Solute carrier family 4, sodium bicarbonate cotransporter, member 7

Overview
NameSolute carrier family 4, sodium bicarbonate cotransporter, member 7
Smed IDSMED30013973
Length (bp)1440
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 (SMED30013973) t-SNE clustered cells

Violin plots show distribution of expression levels for Solute carrier family 4, sodium bicarbonate cotransporter, member 7 (SMED30013973) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 (SMED30013973) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Solute carrier family 4, sodium bicarbonate cotransporter, member 7 (SMED30013973) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013973

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30013973h1SMcG0015060 dd_Smed_v4_5847_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013973h1SMcG0015060 dd_Smed_v4_5847_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013973h1SMcG0015060 dd_Smed_v4_5847_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30013973h1SMcG0015060 dd_Smed_v4_5847_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30013973h1SMcG0015060 dd_Smed_v6_5847_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30013973h1SMcG0015060 dd_Smed_v4_5847_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Human
Match: GIPC1 (GIPC PDZ domain containing family member 1 [Source:HGNC Symbol;Acc:HGNC:1226])

HSP 1 Score: 277.33 bits (708), Expect = 3.058e-89
Identity = 135/276 (48.91%), Postives = 187/276 (67.75%), Query Frame = 2
Query:  194 FQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGGELR-PNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDAKAG 1018
            F  QLAHG PTG I  F N++ELYGKIA+ + +   E++FCTLNTHKVDMD+LLG  IGL+DFIF HVKGQRKE+++ KSED+LGLTITDNG G AFIKRI+  S I  +   LI +GD IE I+ +S +G RHY++A+ L+ +P G+ FT++L  P K+  +  +S+RS  G     P +  G+ T+R+ +      + + S  +E AIE +   +E  +GI D E+A T++E+GK  +NP E  E ++E LGDF FP+  ++D WG I DAK G
Sbjct:   60 FHTQLAHGSPTGRIEGFTNVKELYGKIAEAFRLPTAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSEDALGLTITDNGAGYAFIKRIKEGSVIDHI--HLISVGDMIEAINGQSLLGCRHYEVARLLKELPRGRTFTLKLTEPRKA--FDMISQRSAGGRPGSGPQLGTGRGTLRLRSRGPATVEDLPSAFEEKAIEKVDDLLESYMGIRDTELAATMVELGKDKRNPDELAEALDERLGDFAFPDEFVFDVWGAIGDAKVG 331          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Human
Match: GIPC1 (GIPC PDZ domain containing family member 1 [Source:HGNC Symbol;Acc:HGNC:1226])

HSP 1 Score: 277.33 bits (708), Expect = 3.058e-89
Identity = 135/276 (48.91%), Postives = 187/276 (67.75%), Query Frame = 2
Query:  194 FQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGGELR-PNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDAKAG 1018
            F  QLAHG PTG I  F N++ELYGKIA+ + +   E++FCTLNTHKVDMD+LLG  IGL+DFIF HVKGQRKE+++ KSED+LGLTITDNG G AFIKRI+  S I  +   LI +GD IE I+ +S +G RHY++A+ L+ +P G+ FT++L  P K+  +  +S+RS  G     P +  G+ T+R+ +      + + S  +E AIE +   +E  +GI D E+A T++E+GK  +NP E  E ++E LGDF FP+  ++D WG I DAK G
Sbjct:   60 FHTQLAHGSPTGRIEGFTNVKELYGKIAEAFRLPTAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSEDALGLTITDNGAGYAFIKRIKEGSVIDHI--HLISVGDMIEAINGQSLLGCRHYEVARLLKELPRGRTFTLKLTEPRKA--FDMISQRSAGGRPGSGPQLGTGRGTLRLRSRGPATVEDLPSAFEEKAIEKVDDLLESYMGIRDTELAATMVELGKDKRNPDELAEALDERLGDFAFPDEFVFDVWGAIGDAKVG 331          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Human
Match: GIPC1 (GIPC PDZ domain containing family member 1 [Source:HGNC Symbol;Acc:HGNC:1226])

HSP 1 Score: 277.33 bits (708), Expect = 3.058e-89
Identity = 135/276 (48.91%), Postives = 187/276 (67.75%), Query Frame = 2
Query:  194 FQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGGELR-PNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDAKAG 1018
            F  QLAHG PTG I  F N++ELYGKIA+ + +   E++FCTLNTHKVDMD+LLG  IGL+DFIF HVKGQRKE+++ KSED+LGLTITDNG G AFIKRI+  S I  +   LI +GD IE I+ +S +G RHY++A+ L+ +P G+ FT++L  P K+  +  +S+RS  G     P +  G+ T+R+ +      + + S  +E AIE +   +E  +GI D E+A T++E+GK  +NP E  E ++E LGDF FP+  ++D WG I DAK G
Sbjct:   60 FHTQLAHGSPTGRIEGFTNVKELYGKIAEAFRLPTAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSEDALGLTITDNGAGYAFIKRIKEGSVIDHI--HLISVGDMIEAINGQSLLGCRHYEVARLLKELPRGRTFTLKLTEPRKA--FDMISQRSAGGRPGSGPQLGTGRGTLRLRSRGPATVEDLPSAFEEKAIEKVDDLLESYMGIRDTELAATMVELGKDKRNPDELAEALDERLGDFAFPDEFVFDVWGAIGDAKVG 331          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Human
Match: GIPC2 (GIPC PDZ domain containing family member 2 [Source:HGNC Symbol;Acc:HGNC:18177])

HSP 1 Score: 240.736 bits (613), Expect = 2.167e-75
Identity = 137/316 (43.35%), Postives = 189/316 (59.81%), Query Frame = 2
Query:   65 ISMPLFGKKKKEDSQKDILAHSDIXXXXXXXXXXGAVHKSKFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGGELRPNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDAK 1012
            + + L GKKK +  +   L   + +     S +       +  F  QLAHG  TG +  F +I+ELY +IA  ++I   EIL+CTLNT K+DM+RLLG  +GL+DFIF HVKG  KE+++ KSEDSLGLTITDNG G AFIKRI+    I  +    I +GDHIE I+ E+ VG RHYD+AKKL+ +   + FTM+LI P+K+     +  RS+ G      I  G+ T+R+ +      + + S     AIE I   +E  +GI D ++A T+ E GK   NP EF   ++E LGDF FP+  ++D WGVI DAK
Sbjct:    1 MPLKLRGKKKAKSKETAGLVEGEPTGAGGGSLSASRAPARRLVFHAQLAHGSATGRVEGFSSIQELYAQIAGAFEISPSEILYCTLNTPKIDMERLLGGQLGLEDFIFAHVKGIEKEVNVYKSEDSLGLTITDNGVGYAFIKRIKDGGVIDSVKT--ICVGDHIESINGENIVGWRHYDVAKKLKELKKEELFTMKLIEPKKA---FEIELRSKAGKSSGEKIGCGRATLRLRSKGPATVEEMPSETKAKAIEKIDDVLELYMGIRDIDLATTMFEAGKDKVNPDEFAVALDETLGDFAFPDEFVFDVWGVIGDAK 311          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Human
Match: GIPC3 (GIPC PDZ domain containing family member 3 [Source:HGNC Symbol;Acc:HGNC:18183])

HSP 1 Score: 239.195 bits (609), Expect = 8.963e-75
Identity = 118/274 (43.07%), Postives = 176/274 (64.23%), Query Frame = 2
Query:  194 FQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYG-GELRPNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDAK 1012
            F+ QLAHG PTG I  F N+RELY KIA+ + I   EILFCTLN+HKVDM +LLG  IGL+DFIF HV+G+ KE+++ K+ED+LGLTITDNG G AFIKRI+  S I+++    + +GD IE I++ S VG RHY++AK LR +P  Q FT+RL+ P+++  +  + +RS      +   +  G++T+R+ +      +   S  +E A   +   +E  +GI D E+A T++E  K+  +  EF   ++  LG+F FP+  + + W  I +A+
Sbjct:   39 FRTQLAHGSPTGKIEGFTNVRELYAKIAEAFGIAPTEILFCTLNSHKVDMQKLLGGQIGLEDFIFAHVRGETKEVEVTKTEDALGLTITDNGAGYAFIKRIKEGSIINRIEA--VCVGDSIEAINDHSIVGCRHYEVAKMLRELPKSQPFTLRLVQPKRA--FDMIGQRSRSSKCPVEAKVTSGRETLRLRSGGAATVEEAPSEFEEEASRKVDDLLESYMGIRDPELASTMVETSKKTASAQEFARCLDSVLGEFAFPDEFVVEVWAAIGEAR 308          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Celegans
Match: gipc-1 (GIPC (RGS-GAIP Interacting Protein C) homolog [Source:UniProtKB/TrEMBL;Acc:Q18488])

HSP 1 Score: 173.326 bits (438), Expect = 1.690e-49
Identity = 91/282 (32.27%), Postives = 153/282 (54.26%), Query Frame = 2
Query:  173 VHKSKFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGGELRPNIVKGKKTIRISANNVYEDDTITSTMDELAIEA-ISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNE-ELGDFGFPNSLIYDFWGVITDAK 1012
            V   +  F CQ+AHG P GII ++ N+ ELY  IADC+ I  ++I+F T+N  K DM  +    +   D +F H++GQ  E+ + K   + G+TITDNG G AFIK I P S   ++ +    +G  IE ++ E  +G+RHY +A+ L+++  G++  +RLI+P K+     +    + GG L       K TIR  +   +  + +   M +  +   ++   ++ +G+ D+++A  I E     +   +  E + E EL  F FP+ +++D WG+I D K
Sbjct:   58 VAARQLKFACQMAHGSPVGIIDKWNNMEELYQSIADCFTISKDDIIFLTVNDFKPDMKNMFTGTLNFKDMLFAHIRGQATELRVVKDAKNFGVTITDNGLGNAFIKVISPDSVFDRM-RPATQVGQLIEAVNGECVLGKRHYQVARILKNVRRGEECVVRLIAP-KTADPGTMKTTGKTGGGL------AKGTIRFKSEGGFAVEDVQDQMIQAEMCGKLNEIFDQYLGVQDDQLAMRIWETASNCETLLQLSEAIKESELSMFDFPDGMVFDMWGIIGDLK 331          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Celegans
Match: gipc-2 (GIPC (RGS-GAIP Interacting Protein C) homolog [Source:UniProtKB/TrEMBL;Acc:Q20393])

HSP 1 Score: 172.555 bits (436), Expect = 3.125e-49
Identity = 95/282 (33.69%), Postives = 153/282 (54.26%), Query Frame = 2
Query:  173 VHKSKFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGGELRPNIVKGKKTIRISANNVYEDDTITSTMDELAIEA-ISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNE-ELGDFGFPNSLIYDFWGVITDAK 1012
            V   +  F CQLAHG P  II ++ ++ ELY  IAD + I  ++I+F T+N  K DM  +    +   D +F HV+GQ  E+ + K  +  G+T+TDNG G AFIK I P S   ++ +    +G  IE I+ ES +G+RHY +A+ L+SI  G++  +RLI+P KS     +    + GG+L       K TIR  +   +  + I   M +  +   ++   ++ +G+ D+++A  I E     +   +  E + + EL  F FP+ L++D WG+I D K
Sbjct:   58 VAAKELKFPCQLAHGSPVAIIDKWNDMEELYQSIADFFAISKDDIIFLTVNDFKPDMKNMFSGTLNFKDMLFAHVRGQATELRMVKDANVFGVTVTDNGLGNAFIKVISPGSVFDRM-RPATQVGQLIEAINGESVLGKRHYQVARMLKSIRRGEECIIRLIAP-KSADPGTMKMTRKTGGDL------AKGTIRFKSEGGFAVEDIQDQMIQAEMCGKLNELFDQYLGVQDDQLAMRIWETASNCETLWQLSEAIKQSELSMFEFPDGLVFDMWGIIGDLK 331          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Fly
Match: kermit (gene:FBgn0010504 transcript:FBtr0339296)

HSP 1 Score: 262.692 bits (670), Expect = 7.026e-84
Identity = 136/288 (47.22%), Postives = 188/288 (65.28%), Query Frame = 2
Query:  179 KSKFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSE---YGGELRPNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEM-NEELGDFGFPNSLIYDFWGVITDAKAGILTS 1030
            K    F CQLAHG PTG+I +F ++RELY KIA+C+DI  ++ILFCTLN+HKVDM RLLG  IGLDDFIF H KG+ KEI++ KS+D+LGLTITDNG G AFIKRI+  S I ++    I +GDHIEK++ ++ VG+RHY++A+ L+ I  G+ FT+RL+ P +SG +  +  RS+    G     N   GK+T+R  AN   + +          IEAI+  +E  +GI+D E+A  I ++G +  N  +F E + N +L  FGF +  I + WG ITDA+    TS
Sbjct:   50 KPPLVFHCQLAHGSPTGLIHDFSSVRELYQKIAECFDISEKDILFCTLNSHKVDMTRLLGGQIGLDDFIFAHRKGRPKEIEIVKSQDALGLTITDNGAGYAFIKRIKEDSIIDRIEH--ISVGDHIEKLNGQNMVGKRHYEVARMLKDIATGETFTLRLVEPVRSG-FQGIGPRSQSRASGSAGGKNYGSGKETLRFKANGNAQIEPQFDEATVAGIEAINNLLESFMGINDTELASQIWDLGDQKSNSMDFAEAIDNSDLESFGFTDDFIIELWGAITDARRKSTTS 334          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Fly
Match: kermit (gene:FBgn0010504 transcript:FBtr0088812)

HSP 1 Score: 262.692 bits (670), Expect = 7.026e-84
Identity = 136/288 (47.22%), Postives = 188/288 (65.28%), Query Frame = 2
Query:  179 KSKFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSE---YGGELRPNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEM-NEELGDFGFPNSLIYDFWGVITDAKAGILTS 1030
            K    F CQLAHG PTG+I +F ++RELY KIA+C+DI  ++ILFCTLN+HKVDM RLLG  IGLDDFIF H KG+ KEI++ KS+D+LGLTITDNG G AFIKRI+  S I ++    I +GDHIEK++ ++ VG+RHY++A+ L+ I  G+ FT+RL+ P +SG +  +  RS+    G     N   GK+T+R  AN   + +          IEAI+  +E  +GI+D E+A  I ++G +  N  +F E + N +L  FGF +  I + WG ITDA+    TS
Sbjct:   50 KPPLVFHCQLAHGSPTGLIHDFSSVRELYQKIAECFDISEKDILFCTLNSHKVDMTRLLGGQIGLDDFIFAHRKGRPKEIEIVKSQDALGLTITDNGAGYAFIKRIKEDSIIDRIEH--ISVGDHIEKLNGQNMVGKRHYEVARMLKDIATGETFTLRLVEPVRSG-FQGIGPRSQSRASGSAGGKNYGSGKETLRFKANGNAQIEPQFDEATVAGIEAINNLLESFMGINDTELASQIWDLGDQKSNSMDFAEAIDNSDLESFGFTDDFIIELWGAITDARRKSTTS 334          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Fly
Match: kermit (gene:FBgn0010504 transcript:FBtr0088813)

HSP 1 Score: 262.692 bits (670), Expect = 7.026e-84
Identity = 136/288 (47.22%), Postives = 188/288 (65.28%), Query Frame = 2
Query:  179 KSKFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSE---YGGELRPNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEM-NEELGDFGFPNSLIYDFWGVITDAKAGILTS 1030
            K    F CQLAHG PTG+I +F ++RELY KIA+C+DI  ++ILFCTLN+HKVDM RLLG  IGLDDFIF H KG+ KEI++ KS+D+LGLTITDNG G AFIKRI+  S I ++    I +GDHIEK++ ++ VG+RHY++A+ L+ I  G+ FT+RL+ P +SG +  +  RS+    G     N   GK+T+R  AN   + +          IEAI+  +E  +GI+D E+A  I ++G +  N  +F E + N +L  FGF +  I + WG ITDA+    TS
Sbjct:   50 KPPLVFHCQLAHGSPTGLIHDFSSVRELYQKIAECFDISEKDILFCTLNSHKVDMTRLLGGQIGLDDFIFAHRKGRPKEIEIVKSQDALGLTITDNGAGYAFIKRIKEDSIIDRIEH--ISVGDHIEKLNGQNMVGKRHYEVARMLKDIATGETFTLRLVEPVRSG-FQGIGPRSQSRASGSAGGKNYGSGKETLRFKANGNAQIEPQFDEATVAGIEAINNLLESFMGINDTELASQIWDLGDQKSNSMDFAEAIDNSDLESFGFTDDFIIELWGAITDARRKSTTS 334          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Fly
Match: kermit (gene:FBgn0010504 transcript:FBtr0088814)

HSP 1 Score: 262.692 bits (670), Expect = 7.026e-84
Identity = 136/288 (47.22%), Postives = 188/288 (65.28%), Query Frame = 2
Query:  179 KSKFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSE---YGGELRPNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEM-NEELGDFGFPNSLIYDFWGVITDAKAGILTS 1030
            K    F CQLAHG PTG+I +F ++RELY KIA+C+DI  ++ILFCTLN+HKVDM RLLG  IGLDDFIF H KG+ KEI++ KS+D+LGLTITDNG G AFIKRI+  S I ++    I +GDHIEK++ ++ VG+RHY++A+ L+ I  G+ FT+RL+ P +SG +  +  RS+    G     N   GK+T+R  AN   + +          IEAI+  +E  +GI+D E+A  I ++G +  N  +F E + N +L  FGF +  I + WG ITDA+    TS
Sbjct:   50 KPPLVFHCQLAHGSPTGLIHDFSSVRELYQKIAECFDISEKDILFCTLNSHKVDMTRLLGGQIGLDDFIFAHRKGRPKEIEIVKSQDALGLTITDNGAGYAFIKRIKEDSIIDRIEH--ISVGDHIEKLNGQNMVGKRHYEVARMLKDIATGETFTLRLVEPVRSG-FQGIGPRSQSRASGSAGGKNYGSGKETLRFKANGNAQIEPQFDEATVAGIEAINNLLESFMGINDTELASQIWDLGDQKSNSMDFAEAIDNSDLESFGFTDDFIIELWGAITDARRKSTTS 334          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Fly
Match: kermit (gene:FBgn0010504 transcript:FBtr0088811)

HSP 1 Score: 262.692 bits (670), Expect = 7.026e-84
Identity = 136/288 (47.22%), Postives = 188/288 (65.28%), Query Frame = 2
Query:  179 KSKFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSE---YGGELRPNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEM-NEELGDFGFPNSLIYDFWGVITDAKAGILTS 1030
            K    F CQLAHG PTG+I +F ++RELY KIA+C+DI  ++ILFCTLN+HKVDM RLLG  IGLDDFIF H KG+ KEI++ KS+D+LGLTITDNG G AFIKRI+  S I ++    I +GDHIEK++ ++ VG+RHY++A+ L+ I  G+ FT+RL+ P +SG +  +  RS+    G     N   GK+T+R  AN   + +          IEAI+  +E  +GI+D E+A  I ++G +  N  +F E + N +L  FGF +  I + WG ITDA+    TS
Sbjct:   50 KPPLVFHCQLAHGSPTGLIHDFSSVRELYQKIAECFDISEKDILFCTLNSHKVDMTRLLGGQIGLDDFIFAHRKGRPKEIEIVKSQDALGLTITDNGAGYAFIKRIKEDSIIDRIEH--ISVGDHIEKLNGQNMVGKRHYEVARMLKDIATGETFTLRLVEPVRSG-FQGIGPRSQSRASGSAGGKNYGSGKETLRFKANGNAQIEPQFDEATVAGIEAINNLLESFMGINDTELASQIWDLGDQKSNSMDFAEAIDNSDLESFGFTDDFIIELWGAITDARRKSTTS 334          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Zebrafish
Match: gipc3 (GIPC PDZ domain containing family, member 3 [Source:ZFIN;Acc:ZDB-GENE-060616-326])

HSP 1 Score: 271.166 bits (692), Expect = 3.947e-87
Identity = 132/282 (46.81%), Postives = 186/282 (65.96%), Query Frame = 2
Query:  179 KSKFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGGELRPNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDAKAGIL 1024
            + K  F  QLAHG PTG I  F N+RELY KIA+ ++I   EILFCTLN+HKVDM +LLG  IGL+DFIF HV+G+ KE+++ K+ED+LGLTITDNG G AFIKRI+  S I ++    + +GDHIE I+++S VG RHY++AK L+  P G  FT+RL+ P+K+  +  + +R+         +  GK+T+R+        + I S +++ AI  +   +E  +GI D E+A TI+E GK  KNP +F E ++  LGDFGFP+  ++D WG + D K G L
Sbjct:   56 RPKLVFHTQLAHGSPTGRIHGFTNVRELYAKIAEVFNISPSEILFCTLNSHKVDMQKLLGGQIGLEDFIFAHVRGETKEVEVIKTEDALGLTITDNGAGYAFIKRIKEGSTIDRIKS--VCVGDHIEAINDQSIVGCRHYEVAKMLKEQPRGTPFTLRLVEPKKA--FDMIGQRTRAPKSSEGKLSSGKETLRLRTRGSASLEEIPSELEDAAIRKVDDLLESYMGIRDLELATTIVEAGKNKKNPDDFAEALDSVLGDFGFPDVFLFDVWGALGDVKNGRL 333          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Zebrafish
Match: gipc1 (GIPC PDZ domain containing family, member 1 [Source:ZFIN;Acc:ZDB-GENE-060726-1])

HSP 1 Score: 266.544 bits (680), Expect = 2.711e-85
Identity = 129/280 (46.07%), Postives = 184/280 (65.71%), Query Frame = 2
Query:  179 KSKFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGGELRPNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDAKAG 1018
            + +  F  QLAHG PTG I  F N+RELY KI + + I   E++FCTLNTHKVDMD+LLG  IGL+DFIF HVKGQRKE+++ K ED+LGLTITDNG G AFIKRIR  S I ++   +I++GD IE I+ +  +G RHY++AK L+ +P G+ F ++++ P K+    ++  +          +  G+ T+R+ +      + + S  +E AIE +   +E  +GI D+E+A T++E+GK  KNP EF E ++E LGDF FP+  ++D WG I DAK G
Sbjct:   59 RPRLIFHTQLAHGSPTGRIEGFSNVRELYAKIGEAFGIPPTEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKGEDALGLTITDNGAGYAFIKRIREGSIIHQI--QVINVGDMIESINGQILIGCRHYEVAKMLKELPKGKTFFLKMVEPLKA---FDMISQRSGSRSGSAQLGTGRGTLRLRSKGPATVEELPSAFEEKAIEKVDDLLESYMGIRDSELAATMVELGKDKKNPDEFAEALDETLGDFAFPDEFVFDVWGAIGDAKVG 333          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Zebrafish
Match: gipc2 (GIPC PDZ domain containing family, member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-921])

HSP 1 Score: 263.462 bits (672), Expect = 3.732e-84
Identity = 129/286 (45.10%), Postives = 189/286 (66.08%), Query Frame = 2
Query:  170 AVHKSKFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGG---ELRPNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDAKAG 1018
            A  + K  F  QLAHG PTG I  F N++ELY KIA+ +++  +EILFCTLNTHK+DM++LLG  IGL+DFIF H+KG +KE+D+ KSE++LGLTITDNG G AFIKRI+  S +   G  +I +GDHIE I+ ++ VG RHY++A+ L+ +P  Q FT++L+ P K+  +  L  RS   G        I  G++T+R+ +      + + +  +E A++ +   +E  +GI D E+A T++E+G+  KNP EF   +++ LGDF FP+  ++D WG I DAK G
Sbjct:   45 ASLRPKLVFHTQLAHGSPTGRIEGFTNVKELYNKIAEAFNLSPDEILFCTLNTHKIDMEKLLGGQIGLEDFIFAHIKGIKKEMDVYKSEEALGLTITDNGAGYAFIKRIKEGSVVD--GVKVICVGDHIECINGKNIVGMRHYEVARMLKELPKDQTFTLKLVEPMKA--FEMLEPRSRGAGGKTSGEGKIGTGRETLRLRSKGPATVEEMPTEFEEKAVKKVDDLLESYMGIRDTELAATMVEVGRDKKNPDEFAMALDQALGDFAFPDEFVFDVWGAIGDAKQG 326          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Xenopus
Match: slc4a7 (solute carrier family 4, sodium bicarbonate cotransporter, member 7 [Source:Xenbase;Acc:XB-GENE-963950])

HSP 1 Score: 278.1 bits (710), Expect = 1.248e-89
Identity = 137/280 (48.93%), Postives = 190/280 (67.86%), Query Frame = 2
Query:  179 KSKFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGGELRPNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDAKAG 1018
            + K  F  QLAHG PTG I  F N++ELY KIA+ + I  EEILFCTLNTHK+DMD+LLG  IGL+DFIF HVKG +KE+++ KSED+LGLTITDNG G AFIKRI+  S I K+   +I++GDHIE I+ ++ VG RHY++AK L+ +  GQ FT++LI P K+  +  +  R+  GG+    I  G++T+R+ +      + + S  +E AI+ +   +E  +GI D E+A T++E G+  KNP EF   ++E LGDF FP+  ++D WG I DAK G
Sbjct:   57 RPKLVFHTQLAHGSPTGRIEGFTNVKELYSKIAEAFLITPEEILFCTLNTHKIDMDKLLGGQIGLEDFIFAHVKGTKKEVEILKSEDALGLTITDNGAGIAFIKRIKDDSTIDKV--KVINVGDHIEAINGKNIVGSRHYEVAKMLKELEKGQTFTLKLIEPLKA--FEMIEPRAR-GGKTEGKISTGRETLRLRSKGPATVEELPSAFEEKAIKKVDDLLESYMGIRDVELAATMVEAGRDKKNPDEFAVALDETLGDFSFPDEFVFDVWGAIGDAKQG 331          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Xenopus
Match: slc4a7 (solute carrier family 4, sodium bicarbonate cotransporter, member 7 [Source:Xenbase;Acc:XB-GENE-963950])

HSP 1 Score: 277.715 bits (709), Expect = 1.454e-89
Identity = 137/280 (48.93%), Postives = 190/280 (67.86%), Query Frame = 2
Query:  179 KSKFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGGELRPNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDAKAG 1018
            + K  F  QLAHG PTG I  F N++ELY KIA+ + I  EEILFCTLNTHK+DMD+LLG  IGL+DFIF HVKG +KE+++ KSED+LGLTITDNG G AFIKRI+  S I K+   +I++GDHIE I+ ++ VG RHY++AK L+ +  GQ FT++LI P K+  +  +  R+  GG+    I  G++T+R+ +      + + S  +E AI+ +   +E  +GI D E+A T++E G+  KNP EF   ++E LGDF FP+  ++D WG I DAK G
Sbjct:   55 RPKLVFHTQLAHGSPTGRIEGFTNVKELYSKIAEAFLITPEEILFCTLNTHKIDMDKLLGGQIGLEDFIFAHVKGTKKEVEILKSEDALGLTITDNGAGIAFIKRIKDDSTIDKV--KVINVGDHIEAINGKNIVGSRHYEVAKMLKELEKGQTFTLKLIEPLKA--FEMIEPRAR-GGKTEGKISTGRETLRLRSKGPATVEELPSAFEEKAIKKVDDLLESYMGIRDVELAATMVEAGRDKKNPDEFAVALDETLGDFSFPDEFVFDVWGAIGDAKQG 329          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Xenopus
Match: gipc1 (GIPC PDZ domain containing family member 1 [Source:NCBI gene;Acc:496793])

HSP 1 Score: 258.07 bits (658), Expect = 6.620e-82
Identity = 124/276 (44.93%), Postives = 186/276 (67.39%), Query Frame = 2
Query:  194 FQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGGELRPNIVKGKKTIRISANNVYEDDTI-TSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDAKAG 1018
            F  QLAHG PTG I  F N++ELY KIA+ + I + E++FCTLNTH++DMD+LLG  IGL+DFIF HV+GQ+KE+++ KSEDSLGLTITDNG G AFIKRI+  S I ++   LI +GD IE I+ ++ +G RH+++A+ L+ +P G+ FT++L  P K+  +  +  RS   G        G+ T+R+ +      + +  S ++E A++ +   +E  +GI D+E+A T++E+G   +NP +F + ++  LGDF FP+  ++D WG I DAKAG
Sbjct:   59 FHAQLAHGSPTGRIEGFSNVKELYAKIAEAFTIPVGEVMFCTLNTHRLDMDKLLGGQIGLEDFIFAHVRGQKKELEVYKSEDSLGLTITDNGAGFAFIKRIKEGSVIHRM--QLIGVGDMIEAINGKNLIGSRHFEVARILKELPRGRMFTLKLCEPLKA--FEMIGPRSGLSGISSGTSPSGRGTLRLRSKGPPTVEQLQVSVIEEKAVQKVDDLLESYMGIRDSELAGTMVELGMDKQNPDDFSQALDRTLGDFAFPDEFVFDVWGAIGDAKAG 330          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Xenopus
Match: gipc3 (GIPC PDZ domain containing family member 3 [Source:NCBI gene;Acc:100125129])

HSP 1 Score: 228.794 bits (582), Expect = 1.777e-70
Identity = 117/279 (41.94%), Postives = 180/279 (64.52%), Query Frame = 2
Query:  179 KSKFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKS-GIYSNLSKRSEYGGELRPNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDAK 1012
            + +  F  QLAHG  T  I  F N++ELY KIA+ ++I   EILFCTLNTHKVDM +LLG  IGL+DFIF HV+G+ KE+++ K+ED+LGLTITDNG G AFIKRI+  S   +L   ++++GD IE I++++ VG RHY++AK LR +P  + FT+RL+ P+++  +     + S+   E +  +  GK+T+R+    +   + + S ++E A   +   +E  +GI D ++A T++EI K  +NP EF   ++  LG+F FP+  + + W  I  A+
Sbjct:   63 RPRLVFHTQLAHGSSTEKIEGFTNVKELYAKIAEVFNISPTEILFCTLNTHKVDMQKLLGGQIGLEDFIFAHVRGETKEVEITKTEDALGLTITDNGAGYAFIKRIKEGSITDRL--KIVNVGDIIEAINDQTIVGCRHYEVAKMLRELPKSETFTLRLVHPKRAFDMIGQRGRSSKCSTESK--VSSGKETLRLRNKGMATVEEVPSEVEEEASCKVDDLLESYMGIRDVDLASTLVEIAKEKQNPEEFGRGLDSVLGEFAFPSEFVLEVWDAIHQAE 337          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Mouse
Match: Gipc1 (GIPC PDZ domain containing family, member 1 [Source:MGI Symbol;Acc:MGI:1926252])

HSP 1 Score: 276.559 bits (706), Expect = 3.302e-89
Identity = 134/276 (48.55%), Postives = 187/276 (67.75%), Query Frame = 2
Query:  194 FQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGGELR-PNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDAKAG 1018
            F  QLAHG PTG I  F N++ELYGKIA+ + +   E++FCTLNTHKVDMD+LLG  IGL+DFIF HVKGQRKE+++ KSE++LGLTITDNG G AFIKRI+  S I  +   LI +GD IE I+ +S +G RHY++A+ L+ +P G+ FT++L  P K+  +  +S+RS  G     P +  G+ T+R+ +      + + S  +E AIE +   +E  +GI D E+A T++E+GK  +NP E  E ++E LGDF FP+  ++D WG I DAK G
Sbjct:   60 FHTQLAHGSPTGRIEGFTNVKELYGKIAEAFRLPAAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSEEALGLTITDNGAGYAFIKRIKEGSVIDHI--QLISVGDMIEAINGQSLLGCRHYEVARLLKELPRGRTFTLKLTEPRKA--FDMISQRSAGGHPGSGPQLGTGRGTLRLRSRGPATVEDLPSAFEEKAIEKVDDLLESYMGIRDTELAATMVELGKDKRNPDELAEALDERLGDFAFPDEFVFDVWGAIGDAKVG 331          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Mouse
Match: Gipc3 (GIPC PDZ domain containing family, member 3 [Source:MGI Symbol;Acc:MGI:2387006])

HSP 1 Score: 237.269 bits (604), Expect = 2.476e-74
Identity = 115/281 (40.93%), Postives = 173/281 (61.57%), Query Frame = 2
Query:  170 AVHKSKFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGG-ELRPNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDA 1009
            A  + +  F+ QLAHG PTG I  F N+RELY KIA+ + I   EILFCTLN+HKVDM +LLG  IGL+DFIF HV+G+ KE+++ K+ED+LGLTITDNG G AFIKRI+  S I+++    + +GD IE I++ S VG RHY++AK LR +P  Q FT+RL+ P ++  +  + +RS      +   +  G++T+R+ +      +   S ++  A   +   +E  +GI D E+A  ++E  +       F   ++  LG+F FP+  + + W  I +A
Sbjct:   16 ARARPRLVFRTQLAHGSPTGRIEGFTNVRELYAKIAEAFGIAPTEILFCTLNSHKVDMQKLLGGQIGLEDFIFAHVRGETKEVEVTKTEDALGLTITDNGAGYAFIKRIKEGSIINRIEA--VCVGDSIEAINDHSIVGCRHYEVAKMLRELPKSQPFTLRLVQPRRA--FDMIGQRSRSSKCPVEAKVSSGRETLRLRSGGAATVEEAPSDVEAAAARRVDDLLESYMGIRDPELAAAVVETARSSAGAQAFARGLDAVLGEFAFPDEFVVEVWAAIGEA 292          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Mouse
Match: Gipc2 (GIPC PDZ domain containing family, member 2 [Source:MGI Symbol;Acc:MGI:1889209])

HSP 1 Score: 218.009 bits (554), Expect = 8.647e-67
Identity = 126/278 (45.32%), Postives = 174/278 (62.59%), Query Frame = 2
Query:  185 KFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGGELRPNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDAKAG 1018
            K  F  QLAHG  TG + +F +I ELY KIA  ++I   EILFCTLNT K+DM +LLG  +GL+DFIF HVKG +KE+++ KSEDSLGLTITDNG G AFIKRI+  S I  +    I +GDHIE I+ E+ VG RH+++AKKL+ +   + FT++LI P+K+     +  RS+ G      I   + T+R+ +      + + S     AI  +   +E  +GI D ++A T+ E GK   NP EF   ++E LGDF FP+  ++D WG I+D K G
Sbjct:   41 KLVFHAQLAHGSATGRVEDFSSISELYAKIAGVFEIAPSEILFCTLNTPKIDMGKLLGGQLGLEDFIFAHVKGTKKEVNVYKSEDSLGLTITDNGVGYAFIKRIKDGSTIDSVKT--ICVGDHIECINGENIVGWRHFEVAKKLKELKKEELFTLQLIEPKKA---FEIGPRSKAGKTSTEKIGTSRGTLRLRSKGPATVEELPSEAKAKAIGKVDDLLELYMGIRDIDLATTMFEAGKDKSNPDEFAVALDETLGDFAFPDEFLFDVWGAISDMKQG 313          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Mouse
Match: Gipc1 (GIPC PDZ domain containing family, member 1 [Source:MGI Symbol;Acc:MGI:1926252])

HSP 1 Score: 140.969 bits (354), Expect = 3.990e-40
Identity = 66/107 (61.68%), Postives = 85/107 (79.44%), Query Frame = 2
Query:  308 LFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIP 628
            +FCTLNTHKVDMD+LLG  IGL+DFIF HVKGQRKE+++ KSE++LGLTITDNG G AFIKRI+  S I  +   LI +GD IE I+ +S +G RHY++A+ L+ +P
Sbjct:    1 MFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSEEALGLTITDNGAGYAFIKRIKEGSVIDHI--QLISVGDMIEAINGQSLLGCRHYEVARLLKELP 105          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. UniProt/SwissProt
Match: sp|Q9Z254|GIPC1_RAT (PDZ domain-containing protein GIPC1 OS=Rattus norvegicus OX=10116 GN=Gipc1 PE=1 SV=2)

HSP 1 Score: 279.641 bits (714), Expect = 1.893e-89
Identity = 136/284 (47.89%), Postives = 190/284 (66.90%), Query Frame = 2
Query:  170 AVHKSKFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGGELR-PNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDAKAG 1018
            A  + +  F  QLAHG PTG I  F N++ELYGKIA+ + +   E++FCTLNTHKVDMD+LLG  IGL+DFIF HVKGQRKE+++ KSED+LGLTITDNG G AFIKRI+  S I  +   LI +GD IE I+ +S +G RHY++A+ L+ +P G+ FT++L  P K+  +  +S+RS  G     P +  G+ T+R+ +      + + S  +E AIE +   +E  +GI D E+A T++E+GK  +NP E  E ++E LGDF FP+  ++D WG I DAK G
Sbjct:   52 ASLRPRLVFHTQLAHGSPTGRIEGFTNVKELYGKIAEAFRLPAAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSEDALGLTITDNGAGYAFIKRIKEGSVIDHI--QLISVGDMIEAINGQSLLGCRHYEVARLLKELPRGRTFTLKLTEPRKA--FDMISQRSSGGHPGSGPQLGTGRGTLRLRSRGPATVEDLPSAFEEKAIEKVDDLLESYMGIRDTELAATMVELGKDKRNPDELAEALDERLGDFAFPDEFVFDVWGAIGDAKVG 331          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. UniProt/SwissProt
Match: sp|O14908|GIPC1_HUMAN (PDZ domain-containing protein GIPC1 OS=Homo sapiens OX=9606 GN=GIPC1 PE=1 SV=2)

HSP 1 Score: 277.33 bits (708), Expect = 1.469e-88
Identity = 135/276 (48.91%), Postives = 187/276 (67.75%), Query Frame = 2
Query:  194 FQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGGELR-PNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDAKAG 1018
            F  QLAHG PTG I  F N++ELYGKIA+ + +   E++FCTLNTHKVDMD+LLG  IGL+DFIF HVKGQRKE+++ KSED+LGLTITDNG G AFIKRI+  S I  +   LI +GD IE I+ +S +G RHY++A+ L+ +P G+ FT++L  P K+  +  +S+RS  G     P +  G+ T+R+ +      + + S  +E AIE +   +E  +GI D E+A T++E+GK  +NP E  E ++E LGDF FP+  ++D WG I DAK G
Sbjct:   60 FHTQLAHGSPTGRIEGFTNVKELYGKIAEAFRLPTAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSEDALGLTITDNGAGYAFIKRIKEGSVIDHI--HLISVGDMIEAINGQSLLGCRHYEVARLLKELPRGRTFTLKLTEPRKA--FDMISQRSAGGRPGSGPQLGTGRGTLRLRSRGPATVEDLPSAFEEKAIEKVDDLLESYMGIRDTELAATMVELGKDKRNPDELAEALDERLGDFAFPDEFVFDVWGAIGDAKVG 331          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. UniProt/SwissProt
Match: sp|Q9Z0G0|GIPC1_MOUSE (PDZ domain-containing protein GIPC1 OS=Mus musculus OX=10090 GN=Gipc1 PE=1 SV=1)

HSP 1 Score: 276.559 bits (706), Expect = 2.310e-88
Identity = 134/276 (48.55%), Postives = 187/276 (67.75%), Query Frame = 2
Query:  194 FQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGGELR-PNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDAKAG 1018
            F  QLAHG PTG I  F N++ELYGKIA+ + +   E++FCTLNTHKVDMD+LLG  IGL+DFIF HVKGQRKE+++ KSE++LGLTITDNG G AFIKRI+  S I  +   LI +GD IE I+ +S +G RHY++A+ L+ +P G+ FT++L  P K+  +  +S+RS  G     P +  G+ T+R+ +      + + S  +E AIE +   +E  +GI D E+A T++E+GK  +NP E  E ++E LGDF FP+  ++D WG I DAK G
Sbjct:   60 FHTQLAHGSPTGRIEGFTNVKELYGKIAEAFRLPAAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSEEALGLTITDNGAGYAFIKRIKEGSVIDHI--QLISVGDMIEAINGQSLLGCRHYEVARLLKELPRGRTFTLKLTEPRKA--FDMISQRSAGGHPGSGPQLGTGRGTLRLRSRGPATVEDLPSAFEEKAIEKVDDLLESYMGIRDTELAATMVELGKDKRNPDELAEALDERLGDFAFPDEFVFDVWGAIGDAKVG 331          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. UniProt/SwissProt
Match: sp|Q1JQD4|GIPC2_BOVIN (PDZ domain-containing protein GIPC2 OS=Bos taurus OX=9913 GN=GIPC2 PE=2 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 5.605e-75
Identity = 137/316 (43.35%), Postives = 196/316 (62.03%), Query Frame = 2
Query:   71 MPLFGKKKKEDSQKDI--LAHSDIXXXXXXXXXXGAVHKSKFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGGELRPNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDAK 1012
            MPL  ++KK+ + K+   L   + ++ +  S  +      +  F  QLAHG  TG +  F +I+ELY KIA  ++I   EIL+CTLNT KVDM +LLG+ IGL+DFIF H+KG +KE+++ KSEDSLGLTITDNG G AFIKRI+  S I  +    I +GDHIE I+ E+ VG RH+D+AKKL+ +   + FT+ LI P+K+    ++  RS+ G      I  G++T+R+ +      + + S   E AI  +   +E  +GI D ++A T+ E GK   NP EF   ++E LGDF FP+  ++D WGVI DAK
Sbjct:    1 MPLGLRRKKKFNTKETSRLVEGEHTDAAVRSLPSPPAPARRLVFHTQLAHGSATGRVENFSSIQELYAKIAGVFEIPPSEILYCTLNTPKVDMGKLLGAQIGLEDFIFAHIKGIKKEVNVYKSEDSLGLTITDNGAGYAFIKRIKDDSIIDSVKT--ICVGDHIEAINGENIVGWRHFDVAKKLKELKKEELFTLTLIEPKKA---FDMEPRSKAGKSSTGKIGTGRETLRLRSKGPATVEEVPSEAKEKAIGKVDDLLELYMGIRDTDLATTMFEAGKDKGNPDEFAVALDETLGDFAFPDEFVFDVWGVIGDAK 311          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. UniProt/SwissProt
Match: sp|Q8TF65|GIPC2_HUMAN (PDZ domain-containing protein GIPC2 OS=Homo sapiens OX=9606 GN=GIPC2 PE=1 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 1.041e-74
Identity = 137/316 (43.35%), Postives = 189/316 (59.81%), Query Frame = 2
Query:   65 ISMPLFGKKKKEDSQKDILAHSDIXXXXXXXXXXGAVHKSKFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGGELRPNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDAK 1012
            + + L GKKK +  +   L   + +     S +       +  F  QLAHG  TG +  F +I+ELY +IA  ++I   EIL+CTLNT K+DM+RLLG  +GL+DFIF HVKG  KE+++ KSEDSLGLTITDNG G AFIKRI+    I  +    I +GDHIE I+ E+ VG RHYD+AKKL+ +   + FTM+LI P+K+     +  RS+ G      I  G+ T+R+ +      + + S     AIE I   +E  +GI D ++A T+ E GK   NP EF   ++E LGDF FP+  ++D WGVI DAK
Sbjct:    1 MPLKLRGKKKAKSKETAGLVEGEPTGAGGGSLSASRAPARRLVFHAQLAHGSATGRVEGFSSIQELYAQIAGAFEISPSEILYCTLNTPKIDMERLLGGQLGLEDFIFAHVKGIEKEVNVYKSEDSLGLTITDNGVGYAFIKRIKDGGVIDSVKT--ICVGDHIESINGENIVGWRHYDVAKKLKELKKEELFTMKLIEPKKA---FEIELRSKAGKSSGEKIGCGRATLRLRSKGPATVEEMPSETKAKAIEKIDDVLELYMGIRDIDLATTMFEAGKDKVNPDEFAVALDETLGDFAFPDEFVFDVWGVIGDAK 311          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. TrEMBL
Match: A0A1I8GHQ3 (PDZ domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003091g1 PE=4 SV=1)

HSP 1 Score: 330.487 bits (846), Expect = 1.356e-106
Identity = 171/338 (50.59%), Postives = 228/338 (67.46%), Query Frame = 2
Query:   71 MPLFGKKKKEDSQKDILAHSD-----IXXXXXXXXXXGAV----------HKSKFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKR---SEYGGELRPNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDAKAGILTS 1030
            MPLFGKKKK D  K+   H+         ++++    GAV           + +++F CQLAHG PTGIIS F N++ELY KIA+CY+I   EI+FCTLNTHK+DMDRLLG  IGLDDF+F HVKGQ+KE+++ KSED+LGLTITDNG G AFIKRI+P S   ++    I  GDHIEKID ESFVG+RH+D+AK+L+ IP G  F +RLISPEKS  Y+NL  R     +       +  GKKTIR+ A     ++       ++AI+A++R +E  +GISD E+AQ I E+G+ + NP +F   ++ +LG+F FP+ L++DFWG I+DAKAG L S
Sbjct:    1 MPLFGKKKK-DGNKESPTHAQPSRDATQTSNASHKQAGAVPGSADESPESQRPQYNFHCQLAHGSPTGIISGFTNVKELYAKIAECYNIEPSEIIFCTLNTHKIDMDRLLGGQIGLDDFLFAHVKGQKKEVEVIKSEDALGLTITDNGAGFAFIKRIKPDSVADQVEH--ILPGDHIEKIDGESFVGKRHFDVAKRLKEIPYGATFVLRLISPEKS-PYANLQPRGGSRGHAAGAGGGLGSGKKTIRLKAKGAAVEEDAPDQAADVAIQAVNRLIEGLLGISDAELAQNIWELGQEIDNPHDFALAVDRDLGEFAFPDGLVFDFWGAISDAKAGRLKS 334          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. TrEMBL
Match: A0A1I8GC03 (PDZ domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 328.561 bits (841), Expect = 6.597e-106
Identity = 171/338 (50.59%), Postives = 228/338 (67.46%), Query Frame = 2
Query:   71 MPLFGKKKKEDSQKDILAHSD-----IXXXXXXXXXXGAV----------HKSKFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKR---SEYGGELRPNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDAKAGILTS 1030
            MPLFGKKKK D  K+   H+         +++T    GAV           + +++F CQLAHG PTGIIS F N++ELY KIA+CY+I   EI+FCTLNTHK+DMDRLLG  IGLDDF+F HVKGQ+KE+++ KS+D+LGLTITDNG G AFIKRI+P S   ++    I  GDHIEKID ESFVG+RH+D+AK+L+ IP G  F +RLISPEKS  Y+NL  R     +       +  GKKTIR+ A     ++       ++AI+A++R +E  +GISD E+AQ I E+G+ + NP +F   ++ +LG+F FP+ L++DFWG I+DAKAG L S
Sbjct:    1 MPLFGKKKK-DGNKESPTHAQPSRDATQTSNATHKQAGAVPGSADESPESQRPQYNFHCQLAHGSPTGIISGFTNVKELYAKIAECYNIEPSEIIFCTLNTHKIDMDRLLGGQIGLDDFLFAHVKGQKKEVEVIKSDDALGLTITDNGAGFAFIKRIKPDSVADQVEH--ILPGDHIEKIDGESFVGKRHFDVAKRLKEIPRGATFVLRLISPEKS-PYANLQPRGGSRGHAAGAGGGLGSGKKTIRLKAKGAAVEEDAPDQAADVAIQAVNRLIEGLLGISDAELAQNIWELGREIDNPHDFALAVDRDLGEFAFPDGLVFDFWGAISDAKAGRLKS 334          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. TrEMBL
Match: A0A267DBJ0 (PDZ domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009146g4 PE=4 SV=1)

HSP 1 Score: 301.212 bits (770), Expect = 4.993e-95
Identity = 167/343 (48.69%), Postives = 226/343 (65.89%), Query Frame = 2
Query:   71 MPLFGKKKKEDSQKDILAHSDIXXXXXXXXXXGAVH-----------------KSKFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGGELRP--------NIVKGKKTIRISANNVYEDDTITSTMDE---LAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDAKA 1015
            MPLFGKKK+E +Q+     +  + ++S ++ +   H                 + K++F CQLAHG PTGIIS F N++ELY KIA+CY+I   +I+FCTLNTHK++M+ LLG  IGLDDF+F H+KGQ+KEI++ KSED+LGLTITDNG G AFIKRI+  S I ++    I  GDHIEKID E+FVG+RH+D+AK+L+ IP G  F +RL+SPEKS  Y+NL+ RS  G    P         +  GKKTIR+ A             D+    AIEAI+R +E  +GISD E+AQ+I EIG+   NP EF   ++ +LG+F FP+ L++DFWG ++DAKA
Sbjct:    1 MPLFGKKKREITQESPSHQTSPTKSTSQNSNHNHGHGPTSPSKSKNQEYYDPPRPKYNFHCQLAHGSPTGIISGFTNVKELYAKIAECYNIESSDIIFCTLNTHKIEMEHLLGGQIGLDDFLFAHIKGQKKEIEVEKSEDALGLTITDNGAGYAFIKRIKAGSIIDRIDH--IQPGDHIEKIDGENFVGKRHFDVAKRLKEIPRGTTFVLRLVSPEKS-PYANLNPRS--GSRGHPAGGGGGGGGLGSGKKTIRLKARGGGGGGGEEDAPDQAAAAAIEAINRLIEGLLGISDAELAQSIWEIGQVAGNPHEFALMVDRDLGEFAFPDGLVFDFWGAVSDAKA 338          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. TrEMBL
Match: A0A267G0B1 (PDZ domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009146g5 PE=4 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 5.157e-95
Identity = 169/347 (48.70%), Postives = 223/347 (64.27%), Query Frame = 2
Query:   71 MPLFGKKKKEDSQKDIL--------------------AHSDIXXXXXXXXXXGAVHKSKFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGGELRP--------NIVKGKKTIRISANNVYEDDTITSTMDE---LAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDAKAG 1018
            MPLFGKKK+E +Q+                        H   S + S +       + K++F CQLAHG PTGIIS F N++ELY KIA+CY+I   +I+FCTLNTHK++M+ LLG  IGLDDF+F H+KGQ+KEI++ KSED+LGLTITDNG G AFIKRI+  S I ++    I  GDHIEKID E+FVG+RH+D+AK+L+ IP G  F +RL+SPEKS  Y+NL+ RS  G    P         +  GKKTIR+ A             D+    AIEAI+R +E  +GISD E+AQ+I EIG+   NP EF   ++ +LG+F FP+ L++DFWG ++DAKAG
Sbjct:    1 MPLFGKKKREITQESPSHQTSPTKSTSQNSNHNHGDHGHGPTSPSKSKNQEYYDPPRPKYNFHCQLAHGSPTGIISGFTNVKELYAKIAECYNIESSDIIFCTLNTHKIEMEHLLGGQIGLDDFLFAHIKGQKKEIEVEKSEDALGLTITDNGAGYAFIKRIKAGSIIDRIDH--IQPGDHIEKIDGENFVGKRHFDVAKRLKEIPRGTTFVLRLVSPEKS-PYANLNPRS--GSRGHPAGGGGGGGGLGSGKKTIRLKARGGGGGGGEEDAPDQAAAAAIEAINRLIEGLLGISDAELAQSIWEIGQAAGNPHEFALMVDRDLGEFAFPDGLVFDFWGAVSDAKAG 342          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. TrEMBL
Match: A0A267DBY7 (PDZ domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009146g3 PE=4 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 3.299e-94
Identity = 172/371 (46.36%), Postives = 229/371 (61.73%), Query Frame = 2
Query:   71 MPLFGKKKKEDSQKDIL--------------------AHSDIXXXXXXXXXXGAVHKSKFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGGELRP--------NIVKGKKTIRISANNVYEDDTITSTMDE---LAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDAKAGILTSYQDSASTIVTKLSLSSEPTE 1090
            MPLFGKKK+E +Q+                        H   S + S +       + K++F CQLAHG PTGIIS F N++ELY KIA+CY+I   +I+FCTLNTHK++M+ LLG  IGLDDF+F H+KGQ+KEI++ KS+D+LGLTITDNG G AFIKRI+  S I ++    I  GDHIEKID E+FVG+RH+D+AK+L+ IP G  F +RL+SPEKS  Y+NL+ RS  G    P         +  GKKTIR+ A             D+    AIEAI+R +E  +GISD E+AQ+I EIG+   NP EF   ++ +LG+F FP+ L++DFWG ++DAKAG +              S  +EP E
Sbjct:    1 MPLFGKKKREITQESPSHQTSPTKSTSQNSNHNHGDHGHDPTSPSKSKNQEYYDPPRPKYNFHCQLAHGSPTGIISGFTNVKELYAKIAECYNIESSDIIFCTLNTHKIEMEHLLGGQIGLDDFLFAHIKGQKKEIEVEKSDDALGLTITDNGAGYAFIKRIKAGSIIDRIDH--IQPGDHIEKIDGENFVGKRHFDVAKRLKEIPRGTTFVLRLVSPEKS-PYANLNPRS--GSRGHPAGGGGGGGGLGSGKKTIRLKARGGGGGGGEEDAPDQAAAAAIEAINRLIEGLLGISDAELAQSIWEIGQVAGNPHEFALMVDRDLGEFAFPDGLVFDFWGAVSDAKAGRIRPGSGGGGGRAPADSRKAEPEE 366          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Cavefish
Match: gipc1 (PDZ domain-containing protein GIPC1 [Source:NCBI gene;Acc:103024344])

HSP 1 Score: 272.322 bits (695), Expect = 1.440e-87
Identity = 131/280 (46.79%), Postives = 187/280 (66.79%), Query Frame = 2
Query:  179 KSKFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGGELRPNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDAKAG 1018
            + +  F  QLAHG PTG I  F N+RELY KI + + I   E++FCTLNTHKVDMD+LLG  IGL+DFIF HVKGQRKE+++ K ED+LGLTITDNG G AFIKRIR  S I ++   +I++GD IE I+ +  +G RHY++AK L+ +P G+ F ++L+ P K+  +  +S+R+         +  G+ T+R+ +      + + S  +E AIE +   +E  +GI D+E+A T++E+GK  +NP EF E ++E LGDF FP+  ++D WG I DAK G
Sbjct:   59 RPRLIFHTQLAHGSPTGRIEGFSNVRELYAKIGEAFGIPPAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKGEDALGLTITDNGAGYAFIKRIREGSIIHQI--QVINVGDMIESINGQILIGCRHYEVAKMLKELPRGKNFVLKLVEPLKA--FDMISQRTGGRSGSGVQLGTGRGTLRLRSKGPATVEELPSAFEEKAIEKVDDLLENYMGIRDSELAATMVELGKDKRNPDEFAEALDETLGDFAFPDEFVFDVWGAIGDAKVG 334          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Cavefish
Match: gipc3 (GIPC PDZ domain containing family member 3 [Source:NCBI gene;Acc:103042264])

HSP 1 Score: 270.396 bits (690), Expect = 9.362e-87
Identity = 130/278 (46.76%), Postives = 185/278 (66.55%), Query Frame = 2
Query:  185 KFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGGELRPNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDAKAG 1018
            +  F  QLAHG PTG I  F N++ELY KIA+ ++I   EILFCTLN+HKVDM +LLG  IGL+DFIF HV+G+ KE+++ K+ED+LGLTITDNG G AFIKRI+  S I +L    + +GDHIE I+++S VG RHY++AK L+  P G+ FT+RL+ P+K+  +  + +R+         +V GK+T+R+ +        + S  +E AI+ +   +E  +GI D E+A TI+E GK  KNP +F E ++  LGDF FP+  ++D WG + D K G
Sbjct:   63 RLVFHTQLAHGSPTGRIHGFTNVKELYAKIAEVFEISPSEILFCTLNSHKVDMQKLLGGQIGLEDFIFAHVRGETKEVEVTKTEDALGLTITDNGAGYAFIKRIKEGSTIDQLKS--VCVGDHIEAINDQSIVGCRHYEVAKMLKEQPRGEPFTLRLVGPKKA--FDMIGQRTRAPKSSEGKMVSGKETLRLRSKGTATVQEVPSEFEEKAIKKVDDLLESYMGIRDPELATTIVEAGKDKKNPDDFAEALDSVLGDFAFPDVFLFDVWGALGDVKNG 336          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Cavefish
Match: gipc2 (GIPC PDZ domain containing family member 2 [Source:NCBI gene;Acc:103027012])

HSP 1 Score: 257.299 bits (656), Expect = 8.074e-82
Identity = 127/281 (45.20%), Postives = 186/281 (66.19%), Query Frame = 2
Query:  179 KSKFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKS-GIYSNLSKRSEYGGELRPNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDAKAG 1018
            + +  F  QLAHG  TG I  F N++ELY KIA+ + I   EILFCTLNTHK+DM++LLG  IGL+DFIF HVKG +KE+++ K+ED+LGLTITDNG G AFIKRI+  S +   G  +I +GDHIE I+ ++ VG RHY++A+ L+ +P  + FT++L+ P K+  +    SK  + GGE +  I  GK T+R+ +      + + +  +E A++ +   +E  +GI D E++ T++E+G+   NP EF   ++E LGDF FP+  ++D WG I DAK G
Sbjct:   47 RPRLVFHTQLAHGSATGRIEGFSNVKELYSKIAEAFSIQPTEILFCTLNTHKIDMEKLLGGQIGLEDFIFAHVKGIKKEVEVFKAEDALGLTITDNGAGYAFIKRIKEGSVVD--GVKVICVGDHIECINGQNIVGTRHYEVARMLKDLPKDKPFTLKLVEPMKAFDMLEPRSKGGKPGGENK--IGTGKGTLRLRSKGPATVEDMPTEFEEKAVKKVDDLLESYMGIRDTELSATMVEVGRDKVNPDEFAMALDEALGDFAFPDEFVFDVWGAIGDAKQG 323          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Nematostella
Match: EDO45145 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTU0])

HSP 1 Score: 244.588 bits (623), Expect = 8.876e-78
Identity = 121/285 (42.46%), Postives = 180/285 (63.16%), Query Frame = 2
Query:  185 KFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGGE-------LRPNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDAKAG 1018
            +F F CQLAHG  T  +  F N+++LY KIAD + + +++ILFCTLNT++VDM+RLLG  IGLDDFIF H+KGQ+K +++ K + +LGLTITDNG G AF+KRI+  S   K  Q  I IGDH+E I+ +  VG RH+D+A+ LR + +    T+ L+ P +   +  +  R+   G+           I  GK T+R+ A      + ITST + +A++ +   +E  +GI D E+A T++++ K   NPS+F   ++E   DF FP+  I+D WG+I DA+AG
Sbjct:   11 RFVFHCQLAHGSTTAKVEGFTNVKQLYQKIADAFHVNVDDILFCTLNTYRVDMERLLGGQIGLDDFIFAHIKGQKKIVEVVKDQPALGLTITDNGAGCAFVKRIKEGSIADKTPQ--ICIGDHVEYINGQYVVGSRHFDVARMLREVDVTGTITLHLVEPLRG--FGAIGPRTASRGQSTEEPVNAEKKIGTGKATLRLKAKGPPVVEEITSTWECVAMKKVDDLLENFLGIRDEELANTLVDLSKNKTNPSDFAMNVDENFSDFQFPDDFIFDIWGLINDARAG 291          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Medaka
Match: gipc1 (PDZ domain-containing protein GIPC1 [Source:NCBI gene;Acc:101163009])

HSP 1 Score: 271.937 bits (694), Expect = 4.348e-85
Identity = 136/281 (48.40%), Postives = 190/281 (67.62%), Query Frame = 2
Query:  179 KSKFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGGELRPNIVK---GKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDAK 1012
            + +  F  QLAHG PTG I  F N+RELY KI + + I   E++FCTLNTHKVDMD+LLG  IGL+DFIF HVKGQ+KEI++ K ED+LGLTITDNG G AFIKRIR  S I ++   +I++GD IE I+    +G RHY++AK L+ +P G+ FT++L+ P K+  +  +S+RS  GG    + V+   G+ T+R+ +      + + S  +E AIE +   +E  +GI D+E+A T++E+GK  KNP EF E ++E LGDF FP+  ++D WG I DAK
Sbjct:   59 RPRLIFHTQLAHGSPTGRIEGFSNVRELYAKIGEAFGIPASEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQKKEIEVFKGEDALGLTITDNGAGYAFIKRIREGSIIHQI--QVINVGDMIESINGHRLIGCRHYEVAKMLKELPRGKMFTIKLVEPLKA--FDMISQRS--GGSRSASGVQLGTGRGTLRLRSKGPATVEELPSAFEEKAIEKVDDLLESYMGIRDSELAATMVELGKDKKNPDEFAEALDETLGDFAFPDEFVFDVWGAIGDAK 333          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Medaka
Match: gipc2 (GIPC PDZ domain containing family member 2 [Source:NCBI gene;Acc:101173170])

HSP 1 Score: 261.151 bits (666), Expect = 2.792e-83
Identity = 130/281 (46.26%), Postives = 187/281 (66.55%), Query Frame = 2
Query:  179 KSKFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGGELRPN-IVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDAKAG 1018
            + K  F  QLAHG PTG I  F N++ELYGKIAD +++   EI+FCTLNTHK+DM++LLG  IGL+DFIF H+KG +KE+++ KSED+LGLTITDNG G AFIKRI+  S   ++   LI +GDHIE I+ ++ +G RHY++A+ L+ +P  + FT++L+ P K+  +  L  RS+       N I  GK T+R+ +      +   +  +E AI+ +   +E  +GI D E+A T++E+G+  KNP EF   ++E LGDF FP+  ++D WG I DAK G
Sbjct:   50 RPKLVFHTQLAHGSPTGRIEGFTNVKELYGKIADAFNLSPPEIMFCTLNTHKIDMEKLLGGQIGLEDFIFAHIKGIKKEVEVFKSEDALGLTITDNGAGYAFIKRIKEGSVADRV--KLICVGDHIECINGQNILGTRHYEVARMLKDLPKDKPFTLKLVEPMKA--FDMLEPRSKGAKPANDNKIGNGKGTLRLRSKGPATVEEEPTEFEEKAIKKVDDLLESYMGIRDTELAATMVEVGRDKKNPDEFAMALDETLGDFAFPDEFVFDVWGAIGDAKQG 326          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Medaka
Match: gipc3 (GIPC PDZ domain containing family member 3 [Source:NCBI gene;Acc:101174657])

HSP 1 Score: 258.455 bits (659), Expect = 2.888e-82
Identity = 126/282 (44.68%), Postives = 183/282 (64.89%), Query Frame = 2
Query:  179 KSKFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGGELRPNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGVITDAKAGIL 1024
            + +  F  QLAHG PTG I  F N++ELY KIA+ ++I   EILFCTLN+HKVDM +LLG  IGL+DFIF HV+G+ KE+++ K+ED+LGLTITDNG G AFIKRI+  S I +L    + +GDHIE I+++S VG RHY++AK L+  P    FT+RL+ P+K+  +  +  R++        +  G++T+R+ +        + +  +E A + +   +E  +GI D E+A TI+E GK  K+P +F E ++  LGDF FP+  ++D WG I D K G L
Sbjct:   57 RPRLIFHTQLAHGSPTGRIHGFTNVKELYAKIAEVFNISPSEILFCTLNSHKVDMQKLLGGQIGLEDFIFAHVRGETKEVEVTKTEDALGLTITDNGAGYAFIKRIKEGSTIDQL--KTVCVGDHIEAINDQSIVGCRHYEVAKMLKEQPRSIPFTLRLVEPKKA--FDMIGMRTKAPKSNEGKMANGRETLRLRSKGAATVQEVQNEFEEQATKKVDDLLESYMGIRDVELATTIVEAGKDKKSPDDFAEALDSVLGDFAFPDVFMFDVWGAIRDVKNGKL 334          
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Planmine SMEST
Match: SMESG000012225.1 (SMESG000012225.1)

HSP 1 Score: 608.986 bits (1569), Expect = 0.000e+0
Identity = 307/309 (99.35%), Postives = 308/309 (99.68%), Query Frame = 2
Query:   71 MPLFGKKKKEDSQKDILAHSDIXXXXXXXXXXGAVHKSKFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGGELRPNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGV 997
            MPLFGKKKKEDSQKDILAHSDISNNSSTSTTNGAVHKSKFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCK+EDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGGELRPNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWG 
Sbjct:    1 MPLFGKKKKEDSQKDILAHSDISNNSSTSTTNGAVHKSKFSFQCQLAHGGPTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIGLDDFIFVHVKGQRKEIDLCKTEDSLGLTITDNGTGRAFIKRIRPSSQISKLGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEKSGIYSNLSKRSEYGGELRPNIVKGKKTIRISANNVYEDDTITSTMDELAIEAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPNSLIYDFWGC 309          
The following BLAST results are available for this feature:
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GIPC13.058e-8948.91GIPC PDZ domain containing family member 1 [Source... [more]
GIPC13.058e-8948.91GIPC PDZ domain containing family member 1 [Source... [more]
GIPC13.058e-8948.91GIPC PDZ domain containing family member 1 [Source... [more]
GIPC22.167e-7543.35GIPC PDZ domain containing family member 2 [Source... [more]
GIPC38.963e-7543.07GIPC PDZ domain containing family member 3 [Source... [more]
back to top
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gipc-11.690e-4932.27GIPC (RGS-GAIP Interacting Protein C) homolog [So... [more]
gipc-23.125e-4933.69GIPC (RGS-GAIP Interacting Protein C) homolog [So... [more]
back to top
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kermit7.026e-8447.22gene:FBgn0010504 transcript:FBtr0339296[more]
kermit7.026e-8447.22gene:FBgn0010504 transcript:FBtr0088812[more]
kermit7.026e-8447.22gene:FBgn0010504 transcript:FBtr0088813[more]
kermit7.026e-8447.22gene:FBgn0010504 transcript:FBtr0088814[more]
kermit7.026e-8447.22gene:FBgn0010504 transcript:FBtr0088811[more]
back to top
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gipc33.947e-8746.81GIPC PDZ domain containing family, member 3 [Sourc... [more]
gipc12.711e-8546.07GIPC PDZ domain containing family, member 1 [Sourc... [more]
gipc23.732e-8445.10GIPC PDZ domain containing family, member 2 [Sourc... [more]
back to top
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slc4a71.248e-8948.93solute carrier family 4, sodium bicarbonate cotran... [more]
slc4a71.454e-8948.93solute carrier family 4, sodium bicarbonate cotran... [more]
gipc16.620e-8244.93GIPC PDZ domain containing family member 1 [Source... [more]
gipc31.777e-7041.94GIPC PDZ domain containing family member 3 [Source... [more]
back to top
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Gipc13.302e-8948.55GIPC PDZ domain containing family, member 1 [Sourc... [more]
Gipc32.476e-7440.93GIPC PDZ domain containing family, member 3 [Sourc... [more]
Gipc28.647e-6745.32GIPC PDZ domain containing family, member 2 [Sourc... [more]
Gipc13.990e-4061.68GIPC PDZ domain containing family, member 1 [Sourc... [more]
back to top
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Z254|GIPC1_RAT1.893e-8947.89PDZ domain-containing protein GIPC1 OS=Rattus norv... [more]
sp|O14908|GIPC1_HUMAN1.469e-8848.91PDZ domain-containing protein GIPC1 OS=Homo sapien... [more]
sp|Q9Z0G0|GIPC1_MOUSE2.310e-8848.55PDZ domain-containing protein GIPC1 OS=Mus musculu... [more]
sp|Q1JQD4|GIPC2_BOVIN5.605e-7543.35PDZ domain-containing protein GIPC2 OS=Bos taurus ... [more]
sp|Q8TF65|GIPC2_HUMAN1.041e-7443.35PDZ domain-containing protein GIPC2 OS=Homo sapien... [more]
back to top
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GHQ31.356e-10650.59PDZ domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8GC036.597e-10650.59PDZ domain-containing protein OS=Macrostomum ligna... [more]
A0A267DBJ04.993e-9548.69PDZ domain-containing protein OS=Macrostomum ligna... [more]
A0A267G0B15.157e-9548.70PDZ domain-containing protein OS=Macrostomum ligna... [more]
A0A267DBY73.299e-9446.36PDZ domain-containing protein OS=Macrostomum ligna... [more]
back to top
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gipc11.440e-8746.79PDZ domain-containing protein GIPC1 [Source:NCBI g... [more]
gipc39.362e-8746.76GIPC PDZ domain containing family member 3 [Source... [more]
gipc28.074e-8245.20GIPC PDZ domain containing family member 2 [Source... [more]
back to top
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO451458.876e-7842.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gipc14.348e-8548.40PDZ domain-containing protein GIPC1 [Source:NCBI g... [more]
gipc22.792e-8346.26GIPC PDZ domain containing family member 2 [Source... [more]
gipc32.888e-8244.68GIPC PDZ domain containing family member 3 [Source... [more]
back to top
BLAST of Solute carrier family 4, sodium bicarbonate cotransporter, member 7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000012225.10.000e+099.35SMESG000012225.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013973 ID=SMED30013973|Name=Solute carrier family 4, sodium bicarbonate cotransporter, member 7|organism=Schmidtea mediterranea sexual|type=transcript|length=1440bp
TGATTACCTTGTAAACAGTAGTCATTTTAAATTAATTGGAAATTTTATTG
TGAATTAGTAAACAATTTCAATGCCACTTTTTGGCAAAAAAAAGAAAGAA
GACTCACAGAAAGATATTTTAGCTCATTCAGACATTTCAAATAACTCATC
TACATCTACAACAAACGGTGCTGTTCATAAATCAAAGTTTTCATTTCAAT
GTCAATTGGCCCATGGCGGCCCCACTGGAATTATAAGTGAATTTAAAAAT
ATAAGGGAATTATATGGTAAAATTGCCGACTGTTATGACATTATGATGGA
AGAAATTCTCTTCTGCACTCTAAATACTCATAAAGTAGATATGGACCGTC
TGTTAGGATCTCATATAGGTTTAGATGATTTCATTTTTGTTCATGTCAAA
GGACAAAGAAAAGAAATTGATCTATGCAAATCGGAAGATTCGCTGGGTTT
GACTATCACTGACAATGGAACCGGCAGGGCATTCATTAAACGAATTCGTC
CGTCGAGTCAAATTAGTAAACTTGGTCAGGGATTAATAGATATTGGAGAT
CACATTGAAAAAATTGATAACGAATCTTTTGTTGGTAGGCGTCATTATGA
CATCGCTAAGAAACTTAGATCAATTCCTCTTGGTCAAAAGTTTACAATGA
GACTTATCTCACCGGAAAAGTCAGGAATATACAGTAATCTGTCCAAAAGA
TCAGAATATGGTGGAGAACTTAGGCCAAATATAGTTAAAGGAAAAAAGAC
TATTCGGATTAGTGCAAATAATGTATACGAAGATGATACTATAACATCTA
CAATGGATGAATTAGCAATTGAGGCTATTTCGCGGCATGTTGAAAAGGCA
ATTGGAATATCAGACAATGAAATGGCGCAAACGATTCTCGAAATTGGAAA
GCGAGTAAAAAATCCGTCTGAATTTATAGAAGAAATGAATGAAGAACTCG
GAGATTTTGGGTTTCCAAATAGTTTGATCTACGATTTCTGGGGTGTAATT
ACCGATGCTAAGGCTGGGATTTTGACTTCATATCAAGATAGCGCATCAAC
TATCGTTACCAAATTGTCATTGTCTAGCGAACCGACAGAAATTTATTTTG
AAGATCGACTGTAGGGAATATCTATCTACGATTCTGACTGGTTTTCTTTC
ACATATCACTATGATAGGCACTTTCCATGGCTTTTTGTTTTTGCTTTTTT
ATTTATGTTCTTTACAAGCACAGAAATCTATATTTTATTAGAGCACATTC
TTGGTTCAATATCTCTTATGAAACTATTCATAGCTCAATGATAAATTGTT
TGGTTTTCAATAACCTAACGAAACAAAATTGTTGAAATACGGTTTTTTCA
TAAAAATTATCAATATTGGTTTTTTGCTATTCAATAAGTTACAAAGTTAG
TCAATGTTGTCCTTGAAATTATTTGTCCCGTGGTCGATAA
back to top

protein sequence of SMED30013973-orf-1

>SMED30013973-orf-1 ID=SMED30013973-orf-1|Name=SMED30013973-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=348bp
MPLFGKKKKEDSQKDILAHSDISNNSSTSTTNGAVHKSKFSFQCQLAHGG
PTGIISEFKNIRELYGKIADCYDIMMEEILFCTLNTHKVDMDRLLGSHIG
LDDFIFVHVKGQRKEIDLCKSEDSLGLTITDNGTGRAFIKRIRPSSQISK
LGQGLIDIGDHIEKIDNESFVGRRHYDIAKKLRSIPLGQKFTMRLISPEK
SGIYSNLSKRSEYGGELRPNIVKGKKTIRISANNVYEDDTITSTMDELAI
EAISRHVEKAIGISDNEMAQTILEIGKRVKNPSEFIEEMNEELGDFGFPN
SLIYDFWGVITDAKAGILTSYQDSASTIVTKLSLSSEPTEIYFEDRL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: biological process
TermDefinition
GO:0035725sodium ion transmembrane transport
GO:0006605protein targeting
GO:0007268chemical synaptic transmission
GO:0014047glutamate secretion
GO:0030511positive regulation of transforming growth factor beta receptor signaling pathway
GO:0031647regulation of protein stability
GO:0032435negative regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0032467positive regulation of cytokinesis
GO:0043542endothelial cell migration
GO:0048167regulation of synaptic plasticity
Vocabulary: INTERPRO
TermDefinition
IPR001478PDZ
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003779actin binding
GO:0005102signaling receptor binding
GO:0017022myosin binding
GO:0030165PDZ domain binding
GO:0042803protein homodimerization activity
GO:0045296cadherin binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005903brush border
GO:0005938cell cortex
GO:0008021synaptic vesicle
GO:0012506vesicle membrane
GO:0016020membrane
GO:0030139endocytic vesicle
GO:0031410cytoplasmic vesicle
GO:0043197dendritic spine
GO:0043198dendritic shaft
GO:0070062extracellular exosome