAATAGTAGAAAGAA
TGATAATCAAATGTTTCGTCGGACTTGTTCGTTGTACTCGCTCAAAGGTG
GTTTTTGTGAACTGAAATGACGAGAGGTGCTCCCGGAATTTTTGATGGCG
GCTTCATCTTTAAGCTAGGTCGACTGTTTAAAACCCCATATGGAGGTGAA
GGTGTGGATTTTATCGACCAATTGAACTACCAATTTACAAGCGGTCTCAT
GATCATTTTTATTGCCATTATCTCCGTTCGTCAGTACGTAGGAAAACCAA
TTCAATGTTGGGTTCCTCAGGAATTTACCCGGTCATGGGAAGAATATGCA
GAAAACTTTTGCTGGATTTCGAATACCTACTTTCTTTTACCAAATGAACA
AATTCCGACAGAGGATATTGATAGACTTAAAAAACGATATATTTGTTATT
ATCAATGGGTGGCTATAGTCTTAGCTGGACAGGCTCTACTGTCATGGGTC
CCACATGTATTCTGGAGGGTCTGCTCACATCGACTACCTTTACTATTAAA
ATCTGCTAAAGAAGCAGCGATTCCCGATCGTGAACTTCGTTTAAAAGCAG
TTTCTTGTTTAGTCGCAACACTTGAAGAACAGTATGAAGCTTACAGTAGA
TTTATCAGAAAGCGAAGTTTTATTCATCGATGTGCGTGTGGTATTGCACC
AAATTTGAGGCTCACTGTTCTTTTCATTGGAGTACGCTGCTTGTTCCTTG
CCAATTCAGTGGGTCAAATCTACCTCATGAAACGTTTTGTCGGAGCAAAC
AGTACACTATTCGGTTTAGACTTGATATCAGACTTGCTATCAGACAAAGA
ATGGCAGATCACTGGACATTTTCCCAGAGTCACATTTTGTACAATTAAAG
TAAGGAAAATGGGCCAACAACAGCCTGCCAGTTATACCCTTCAATGTGTT
CTACCAATAAATCACTTTGTTGAGAAGATATATATATTTCTCTGGTTTTG
GTTTCTAATTCTCGCTTCCTTAACCTTTCTCAGCACACTCCAATGGATTG
TAAATACTCTTATTCCAATGCGACGGGTCCAATATATCAAACAATATTTA
AAAGCTCTAAAAATGGTCAGTAGCACTGAGGAAAGAGATTGTGCAAGATT
TGTCAACATAAATCTCGGTCCTGATGGTGTATTCATTTTACAATTAGTCT
CAAAAATTGCTAGCGATTTAATAGCTTTAGATGTCACTGCAACATTGTGG
AAAAATTTTCGACAAGCTAAAATAACTGGAACTGAAGAAGATGTAAATCG
TTTGTTAGAATTTAATAACCGAAGTGCAGGAGGATCTTCAAGTGTTGTAT
AGCGTTGACGGGATAAAAATCTTTTTCGAATTTGCGTTGTATTTGGATTT
TAATAACTAAAATACTCAGATTTG
back to top

protein sequence of SMED30013974-orf-1

>SMED30013974-orf-1 ID=SMED30013974-orf-1|Name=SMED30013974-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=412bp
MTRGAPGIFDGGFIFKLGRLFKTPYGGEGVDFIDQLNYQFTSGLMIIFIA
IISVRQYVGKPIQCWVPQEFTRSWEEYAENFCWISNTYFLLPNEQIPTED
IDRLKKRYICYYQWVAIVLAGQALLSWVPHVFWRVCSHRLPLLLKSAKEA
AIPDRELRLKAVSCLVATLEEQYEAYSRFIRKRSFIHRCACGIAPNLRLT
VLFIGVRCLFLANSVGQIYLMKRFVGANSTLFGLDLISDLLSDKEWQITG
HFPRVTFCTIKVRKMGQQQPASYTLQCVLPINHFVEKIYIFLWFWFLILA
SLTFLSTLQWIVNTLIPMRRVQYIKQYLKALKMVSSTEERDCARFVNINL
GPDGVFILQLVSKIASDLIALDVTATLWKNFRQAKITGTEEDVNRLLEFN
NRSAGGSSSVV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000990Innexin
Vocabulary: cellular component
TermDefinition
GO:0005921gap junction
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000990InnexinPRINTSPR01262INNEXINcoord: 251..260
score: 58.4
coord: 81..90
score: 50.0
coord: 111..133
score: 48.17
coord: 277..293
score: 62.59
coord: 203..217
score: 29.87
coord: 53..64
score: 56.67
IPR000990InnexinPFAMPF00876Innexincoord: 31..381
e-value: 8.0E-108
score: 360.8
IPR000990InnexinPANTHERPTHR11893INNEXINcoord: 22..391
IPR000990InnexinPROSITEPS51013PANNEXINcoord: 25..387
score: 31.391
NoneNo IPR availableTMHMMTMhelixcoord: 35..54
NoneNo IPR availableTMHMMTMhelixcoord: 290..312
NoneNo IPR availableTMHMMTMhelixcoord: 111..133