Plexin-B2

Overview
NamePlexin-B2
Smed IDSMED30013972
Length (bp)1703
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Plexin-B2 (SMED30013972) t-SNE clustered cells

Violin plots show distribution of expression levels for Plexin-B2 (SMED30013972) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Plexin-B2 (SMED30013972) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Plexin-B2 (SMED30013972) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013972

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30013972SMESG000033322.1 SMESG000033300.1 dd_Smed_v4_13016_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Plexin-B2 vs. Ensembl Human
Match: PLXNB2 (plexin B2 [Source:HGNC Symbol;Acc:HGNC:9104])

HSP 1 Score: 89.7373 bits (221), Expect = 6.221e-18
Identity = 96/379 (25.33%), Postives = 160/379 (42.22%), Query Frame = 3
Query:  510 LEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNKTFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQ---SRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETK--YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSLSISQQ-TKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQL---WKRFLENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFL 1619
            + V VL+ D+ISQVK+KIID+           VY  +          + LE     T   L D D T+     +  VNT+ HYN+  G  L LS+   S+  ED S ++L  E                                    H+++E  N+   ++ L+     +D   S    S+ E ER +     Y  + ++ K T  ++VDN   S     H+           + F  LD+  +  +I  + T  +WKT    L+ WVN++KN  FIF     + V   L  IA+  M++C+RT +K S +      K L+ KEI  + ++   + + +   V  +D+ M   + ++++ +   +  +N L  LH L
Sbjct: 1477 IPVKVLNCDTISQVKEKIIDQ-----------VYRGQPCSCWPRPDSVVLEWRPGSTAQILSDLDLTSQREGRWKRVNTLMHYNVRDGATLILSKVGVSQQPED-SQQDLPGER-----------------------------------HALLEEENR---VWHLVRPTDEVDEGKSKR-GSVKEKERTKAITEIYLTRLLSVKGTLQQFVDNFFQSVLAPGHA-----VPPAVKYFFDFLDEQAEKHNIQDEDTIHIWKTNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSVIAQTFMDACTRTEHKLSRDSP--SNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAH---TDSLNTLVALHQL 1794          
BLAST of Plexin-B2 vs. Ensembl Human
Match: PLXNB2 (plexin B2 [Source:HGNC Symbol;Acc:HGNC:9104])

HSP 1 Score: 89.7373 bits (221), Expect = 6.221e-18
Identity = 96/379 (25.33%), Postives = 160/379 (42.22%), Query Frame = 3
Query:  510 LEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNKTFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQ---SRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETK--YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSLSISQQ-TKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQL---WKRFLENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFL 1619
            + V VL+ D+ISQVK+KIID+           VY  +          + LE     T   L D D T+     +  VNT+ HYN+  G  L LS+   S+  ED S ++L  E                                    H+++E  N+   ++ L+     +D   S    S+ E ER +     Y  + ++ K T  ++VDN   S     H+           + F  LD+  +  +I  + T  +WKT    L+ WVN++KN  FIF     + V   L  IA+  M++C+RT +K S +      K L+ KEI  + ++   + + +   V  +D+ M   + ++++ +   +  +N L  LH L
Sbjct: 1477 IPVKVLNCDTISQVKEKIIDQ-----------VYRGQPCSCWPRPDSVVLEWRPGSTAQILSDLDLTSQREGRWKRVNTLMHYNVRDGATLILSKVGVSQQPED-SQQDLPGER-----------------------------------HALLEEENR---VWHLVRPTDEVDEGKSKR-GSVKEKERTKAITEIYLTRLLSVKGTLQQFVDNFFQSVLAPGHA-----VPPAVKYFFDFLDEQAEKHNIQDEDTIHIWKTNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSVIAQTFMDACTRTEHKLSRDSP--SNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAH---TDSLNTLVALHQL 1794          
BLAST of Plexin-B2 vs. Ensembl Human
Match: PLXNA3 (plexin A3 [Source:HGNC Symbol;Acc:HGNC:9101])

HSP 1 Score: 78.9518 bits (193), Expect = 1.506e-14
Identity = 87/382 (22.77%), Postives = 161/382 (42.15%), Query Frame = 3
Query:  516 VDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNK-TFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETKYSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKIS-DFLFTLLDDIGDSLSISQ-QTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRF---LENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFLSSSMSQKI 1643
            V VL+ DSI+Q K K++D            VY+           ++ LE    + T + L+D D T     ++  +N++ HY +  G L+ L   +     S   + N F + +  +  +  L    S  D  +  A +        I       + L+ L+      D    G   S M +E      Y  + +  K T  ++VD++  +     H G+    L ++  ++F  LD+  D   IS    +  WK+ C  L+ WVN+IKN  F+F   K+      L  +A+  M+SCS + ++   +      K L+ K+I N+    +R+   +      +D+ M   + + ++ +  +   ++AL  L+F  +   Q+I
Sbjct: 1495 VKVLNCDSITQAKDKLLD-----------TVYKGIPYSQRPKAEDMDLEWRQGRMTRIILQDEDVTTKIECDWKRLNSLAHYQVTDGSLVALVPKQV----SAYNMANSF-TFTRSLSRYESLLRTASSPDSLRSRAPM--------ITPDQETGTKLWHLVKNHDHADHR-EGDRGSKMVSE-----IYLTRLLATKGTLQKFVDDLFETVFSTAHRGS---ALPLAIKYMFDFLDEQADQRQISDPDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHRLGKDSP--SNKLLYAKDIPNYKSWVERYYRDIAKMASISDQDMDAYLVEQSRLHASDFSVLSALNELYFYVTKYRQEI 1841          
BLAST of Plexin-B2 vs. Ensembl Human
Match: PLXNA1 (plexin A1 [Source:HGNC Symbol;Acc:HGNC:9099])

HSP 1 Score: 73.1738 bits (178), Expect = 9.137e-13
Identity = 94/397 (23.68%), Postives = 164/397 (41.31%), Query Frame = 3
Query:  480 IRPMEIDIHNLEVDVLSLDSISQVKQKIIDKAIVKHDETYTNV-YEYESTIASIDHREISLECFLNK-TFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNE--FASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETKYSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKIS-DFLFTLLDDIGDSLSI-SQQTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRFLENSVHANDEKMILIMTDLTKKYF-----LNSYKINALKNLHFLSSSMSQ 1637
            + P   +   + V  L  D+++Q K+K++D A       Y  V Y      A +D     LE    +   + L+D D T     ++  +NT+ HY +  G  + L   +T    S   ++N   F  S  R   +  +    S  D  +    +         +ES  K   L+ L+     LD    G   S M +E      Y  + +  K T  ++VD++  +     H G+    L ++  ++F  LD+  D   I     +  WK+ C  L+ WVN+IKN  F+F   K+      L  +A+  M+SCS + +K   +      K L+ K+I N+    +R+     +A+  KM  I       Y      L+  + N++  LH + S +++
Sbjct: 1508 VNPENENAPEVPVKGLDCDTVTQAKEKLLDAA-------YKGVPYSQRPKAADMD-----LEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQT----SAYNISNSSTFTKSLSR---YESMLRTASSPDSLRSRTPMITPD-----LESGTK---LWHLVKNHDHLDQR-EGDRGSKMVSE-----IYLTRLLATKGTLQKFVDDLFETIFSTAHRGS---ALPLAIKYMFDFLDEQADKHQIHDADVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHKLGKDSP--SNKLLYAKDIPNYKSWVERY-----YADIAKMPAISDQDMSAYLAEQSRLHLSQFNSMSALHEIYSYITK 1861          
BLAST of Plexin-B2 vs. Ensembl Human
Match: PLXNB3 (plexin B3 [Source:HGNC Symbol;Acc:HGNC:9105])

HSP 1 Score: 70.0922 bits (170), Expect = 9.568e-12
Identity = 83/393 (21.12%), Postives = 160/393 (40.71%), Query Frame = 3
Query:  498 DIHNLEVDVLSLDSISQVKQKIIDKA-----IVKHDETYTNVYEYESTIASIDHREISLECFLNKTFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETK-----YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKIS-------DFLFTLLDDIGDSLSISQQ-TKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRF---LENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLH 1613
            ++  +   VL  D+I+QVK+K++D+        +    +    E+ S +A                 ++L D D T+ T  ++  +NT++HY +  G  + L     R            ++ S  +     L  NI                   ++ +      CL+ L+  K + +P  + +  S +        K     Y  + ++ K T  ++VD+            TF   L ++        +LF LLD++ +   I    T  +WKT   +L+ WVN +KN   IF    S +V   L  IA+  ++SC+ + +K   +      K L+ +EI  + Q+ +R+   +  S  A+ ++M   + +L+  Y    + + AL+ L+
Sbjct: 1534 EMQRVPARVLDTDTITQVKEKVLDQVYKGTPFSQRPSVHALDLEWRSGLAG---------------HLTLSDEDLTSVTQNHWKRLNTLQHYKVPDGATVGLVPQLHRG-----------STISQSLAQRCPLGENIP------------------TLEDGEEGGVCLWHLV--KATEEPEGAKVRCSSLREREPARAKAIPEIYLTRLLSMKGTLQKFVDD------------TFQAILSVNRPIPIAVKYLFDLLDELAEKHGIEDPGTLHIWKTNSLLLRFWVNALKNPQLIFDVRVSDNVDAILAVIAQTFIDSCTTSEHKVGRDSPVN--KLLYAREIPRYKQMVERYYADIRQSSPASYQEMNSALAELSGNYTSAPHCLEALQELY 1866          
BLAST of Plexin-B2 vs. Ensembl Celegans
Match: plx-1 (PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90])

HSP 1 Score: 64.6994 bits (156), Expect = 1.466e-10
Identity = 72/303 (23.76%), Postives = 138/303 (45.54%), Query Frame = 3
Query:  504 HNLEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNKTFVSLKDFDSTNNT-FKNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETK-YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSLSIS-QQTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCS 1403
             ++ V VL  D+I+QVK+K +D             Y +    A  D  E+  +  +N   ++L+D DS++     N+  +NT+ HYN+ +  +L L+ S++   +++  L++     S++  V ++ P   S K      + +    A H+   +   N   F L    K  +       H   +++ +  T+ Y  + +  K T  +++ ++L S      S T    +K   ++F  +D+      I+  +    WK+    L+ WVNLIKN  F+F  +K   +   L  +A+ LM++CS
Sbjct:  768 QDIPVRVLDCDTITQVKEKCLDAKY--------RGYRFADRPAPGDM-ELEWKTGMNGK-MALQDIDSSSRVEGGNWKRLNTLAHYNVPNNAILTLT-SKSNSLYNLSILSDR----SEKSSVSMKTPGVGSPKPWGAPPSVI----ADHASSSADTDNG--FKLYHLVKPTE-------HGPTDSQEKMVTEIYLTRLLMMKGTLAKFITSLLESI---FSSSTVPPCIK---YMFDFMDEQAREHGINDPEVVHAWKSNALPLRFWVNLIKNPHFLFDIQKPTKIEGCLSVVAQTLMDACS 1036          
BLAST of Plexin-B2 vs. Ensembl Celegans
Match: plx-1 (PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90])

HSP 1 Score: 62.7734 bits (151), Expect = 5.427e-10
Identity = 75/312 (24.04%), Postives = 134/312 (42.95%), Query Frame = 3
Query:  504 HNLEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNKTFVSLKDFDSTNNT-FKNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISG--LFHSIMETERREETK--------YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSLSIS-QQTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCS 1403
             ++ V VL  D+I+QVK+K +D             Y +    A  D  E+  +  +N   ++L+D DS++     N+  +NT+ HYN+ +  +L L    T +  S+  L N F+S+S +    +         DR + ++   K     S        S +    ++    D   +G  L+H +  TE              Y  + +  K T  +++ ++L S      S T    +K   ++F  +D+      I+  +    WK+    L+ WVNLIKN  F+F  +K   +   L  +A+ LM++CS
Sbjct:  768 QDIPVRVLDCDTITQVKEKCLDAKY--------RGYRFADRPAPGDM-ELEWKTGMNGK-MALQDIDSSSRVEGGNWKRLNTLAHYNVPNNAILTL----TSKSNSLYNLVN-FSSTSMKTASILS--------DRSEKSSVSMKTPGVGSPKPWGAPPSVIADHASSSADTD---NGFKLYHLVKPTEHGPTDSQEKMVTEIYLTRLLMMKGTLAKFITSLLESI---FSSSTVPPCIK---YMFDFMDEQAREHGINDPEVVHAWKSNALPLRFWVNLIKNPHFLFDIQKPTKIEGCLSVVAQTLMDACS 1047          
BLAST of Plexin-B2 vs. Ensembl Celegans
Match: plx-1 (PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90])

HSP 1 Score: 60.077 bits (144), Expect = 3.678e-9
Identity = 78/333 (23.42%), Postives = 147/333 (44.14%), Query Frame = 3
Query:  504 HNLEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNKTFVSLKDFDSTNNT-FKNYILVNTMKHYNI-NSGQLLFLSQSRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETK-YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSLSISQ-QTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQL 1490
             ++ V VL  D+I+QVK+K +D             Y +    A  D  E+  +  +N   ++L+D DS++     N+  +NT+ HYN+ N+  L   S+S +  + S+       +  S++  V ++ P   S K      + +    A H+   +   N   F L    K  +       H   +++ +  T+ Y  + +  K T  +++ ++L S      S T    +K   ++F  +D+      I+  +    WK+    L+ WVNLIKN  F+F  +K   +   L  +A+ LM++CS   ++ + +      K LF K++  +  L
Sbjct: 1350 QDIPVRVLDCDTITQVKEKCLDAKY--------RGYRFADRPAPGD-MELEWKTGMNGK-MALQDIDSSSRVEGGNWKRLNTLAHYNVPNNAILTLTSKSNSLYNLSI------LSDRSEKSSVSMKTPGVGSPKPWGAPPSVI----ADHASSSADTDNG--FKLYHLVKPTE-------HGPTDSQEKMVTEIYLTRLLMMKGTLAKFITSLLESI---FSSSTVPPCIK---YMFDFMDEQAREHGINDPEVVHAWKSNALPLRFWVNLIKNPHFLFDIQKPTKIEGCLSVVAQTLMDACSTQDHQLTKDSP--SSKLLFAKDMYQYRDL 1645          
BLAST of Plexin-B2 vs. Ensembl Celegans
Match: plx-1 (PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90])

HSP 1 Score: 60.077 bits (144), Expect = 3.732e-9
Identity = 78/333 (23.42%), Postives = 147/333 (44.14%), Query Frame = 3
Query:  504 HNLEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNKTFVSLKDFDSTNNT-FKNYILVNTMKHYNI-NSGQLLFLSQSRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETK-YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSLSISQ-QTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQL 1490
             ++ V VL  D+I+QVK+K +D             Y +    A  D  E+  +  +N   ++L+D DS++     N+  +NT+ HYN+ N+  L   S+S +  + S+       +  S++  V ++ P   S K      + +    A H+   +   N   F L    K  +       H   +++ +  T+ Y  + +  K T  +++ ++L S      S T    +K   ++F  +D+      I+  +    WK+    L+ WVNLIKN  F+F  +K   +   L  +A+ LM++CS   ++ + +      K LF K++  +  L
Sbjct: 1539 QDIPVRVLDCDTITQVKEKCLDAKY--------RGYRFADRPAPGD-MELEWKTGMNGK-MALQDIDSSSRVEGGNWKRLNTLAHYNVPNNAILTLTSKSNSLYNLSI------LSDRSEKSSVSMKTPGVGSPKPWGAPPSVI----ADHASSSADTDNG--FKLYHLVKPTE-------HGPTDSQEKMVTEIYLTRLLMMKGTLAKFITSLLESI---FSSSTVPPCIK---YMFDFMDEQAREHGINDPEVVHAWKSNALPLRFWVNLIKNPHFLFDIQKPTKIEGCLSVVAQTLMDACSTQDHQLTKDSP--SSKLLFAKDMYQYRDL 1834          
BLAST of Plexin-B2 vs. Ensembl Celegans
Match: plx-1 (PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90])

HSP 1 Score: 59.3066 bits (142), Expect = 6.590e-9
Identity = 78/338 (23.08%), Postives = 147/338 (43.49%), Query Frame = 3
Query:  504 HNLEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNKTFVSLKDFDSTNNT-FKNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDP------LISGLFHSIMETERREETK-YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSLSISQ-QTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQL 1490
             ++ V VL  D+I+QVK+K +D             Y +    A  D  E+  +  +N   ++L+D DS++     N+  +NT+ HYN+ +  +L L    T +  S+  L N F+S+S +    +         DR + ++   K     S        S +    ++    D       L+    H   +++ +  T+ Y  + +  K T  +++ ++L S      S T    +K   ++F  +D+      I+  +    WK+    L+ WVNLIKN  F+F  +K   +   L  +A+ LM++CS   ++ + +      K LF K++  +  L
Sbjct: 1350 QDIPVRVLDCDTITQVKEKCLDAKY--------RGYRFADRPAPGD-MELEWKTGMNGK-MALQDIDSSSRVEGGNWKRLNTLAHYNVPNNAILTL----TSKSNSLYNLVN-FSSTSMKTASILS--------DRSEKSSVSMKTPGVGSPKPWGAPPSVIADHASSSADTDNGFKLYHLVKPTEHGPTDSQEKMVTEIYLTRLLMMKGTLAKFITSLLESI---FSSSTVPPCIK---YMFDFMDEQAREHGINDPEVVHAWKSNALPLRFWVNLIKNPHFLFDIQKPTKIEGCLSVVAQTLMDACSTQDHQLTKDSP--SSKLLFAKDMYQYRDL 1656          
BLAST of Plexin-B2 vs. Ensembl Fly
Match: PlexA (gene:FBgn0025741 transcript:FBtr0089224)

HSP 1 Score: 67.3958 bits (163), Expect = 2.687e-11
Identity = 85/341 (24.93%), Postives = 143/341 (41.94%), Query Frame = 3
Query:  507 NLEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNKTF-VSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQSRTR-EDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETK-----YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKIS-DFLFTLLDDIGDSLSIS-QQTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRF 1502
            N+ V VL  D+I QVK+K ++            +Y    +       ++ LE     T  V L D D T+ T   +  +NT++HYN+  G  L L   ++   +FS+    NE +        H    LNISK      ++  F + A   +    ++N   +  L      D          M+ E     K     Y  + +  K T  ++VD++  +     H G+    L ++  ++F  LDD      I+  +    WK+    L+ WVNLIKN +F+F   KS  V   L  +A+  M+SCS + ++   +      K L+ K+I  + +   R+
Sbjct: 1124 NVSVKVLDCDTIGQVKEKCLE-----------TIYRNIPSSQRPRKDDLDLEWRTGATGRVILYDEDVTSKTESEWKKLNTLQHYNVPDGAGLSLVPKQSSIYNFSILSDKNEKS--------HKYETLNISKYTS---SSPTFSR-AGSPLNNDMHENGLRYWHLVKHHDSD----------MQKEGERVNKLVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGS---ALPLAIKYMFDFLDDQAQLHGITDPEVVHTWKSNSLPLRFWVNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSP--SSKLLYAKDIPEYRKWVDRY 1426          
BLAST of Plexin-B2 vs. Ensembl Fly
Match: PlexA (gene:FBgn0025741 transcript:FBtr0089225)

HSP 1 Score: 67.3958 bits (163), Expect = 2.687e-11
Identity = 85/341 (24.93%), Postives = 143/341 (41.94%), Query Frame = 3
Query:  507 NLEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNKTF-VSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQSRTR-EDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETK-----YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKIS-DFLFTLLDDIGDSLSIS-QQTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRF 1502
            N+ V VL  D+I QVK+K ++            +Y    +       ++ LE     T  V L D D T+ T   +  +NT++HYN+  G  L L   ++   +FS+    NE +        H    LNISK      ++  F + A   +    ++N   +  L      D          M+ E     K     Y  + +  K T  ++VD++  +     H G+    L ++  ++F  LDD      I+  +    WK+    L+ WVNLIKN +F+F   KS  V   L  +A+  M+SCS + ++   +      K L+ K+I  + +   R+
Sbjct: 1124 NVSVKVLDCDTIGQVKEKCLE-----------TIYRNIPSSQRPRKDDLDLEWRTGATGRVILYDEDVTSKTESEWKKLNTLQHYNVPDGAGLSLVPKQSSIYNFSILSDKNEKS--------HKYETLNISKYTS---SSPTFSR-AGSPLNNDMHENGLRYWHLVKHHDSD----------MQKEGERVNKLVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGS---ALPLAIKYMFDFLDDQAQLHGITDPEVVHTWKSNSLPLRFWVNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSP--SSKLLYAKDIPEYRKWVDRY 1426          
BLAST of Plexin-B2 vs. Ensembl Fly
Match: PlexA (gene:FBgn0025741 transcript:FBtr0089223)

HSP 1 Score: 67.0106 bits (162), Expect = 3.519e-11
Identity = 85/341 (24.93%), Postives = 143/341 (41.94%), Query Frame = 3
Query:  507 NLEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNKTF-VSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQSRTR-EDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETK-----YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKIS-DFLFTLLDDIGDSLSIS-QQTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRF 1502
            N+ V VL  D+I QVK+K ++            +Y    +       ++ LE     T  V L D D T+ T   +  +NT++HYN+  G  L L   ++   +FS+    NE +        H    LNISK      ++  F + A   +    ++N   +  L      D          M+ E     K     Y  + +  K T  ++VD++  +     H G+    L ++  ++F  LDD      I+  +    WK+    L+ WVNLIKN +F+F   KS  V   L  +A+  M+SCS + ++   +      K L+ K+I  + +   R+
Sbjct: 1564 NVSVKVLDCDTIGQVKEKCLE-----------TIYRNIPSSQRPRKDDLDLEWRTGATGRVILYDEDVTSKTESEWKKLNTLQHYNVPDGAGLSLVPKQSSIYNFSILSDKNEKS--------HKYETLNISKYTS---SSPTFSR-AGSPLNNDMHENGLRYWHLVKHHDSD----------MQKEGERVNKLVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGS---ALPLAIKYMFDFLDDQAQLHGITDPEVVHTWKSNSLPLRFWVNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSP--SSKLLYAKDIPEYRKWVDRY 1866          
BLAST of Plexin-B2 vs. Ensembl Fly
Match: PlexB (gene:FBgn0025740 transcript:FBtr0308297)

HSP 1 Score: 66.2402 bits (160), Expect = 7.044e-11
Identity = 46/143 (32.17%), Postives = 70/143 (48.95%), Query Frame = 3
Query: 1200 FLFTLLDDIGDSLSISQ-QTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRFLENS---VHANDEKMILIMTDLTKKYFLNSYKINALKNLHF 1616
            +LF LLD+      I+       WK+ C  L+ WVN IKN DFIF   K+ SV   L  IA+  M++CS + ++   +      K LF K+I N+  + K F  +       +D++M   M  L+ +       I+ALK L+ 
Sbjct: 1868 WLFDLLDEAARRHDIADTDIVHAWKSNCLPLRFWVNFIKNPDFIFDVNKTYSVDSCLSVIAQTFMDACSTSEHRLGKDSP--SNKLLFAKDIPNYRIMVKEFYRDVSRLPQISDQEMSTAMQQLSVRQNEEFDTISALKELYI 2008          
BLAST of Plexin-B2 vs. Ensembl Fly
Match: PlexB (gene:FBgn0025740 transcript:FBtr0089179)

HSP 1 Score: 66.2402 bits (160), Expect = 7.044e-11
Identity = 46/143 (32.17%), Postives = 70/143 (48.95%), Query Frame = 3
Query: 1200 FLFTLLDDIGDSLSISQ-QTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRFLENS---VHANDEKMILIMTDLTKKYFLNSYKINALKNLHF 1616
            +LF LLD+      I+       WK+ C  L+ WVN IKN DFIF   K+ SV   L  IA+  M++CS + ++   +      K LF K+I N+  + K F  +       +D++M   M  L+ +       I+ALK L+ 
Sbjct: 1868 WLFDLLDEAARRHDIADTDIVHAWKSNCLPLRFWVNFIKNPDFIFDVNKTYSVDSCLSVIAQTFMDACSTSEHRLGKDSP--SNKLLFAKDIPNYRIMVKEFYRDVSRLPQISDQEMSTAMQQLSVRQNEEFDTISALKELYI 2008          
BLAST of Plexin-B2 vs. Ensembl Zebrafish
Match: plxnb2a (plexin b2a [Source:ZFIN;Acc:ZDB-GENE-030131-8917])

HSP 1 Score: 80.8777 bits (198), Expect = 1.868e-15
Identity = 94/405 (23.21%), Postives = 167/405 (41.23%), Query Frame = 3
Query:  513 EVDVLSLDSISQVKQKIIDKAIVKHDETYTNV-YEYESTIASIDHREISLECFLNKTFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSI-----VESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETKYSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSL-SISQQTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQL---WKRFLENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFLSSSMSQKISKTT*KLSLFYNFIVTNL 1697
             V VL+ D+ISQVK+KII+       + Y N+ Y     + S+     +LE     T   L D D T+     +  +NT+ HYN+  G  L LS+                        +H +   + +  +  + NA L     FH +     +E            AT K++  +                  Y  + ++ K T  ++VD+   S  C   SGT         + F  LD+      ++  +T  +WKT    L+ WVN++KN  FIF    ++ V   L  IA+  M++C++T +K + E      K L+ KEI  + ++   + + +   V  +D+ M   + ++++ +   + K+N    LH L    S+           +Y+ I+++L
Sbjct:  558 PVKVLNCDTISQVKEKIIE-------QVYRNLPYSQRPVVDSV-----ALEWRPGSTGQILSDLDLTSQKEGRWKRINTLAHYNVRDGATLVLSR-----------------------VLHTQQSFDQNMDNHEERNALLEDDKVFHLVRPADELEEVKSKRGSMKDKATTKAITEI------------------YLTRLLSMKGTLQQFVDDFFRSVLC---SGTV--VPPAVKYFFDFLDEQAQKHDNVDDETIHIWKTNSLPLRFWVNILKNPHFIFDVHLTEVVDASLSVIAQTFMDACTKTEHKLTRESP--SNKLLYAKEISTYKKMVDDYYKGIRQMVPVSDQDMNTHLAEISRSH---TDKLNTQAALHQLYQYASK-----------YYDGIISSL 888          
BLAST of Plexin-B2 vs. Ensembl Zebrafish
Match: plxnb2a (plexin b2a [Source:ZFIN;Acc:ZDB-GENE-030131-8917])

HSP 1 Score: 80.1073 bits (196), Expect = 4.402e-15
Identity = 99/403 (24.57%), Postives = 169/403 (41.94%), Query Frame = 3
Query:  513 EVDVLSLDSISQVKQKIIDKAIVKHDETYTNV-YEYESTIASIDHREISLECFLNKTFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQS-RTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLIS--GLFHSIMETERREETKYSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSL-SISQQTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQL---WKRFLENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFLSSSMSQKISKTT*KLSLFYNFIVTNL 1697
             V VL+ D+ISQVK+KII+       + Y N+ Y     + S+     +LE     T   L D D T+     +  +NT+ HYN+  G  L LS+   T++ F     N+E                        + NA L     FH              L+     L+ + S  G       T+   E  Y  + ++ K T  ++VD+   S  C   SGT         + F  LD+      ++  +T  +WKT    L+ WVN++KN  FIF    ++ V   L  IA+  M++C++T +K + E      K L+ KEI  + ++   + + +   V  +D+ M   + ++++ +   + K+N    LH L    S+           +Y+ I+++L
Sbjct: 1505 PVKVLNCDTISQVKEKIIE-------QVYRNLPYSQRPVVDSV-----ALEWRPGSTGQILSDLDLTSQKEGRWKRINTLAHYNVRDGATLVLSRVLHTQQSFDQNMDNHE------------------------ERNALLEDDKVFH--------------LVRPADELEEVKSKRGSMKDKATTKAITEI-YLTRLLSMKGTLQQFVDDFFRSVLC---SGTV--VPPAVKYFFDFLDEQAQKHDNVDDETIHIWKTNSLPLRFWVNILKNPHFIFDVHLTEVVDASLSVIAQTFMDACTKTEHKLTRESP--SNKLLYAKEISTYKKMVDDYYKGIRQMVPVSDQDMNTHLAEISRSH---TDKLNTQAALHQLYQYASK-----------YYDGIISSL 1835          
BLAST of Plexin-B2 vs. Ensembl Zebrafish
Match: plxnb2a (plexin b2a [Source:ZFIN;Acc:ZDB-GENE-030131-8917])

HSP 1 Score: 80.1073 bits (196), Expect = 4.402e-15
Identity = 99/403 (24.57%), Postives = 169/403 (41.94%), Query Frame = 3
Query:  513 EVDVLSLDSISQVKQKIIDKAIVKHDETYTNV-YEYESTIASIDHREISLECFLNKTFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQS-RTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLIS--GLFHSIMETERREETKYSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSL-SISQQTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQL---WKRFLENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFLSSSMSQKISKTT*KLSLFYNFIVTNL 1697
             V VL+ D+ISQVK+KII+       + Y N+ Y     + S+     +LE     T   L D D T+     +  +NT+ HYN+  G  L LS+   T++ F     N+E                        + NA L     FH              L+     L+ + S  G       T+   E  Y  + ++ K T  ++VD+   S  C   SGT         + F  LD+      ++  +T  +WKT    L+ WVN++KN  FIF    ++ V   L  IA+  M++C++T +K + E      K L+ KEI  + ++   + + +   V  +D+ M   + ++++ +   + K+N    LH L    S+           +Y+ I+++L
Sbjct: 1505 PVKVLNCDTISQVKEKIIE-------QVYRNLPYSQRPVVDSV-----ALEWRPGSTGQILSDLDLTSQKEGRWKRINTLAHYNVRDGATLVLSRVLHTQQSFDQNMDNHE------------------------ERNALLEDDKVFH--------------LVRPADELEEVKSKRGSMKDKATTKAITEI-YLTRLLSMKGTLQQFVDDFFRSVLC---SGTV--VPPAVKYFFDFLDEQAQKHDNVDDETIHIWKTNSLPLRFWVNILKNPHFIFDVHLTEVVDASLSVIAQTFMDACTKTEHKLTRESP--SNKLLYAKEISTYKKMVDDYYKGIRQMVPVSDQDMNTHLAEISRSH---TDKLNTQAALHQLYQYASK-----------YYDGIISSL 1835          
BLAST of Plexin-B2 vs. Ensembl Zebrafish
Match: plxnb2a (plexin b2a [Source:ZFIN;Acc:ZDB-GENE-030131-8917])

HSP 1 Score: 79.7221 bits (195), Expect = 6.136e-15
Identity = 99/403 (24.57%), Postives = 169/403 (41.94%), Query Frame = 3
Query:  513 EVDVLSLDSISQVKQKIIDKAIVKHDETYTNV-YEYESTIASIDHREISLECFLNKTFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQS-RTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLIS--GLFHSIMETERREETKYSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSL-SISQQTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQL---WKRFLENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFLSSSMSQKISKTT*KLSLFYNFIVTNL 1697
             V VL+ D+ISQVK+KII+       + Y N+ Y     + S+     +LE     T   L D D T+     +  +NT+ HYN+  G  L LS+   T++ F     N+E                        + NA L     FH              L+     L+ + S  G       T+   E  Y  + ++ K T  ++VD+   S  C   SGT         + F  LD+      ++  +T  +WKT    L+ WVN++KN  FIF    ++ V   L  IA+  M++C++T +K + E      K L+ KEI  + ++   + + +   V  +D+ M   + ++++ +   + K+N    LH L    S+           +Y+ I+++L
Sbjct: 1462 PVKVLNCDTISQVKEKIIE-------QVYRNLPYSQRPVVDSV-----ALEWRPGSTGQILSDLDLTSQKEGRWKRINTLAHYNVRDGATLVLSRVLHTQQSFDQNMDNHE------------------------ERNALLEDDKVFH--------------LVRPADELEEVKSKRGSMKDKATTKAITEI-YLTRLLSMKGTLQQFVDDFFRSVLC---SGTV--VPPAVKYFFDFLDEQAQKHDNVDDETIHIWKTNSLPLRFWVNILKNPHFIFDVHLTEVVDASLSVIAQTFMDACTKTEHKLTRESP--SNKLLYAKEISTYKKMVDDYYKGIRQMVPVSDQDMNTHLAEISRSH---TDKLNTQAALHQLYQYASK-----------YYDGIISSL 1792          
BLAST of Plexin-B2 vs. Ensembl Zebrafish
Match: plxna3 (plexin A3 [Source:NCBI gene;Acc:567422])

HSP 1 Score: 77.7962 bits (190), Expect = 2.503e-14
Identity = 87/384 (22.66%), Postives = 164/384 (42.71%), Query Frame = 3
Query:  510 LEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNK-TFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETKYSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKIS-DFLFTLLDDIGDSLSISQ-QTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRF---LENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFLSSSMSQKI 1643
            + V VL+ D+I+QVK K++D            VY+           ++ LE    + T + L+D D T     ++  +NT+ HY +  G L+ L Q +     S   + N F + +  +  +  L    S  D  +  A +        I       + L+ L+   +  D    G   S M +E      Y  + +  K T  ++VD++  +     H G+    L ++  ++F  LD+  D   I+    +  WK+ C  L+ WVN+IKN  F+F   K+      L  +A+  M+SCS + ++   +      K L+ K+I N+    +R+   +      +D+ M   + + ++ +      ++AL  L+F  +   ++I
Sbjct: 1514 IPVKVLNCDTITQVKDKLLDA-----------VYKGIPYSQRPQADDMDLEWRQGRLTRIILQDEDVTTKIESDWKRLNTLAHYQVTDGSLVALVQKQV----SAYNIANSF-TFTRSLSRYESLLRTSSSPDSLRSRAPM--------ITPDQETGTKLWHLVKNHEHADQR-EGDRGSKMVSE-----IYLTRLLATKGTLQKFVDDLFETVFSTAHRGS---ALPLAIKYMFDFLDEQADKRQITDPDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHRLGKDSP--SNKLLYAKDIPNYKSWVERYYRDISKMPSISDQDMDAYLVEQSRLHGNEFNTLSALSELYFYINKYKEEI 1862          
BLAST of Plexin-B2 vs. Ensembl Xenopus
Match: PLXNB2 (plexin B2 [Source:NCBI gene;Acc:550076])

HSP 1 Score: 78.1814 bits (191), Expect = 2.433e-14
Identity = 97/377 (25.73%), Postives = 158/377 (41.91%), Query Frame = 3
Query:  510 LEVDVLSLDSISQVKQKIIDKAIVKHDETYTNV-YEYESTIASIDHREISLECFLNKTFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETK--YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSLSISQQ-TKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQL---WKRFLENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFL 1619
            + V VL+ D+I+QVK+KI+D       + Y N+ Y       S+     +LE     T   L D D T+         NT+ HYN+     L LS    R   S ++  N           H + P                     ++++E  NK    + L+     +D + S    S+ E ER +     Y  + ++ K T  ++VDN   S    L+S           + F  LD+  +   I  + T  +WKT    L+ WVN++KN  FIF     Q V   L  IA+  M++CSRT +K S E      K L+ KEI  + ++   + + +   V  +D+ M   + ++++ +   +  +N L  LH L
Sbjct: 1227 VPVKVLNCDTITQVKEKIVD-------QVYRNIPYSLRPKADSL-----ALEWRPGSTAQILSDLDLTSQKEGRLKRYNTLMHYNVRDNATLILS----RMGISQQQEEN-----------HQDFP------------------GERNALLEDENK---AWHLVRPADEVDEVKSKR-GSMKEKERTKAITEIYLTRLLSVKGTLQQFVDNFFQSV---LNSNQV--VPPAVKYFFDFLDEQAEKYEIKDEDTVHIWKTNSLSLRFWVNILKNPHFIFDVHVHQVVDASLSVIAQTFMDACSRTEHKLSRESP--SNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAH---TESLNTLVALHQL 1544          
BLAST of Plexin-B2 vs. Ensembl Xenopus
Match: PLXNB2 (plexin B2 [Source:NCBI gene;Acc:550076])

HSP 1 Score: 78.1814 bits (191), Expect = 2.473e-14
Identity = 97/377 (25.73%), Postives = 158/377 (41.91%), Query Frame = 3
Query:  510 LEVDVLSLDSISQVKQKIIDKAIVKHDETYTNV-YEYESTIASIDHREISLECFLNKTFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETK--YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSLSISQQ-TKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQL---WKRFLENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFL 1619
            + V VL+ D+I+QVK+KI+D       + Y N+ Y       S+     +LE     T   L D D T+         NT+ HYN+     L LS    R   S ++  N           H + P                     ++++E  NK    + L+     +D + S    S+ E ER +     Y  + ++ K T  ++VDN   S    L+S           + F  LD+  +   I  + T  +WKT    L+ WVN++KN  FIF     Q V   L  IA+  M++CSRT +K S E      K L+ KEI  + ++   + + +   V  +D+ M   + ++++ +   +  +N L  LH L
Sbjct: 1281 VPVKVLNCDTITQVKEKIVD-------QVYRNIPYSLRPKADSL-----ALEWRPGSTAQILSDLDLTSQKEGRLKRYNTLMHYNVRDNATLILS----RMGISQQQEEN-----------HQDFP------------------GERNALLEDENK---AWHLVRPADEVDEVKSKR-GSMKEKERTKAITEIYLTRLLSVKGTLQQFVDNFFQSV---LNSNQV--VPPAVKYFFDFLDEQAEKYEIKDEDTVHIWKTNSLSLRFWVNILKNPHFIFDVHVHQVVDASLSVIAQTFMDACSRTEHKLSRESP--SNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAH---TESLNTLVALHQL 1598          
BLAST of Plexin-B2 vs. Ensembl Xenopus
Match: PLXNB2 (plexin B2 [Source:NCBI gene;Acc:550076])

HSP 1 Score: 78.1814 bits (191), Expect = 2.618e-14
Identity = 97/377 (25.73%), Postives = 158/377 (41.91%), Query Frame = 3
Query:  510 LEVDVLSLDSISQVKQKIIDKAIVKHDETYTNV-YEYESTIASIDHREISLECFLNKTFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETK--YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSLSISQQ-TKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQL---WKRFLENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFL 1619
            + V VL+ D+I+QVK+KI+D       + Y N+ Y       S+     +LE     T   L D D T+         NT+ HYN+     L LS    R   S ++  N           H + P                     ++++E  NK    + L+     +D + S    S+ E ER +     Y  + ++ K T  ++VDN   S    L+S           + F  LD+  +   I  + T  +WKT    L+ WVN++KN  FIF     Q V   L  IA+  M++CSRT +K S E      K L+ KEI  + ++   + + +   V  +D+ M   + ++++ +   +  +N L  LH L
Sbjct: 1256 VPVKVLNCDTITQVKEKIVD-------QVYRNIPYSLRPKADSL-----ALEWRPGSTAQILSDLDLTSQKEGRLKRYNTLMHYNVRDNATLILS----RMGISQQQEEN-----------HQDFP------------------GERNALLEDENK---AWHLVRPADEVDEVKSKR-GSMKEKERTKAITEIYLTRLLSVKGTLQQFVDNFFQSV---LNSNQV--VPPAVKYFFDFLDEQAEKYEIKDEDTVHIWKTNSLSLRFWVNILKNPHFIFDVHVHQVVDASLSVIAQTFMDACSRTEHKLSRESP--SNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAH---TESLNTLVALHQL 1573          
BLAST of Plexin-B2 vs. Ensembl Xenopus
Match: PLXNB2 (plexin B2 [Source:NCBI gene;Acc:550076])

HSP 1 Score: 77.7962 bits (190), Expect = 2.774e-14
Identity = 97/377 (25.73%), Postives = 158/377 (41.91%), Query Frame = 3
Query:  510 LEVDVLSLDSISQVKQKIIDKAIVKHDETYTNV-YEYESTIASIDHREISLECFLNKTFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETK--YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSLSISQQ-TKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQL---WKRFLENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFL 1619
            + V VL+ D+I+QVK+KI+D       + Y N+ Y       S+     +LE     T   L D D T+         NT+ HYN+     L LS    R   S ++  N           H + P                     ++++E  NK    + L+     +D + S    S+ E ER +     Y  + ++ K T  ++VDN   S    L+S           + F  LD+  +   I  + T  +WKT    L+ WVN++KN  FIF     Q V   L  IA+  M++CSRT +K S E      K L+ KEI  + ++   + + +   V  +D+ M   + ++++ +   +  +N L  LH L
Sbjct: 1300 VPVKVLNCDTITQVKEKIVD-------QVYRNIPYSLRPKADSL-----ALEWRPGSTAQILSDLDLTSQKEGRLKRYNTLMHYNVRDNATLILS----RMGISQQQEEN-----------HQDFP------------------GERNALLEDENK---AWHLVRPADEVDEVKSKR-GSMKEKERTKAITEIYLTRLLSVKGTLQQFVDNFFQSV---LNSNQV--VPPAVKYFFDFLDEQAEKYEIKDEDTVHIWKTNSLSLRFWVNILKNPHFIFDVHVHQVVDASLSVIAQTFMDACSRTEHKLSRESP--SNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAH---TESLNTLVALHQL 1617          
BLAST of Plexin-B2 vs. Ensembl Xenopus
Match: PLXNB2 (plexin B2 [Source:NCBI gene;Acc:550076])

HSP 1 Score: 77.7962 bits (190), Expect = 2.815e-14
Identity = 97/377 (25.73%), Postives = 158/377 (41.91%), Query Frame = 3
Query:  510 LEVDVLSLDSISQVKQKIIDKAIVKHDETYTNV-YEYESTIASIDHREISLECFLNKTFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETK--YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSLSISQQ-TKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQL---WKRFLENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFL 1619
            + V VL+ D+I+QVK+KI+D       + Y N+ Y       S+     +LE     T   L D D T+         NT+ HYN+     L LS    R   S ++  N           H + P                     ++++E  NK    + L+     +D + S    S+ E ER +     Y  + ++ K T  ++VDN   S    L+S           + F  LD+  +   I  + T  +WKT    L+ WVN++KN  FIF     Q V   L  IA+  M++CSRT +K S E      K L+ KEI  + ++   + + +   V  +D+ M   + ++++ +   +  +N L  LH L
Sbjct: 1280 VPVKVLNCDTITQVKEKIVD-------QVYRNIPYSLRPKADSL-----ALEWRPGSTAQILSDLDLTSQKEGRLKRYNTLMHYNVRDNATLILS----RMGISQQQEEN-----------HQDFP------------------GERNALLEDENK---AWHLVRPADEVDEVKSKR-GSMKEKERTKAITEIYLTRLLSVKGTLQQFVDNFFQSV---LNSNQV--VPPAVKYFFDFLDEQAEKYEIKDEDTVHIWKTNSLSLRFWVNILKNPHFIFDVHVHQVVDASLSVIAQTFMDACSRTEHKLSRESP--SNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAH---TESLNTLVALHQL 1597          
BLAST of Plexin-B2 vs. Ensembl Mouse
Match: Plxnb2 (plexin B2 [Source:MGI Symbol;Acc:MGI:2154239])

HSP 1 Score: 89.3521 bits (220), Expect = 6.157e-18
Identity = 96/382 (25.13%), Postives = 160/382 (41.88%), Query Frame = 3
Query:  501 IHNLEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNKTFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQ---SRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETK--YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSLSI-SQQTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQL---WKRFLENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFL 1619
            I  + V VL+ D+ISQVK+KIID+           VY  +          + LE     T   L D D T+     +  +NT+ HYN+  G  L LS+   S+  ED S ++L  E                                    H+++E  N+   ++ L+     +D   S    S+ E ER +     Y  + ++ K T  ++VDN   S     H+           + F  LD+  +   I  + T  +WKT    L+ WVN++KN  FIF     + V   L  IA+  M++C+RT +K S +      K L+ KEI  + ++   + + +   V  +D+ M   + ++++ +   +  +N L  LH L
Sbjct: 1478 IDAIPVKVLNCDTISQVKEKIIDQ-----------VYRTQPCSCWPKPDSVVLEWRPGSTAQILSDLDLTSQREGRWKRINTLMHYNVRDGATLILSKVGVSQQPED-SQQDLPGER-----------------------------------HALLEEENR---VWHLVRPTDEVDEGKSKR-GSMKEKERTKAITEIYLTRLLSVKGTLQQFVDNFFQSVLAPGHA-----VPPAVKYFFDFLDEQAEKHDIRDEDTIHIWKTNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSVIAQTFMDACTRTEHKLSRDSP--SNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAH---TDSLNTLVALHQL 1798          
BLAST of Plexin-B2 vs. Ensembl Mouse
Match: Plxnb2 (plexin B2 [Source:MGI Symbol;Acc:MGI:2154239])

HSP 1 Score: 89.3521 bits (220), Expect = 6.157e-18
Identity = 96/382 (25.13%), Postives = 160/382 (41.88%), Query Frame = 3
Query:  501 IHNLEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNKTFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQ---SRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETK--YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSLSI-SQQTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQL---WKRFLENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFL 1619
            I  + V VL+ D+ISQVK+KIID+           VY  +          + LE     T   L D D T+     +  +NT+ HYN+  G  L LS+   S+  ED S ++L  E                                    H+++E  N+   ++ L+     +D   S    S+ E ER +     Y  + ++ K T  ++VDN   S     H+           + F  LD+  +   I  + T  +WKT    L+ WVN++KN  FIF     + V   L  IA+  M++C+RT +K S +      K L+ KEI  + ++   + + +   V  +D+ M   + ++++ +   +  +N L  LH L
Sbjct: 1478 IDAIPVKVLNCDTISQVKEKIIDQ-----------VYRTQPCSCWPKPDSVVLEWRPGSTAQILSDLDLTSQREGRWKRINTLMHYNVRDGATLILSKVGVSQQPED-SQQDLPGER-----------------------------------HALLEEENR---VWHLVRPTDEVDEGKSKR-GSMKEKERTKAITEIYLTRLLSVKGTLQQFVDNFFQSVLAPGHA-----VPPAVKYFFDFLDEQAEKHDIRDEDTIHIWKTNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSVIAQTFMDACTRTEHKLSRDSP--SNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAH---TDSLNTLVALHQL 1798          
BLAST of Plexin-B2 vs. Ensembl Mouse
Match: Plxna3 (plexin A3 [Source:MGI Symbol;Acc:MGI:107683])

HSP 1 Score: 76.2554 bits (186), Expect = 7.785e-14
Identity = 85/393 (21.63%), Postives = 161/393 (40.97%), Query Frame = 3
Query:  516 VDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNK-TFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFT---LLATKKSLDPLISGLFHSIMETERREETK--------YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKIS-DFLFTLLDDIGDSLSISQ-QTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRF---LENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFLSSSMSQKI 1643
            V VL+ DSI+Q K K++D            VY+           ++ LE    +   + L+D D T     ++  VN++ HY +  G L+ L   +     S   + N F  +                   R L       S + S++ + +    L +   +L   +     +  L  +   T+ RE  +        Y  + +  K T  ++VD++  +     H G+    L ++  ++F  LD+  D   IS    +  WK+ C  L+ WVN+IKN  F+F   K+      L  +A+  M+SCS + ++   +      K L+ K+I N+    +R+   +      +D+ M   + + ++ +  +   ++AL  L+F  +   Q+I
Sbjct: 1496 VKVLNCDSITQAKDKLLD-----------TVYKGIPYSQRPKAEDMDLEWRQGRMARIILQDEDITTKIECDWKRVNSLAHYQVTDGSLVALVPKQV----SAYNMANSFTFT-------------------RSL-------SRYESLLRAASSPDSLRSRAPMLTPDQEAGTKLWHLVRNHDHTDHREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETVFSTAHRGS---ALPLAIKYMFDFLDEQADQRQISDPDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHRLGKDSP--SNKLLYAKDIPNYKSWVERYYRDIAKMASISDQDMDAYLVEQSRLHANDFNVLSALSELYFYVTKYRQEI 1842          
BLAST of Plexin-B2 vs. Ensembl Mouse
Match: Plxna1 (plexin A1 [Source:MGI Symbol;Acc:MGI:107685])

HSP 1 Score: 72.4034 bits (176), Expect = 1.175e-12
Identity = 93/397 (23.43%), Postives = 164/397 (41.31%), Query Frame = 3
Query:  480 IRPMEIDIHNLEVDVLSLDSISQVKQKIIDKAIVKHDETYTNV-YEYESTIASIDHREISLECFLNK-TFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNE--FASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETKYSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKIS-DFLFTLLDDIGDSLSI-SQQTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRFLENSVHANDEKMILIMTDLTKKYF-----LNSYKINALKNLHFLSSSMSQ 1637
            + P   +   + V  L+ D+++QVK+K++D         Y  V Y        +D     LE    +   + L+D D T     ++  +NT+ HY +  G  + L   +T    S   ++N   F  S  R   +  +    S  D  +    +         +ES  K   L+ L+     LD    G   S M +E      Y  + +  K T  ++VD++  +     H G+    L ++  ++F  LD+  D   I     +  WK+ C  L+ WVN+IKN  F+F   K+      L  +A+  M+SCS + +K   +      K L+ K+I N+    +R+     +A+  KM  I       Y      L+  + N++  LH + S +++
Sbjct: 1506 VNPEHENAPEVPVKGLNCDTVTQVKEKLLDA-------VYKGVPYSQRPKAGDMD-----LEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQT----SAYNISNSSTFTKSLSR---YESMLRTASSPDSLRSRTPMITPD-----LESGTK---LWHLVKNHDHLDQR-EGDRGSKMVSE-----IYLTRLLATKGTLQKFVDDLFETIFSTAHRGS---ALPLAIKYMFDFLDEQADKHQIHDSDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHKLGKDSP--SNKLLYAKDIPNYKSWVERY-----YADIAKMPAISDQDMSAYLAEQSRLHLSQFNSMSALHEIYSYIAK 1859          
BLAST of Plexin-B2 vs. Ensembl Mouse
Match: Plxna1 (plexin A1 [Source:MGI Symbol;Acc:MGI:107685])

HSP 1 Score: 72.4034 bits (176), Expect = 1.175e-12
Identity = 93/397 (23.43%), Postives = 164/397 (41.31%), Query Frame = 3
Query:  480 IRPMEIDIHNLEVDVLSLDSISQVKQKIIDKAIVKHDETYTNV-YEYESTIASIDHREISLECFLNK-TFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNE--FASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETKYSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKIS-DFLFTLLDDIGDSLSI-SQQTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRFLENSVHANDEKMILIMTDLTKKYF-----LNSYKINALKNLHFLSSSMSQ 1637
            + P   +   + V  L+ D+++QVK+K++D         Y  V Y        +D     LE    +   + L+D D T     ++  +NT+ HY +  G  + L   +T    S   ++N   F  S  R   +  +    S  D  +    +         +ES  K   L+ L+     LD    G   S M +E      Y  + +  K T  ++VD++  +     H G+    L ++  ++F  LD+  D   I     +  WK+ C  L+ WVN+IKN  F+F   K+      L  +A+  M+SCS + +K   +      K L+ K+I N+    +R+     +A+  KM  I       Y      L+  + N++  LH + S +++
Sbjct: 1506 VNPEHENAPEVPVKGLNCDTVTQVKEKLLDA-------VYKGVPYSQRPKAGDMD-----LEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQT----SAYNISNSSTFTKSLSR---YESMLRTASSPDSLRSRTPMITPD-----LESGTK---LWHLVKNHDHLDQR-EGDRGSKMVSE-----IYLTRLLATKGTLQKFVDDLFETIFSTAHRGS---ALPLAIKYMFDFLDEQADKHQIHDSDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHKLGKDSP--SNKLLYAKDIPNYKSWVERY-----YADIAKMPAISDQDMSAYLAEQSRLHLSQFNSMSALHEIYSYIAK 1859          
BLAST of Plexin-B2 vs. UniProt/SwissProt
Match: sp|O15031|PLXB2_HUMAN (Plexin-B2 OS=Homo sapiens OX=9606 GN=PLXNB2 PE=1 SV=3)

HSP 1 Score: 89.7373 bits (221), Expect = 2.988e-17
Identity = 96/379 (25.33%), Postives = 160/379 (42.22%), Query Frame = 3
Query:  510 LEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNKTFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQ---SRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETK--YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSLSISQQ-TKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQL---WKRFLENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFL 1619
            + V VL+ D+ISQVK+KIID+           VY  +          + LE     T   L D D T+     +  VNT+ HYN+  G  L LS+   S+  ED S ++L  E                                    H+++E  N+   ++ L+     +D   S    S+ E ER +     Y  + ++ K T  ++VDN   S     H+           + F  LD+  +  +I  + T  +WKT    L+ WVN++KN  FIF     + V   L  IA+  M++C+RT +K S +      K L+ KEI  + ++   + + +   V  +D+ M   + ++++ +   +  +N L  LH L
Sbjct: 1477 IPVKVLNCDTISQVKEKIIDQ-----------VYRGQPCSCWPRPDSVVLEWRPGSTAQILSDLDLTSQREGRWKRVNTLMHYNVRDGATLILSKVGVSQQPED-SQQDLPGER-----------------------------------HALLEEENR---VWHLVRPTDEVDEGKSKR-GSVKEKERTKAITEIYLTRLLSVKGTLQQFVDNFFQSVLAPGHA-----VPPAVKYFFDFLDEQAEKHNIQDEDTIHIWKTNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSVIAQTFMDACTRTEHKLSRDSP--SNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAH---TDSLNTLVALHQL 1794          
BLAST of Plexin-B2 vs. UniProt/SwissProt
Match: sp|B2RXS4|PLXB2_MOUSE (Plexin-B2 OS=Mus musculus OX=10090 GN=Plxnb2 PE=1 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 4.269e-17
Identity = 96/382 (25.13%), Postives = 160/382 (41.88%), Query Frame = 3
Query:  501 IHNLEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNKTFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQ---SRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETK--YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSLSI-SQQTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQL---WKRFLENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFL 1619
            I  + V VL+ D+ISQVK+KIID+           VY  +          + LE     T   L D D T+     +  +NT+ HYN+  G  L LS+   S+  ED S ++L  E                                    H+++E  N+   ++ L+     +D   S    S+ E ER +     Y  + ++ K T  ++VDN   S     H+           + F  LD+  +   I  + T  +WKT    L+ WVN++KN  FIF     + V   L  IA+  M++C+RT +K S +      K L+ KEI  + ++   + + +   V  +D+ M   + ++++ +   +  +N L  LH L
Sbjct: 1478 IDAIPVKVLNCDTISQVKEKIIDQ-----------VYRTQPCSCWPKPDSVVLEWRPGSTAQILSDLDLTSQREGRWKRINTLMHYNVRDGATLILSKVGVSQQPED-SQQDLPGER-----------------------------------HALLEEENR---VWHLVRPTDEVDEGKSKR-GSMKEKERTKAITEIYLTRLLSVKGTLQQFVDNFFQSVLAPGHA-----VPPAVKYFFDFLDEQAEKHDIRDEDTIHIWKTNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSVIAQTFMDACTRTEHKLSRDSP--SNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAH---TDSLNTLVALHQL 1798          
BLAST of Plexin-B2 vs. UniProt/SwissProt
Match: sp|P51805|PLXA3_HUMAN (Plexin-A3 OS=Homo sapiens OX=9606 GN=PLXNA3 PE=1 SV=2)

HSP 1 Score: 78.9518 bits (193), Expect = 7.234e-14
Identity = 87/382 (22.77%), Postives = 161/382 (42.15%), Query Frame = 3
Query:  516 VDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNK-TFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETKYSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKIS-DFLFTLLDDIGDSLSISQ-QTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRF---LENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFLSSSMSQKI 1643
            V VL+ DSI+Q K K++D            VY+           ++ LE    + T + L+D D T     ++  +N++ HY +  G L+ L   +     S   + N F + +  +  +  L    S  D  +  A +        I       + L+ L+      D    G   S M +E      Y  + +  K T  ++VD++  +     H G+    L ++  ++F  LD+  D   IS    +  WK+ C  L+ WVN+IKN  F+F   K+      L  +A+  M+SCS + ++   +      K L+ K+I N+    +R+   +      +D+ M   + + ++ +  +   ++AL  L+F  +   Q+I
Sbjct: 1495 VKVLNCDSITQAKDKLLD-----------TVYKGIPYSQRPKAEDMDLEWRQGRMTRIILQDEDVTTKIECDWKRLNSLAHYQVTDGSLVALVPKQV----SAYNMANSF-TFTRSLSRYESLLRTASSPDSLRSRAPM--------ITPDQETGTKLWHLVKNHDHADHR-EGDRGSKMVSE-----IYLTRLLATKGTLQKFVDDLFETVFSTAHRGS---ALPLAIKYMFDFLDEQADQRQISDPDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHRLGKDSP--SNKLLYAKDIPNYKSWVERYYRDIAKMASISDQDMDAYLVEQSRLHASDFSVLSALNELYFYVTKYRQEI 1841          
BLAST of Plexin-B2 vs. UniProt/SwissProt
Match: sp|B0S5N4|PLXA3_DANRE (Plexin A3 OS=Danio rerio OX=7955 GN=plxna3 PE=2 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 1.873e-13
Identity = 87/384 (22.66%), Postives = 164/384 (42.71%), Query Frame = 3
Query:  510 LEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNK-TFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETKYSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKIS-DFLFTLLDDIGDSLSISQ-QTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRF---LENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFLSSSMSQKI 1643
            + V VL+ D+I+QVK K++D            VY+           ++ LE    + T + L+D D T     ++  +NT+ HY +  G L+ L Q +     S   + N F + +  +  +  L    S  D  +  A +        I       + L+ L+   +  D    G   S M +E      Y  + +  K T  ++VD++  +     H G+    L ++  ++F  LD+  D   I+    +  WK+ C  L+ WVN+IKN  F+F   K+      L  +A+  M+SCS + ++   +      K L+ K+I N+    +R+   +      +D+ M   + + ++ +      ++AL  L+F  +   ++I
Sbjct: 1514 IPVKVLNCDTITQVKDKLLDA-----------VYKGIPYSQRPQADDMDLEWRQGRLTRIILQDEDVTTKIESDWKRLNTLAHYQVTDGSLVALVQKQV----SAYNIANSF-TFTRSLSRYESLLRTSSSPDSLRSRAPM--------ITPDQETGTKLWHLVKNHEHADQR-EGDRGSKMVSE-----IYLTRLLATKGTLQKFVDDLFETVFSTAHRGS---ALPLAIKYMFDFLDEQADKRQITDPDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHRLGKDSP--SNKLLYAKDIPNYKSWVERYYRDISKMPSISDQDMDAYLVEQSRLHGNEFNTLSALSELYFYINKYKEEI 1862          
BLAST of Plexin-B2 vs. UniProt/SwissProt
Match: sp|P70208|PLXA3_MOUSE (Plexin-A3 OS=Mus musculus OX=10090 GN=Plxna3 PE=1 SV=2)

HSP 1 Score: 76.2554 bits (186), Expect = 5.446e-13
Identity = 85/393 (21.63%), Postives = 161/393 (40.97%), Query Frame = 3
Query:  516 VDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNK-TFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFT---LLATKKSLDPLISGLFHSIMETERREETK--------YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKIS-DFLFTLLDDIGDSLSISQ-QTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRF---LENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFLSSSMSQKI 1643
            V VL+ DSI+Q K K++D            VY+           ++ LE    +   + L+D D T     ++  VN++ HY +  G L+ L   +     S   + N F  +                   R L       S + S++ + +    L +   +L   +     +  L  +   T+ RE  +        Y  + +  K T  ++VD++  +     H G+    L ++  ++F  LD+  D   IS    +  WK+ C  L+ WVN+IKN  F+F   K+      L  +A+  M+SCS + ++   +      K L+ K+I N+    +R+   +      +D+ M   + + ++ +  +   ++AL  L+F  +   Q+I
Sbjct: 1496 VKVLNCDSITQAKDKLLD-----------TVYKGIPYSQRPKAEDMDLEWRQGRMARIILQDEDITTKIECDWKRVNSLAHYQVTDGSLVALVPKQV----SAYNMANSFTFT-------------------RSL-------SRYESLLRAASSPDSLRSRAPMLTPDQEAGTKLWHLVRNHDHTDHREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETVFSTAHRGS---ALPLAIKYMFDFLDEQADQRQISDPDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHRLGKDSP--SNKLLYAKDIPNYKSWVERYYRDIAKMASISDQDMDAYLVEQSRLHANDFNVLSALSELYFYVTKYRQEI 1842          
BLAST of Plexin-B2 vs. TrEMBL
Match: A0A0K0LJ73 (Plexin B-4 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=plxnB-4 PE=2 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 1.878e-28
Identity = 129/402 (32.09%), Postives = 209/402 (51.99%), Query Frame = 3
Query:  435 IFINVKIQICLVDPRIRPMEIDIHNLEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVY---EYESTIASIDHREISLECFLNKTFVSLKDFDSTNNTF---KNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNEFASSSDRIC-VHVELP--LNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETKYSNKFINNKDTQMEYVDNV-LYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSLSI--SQQTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEI-DNFSQLWKRFLENSVHANDEKMILIMTDLTKKYFLNSYKINAL 1601
            +F++V +QI ++D  I P  I + N+ + +LSLD++SQVK KI+DKAI+ + +   +++   E + TIA  +     L  F NK  V+L +FD T+      K +I+ NTMKHYNI S   L L+ S    +F+ R L      + D++  +H+ +P    IS  + +K N++  KK  F   V+  N NS LF LL TKK+++  I   F S+                    T +    N  ++SS+ +        +  +  +LF++L+DI  S+SI  +++ KS WK   FI   W   I+N + IFS E   S+   L  IA+VL+ SCS+ S+  S +       Q+F ++I   +   W  FL +     +E ++ +M+D+ +KY L  +K NAL
Sbjct:   76 VFVSVNVQIKMMDASINPWTISLINIPIIILSLDTVSQVKAKILDKAIMMYLKGEHSLFTDSENKQTIAESNLDNFLLYFFHNKVKVNLANFDKTSILLPGKKKFIVANTMKHYNIKSDNKLLLT-SENLLNFNERHL-----LTDDKLTKIHLLIPKEAEISTIENKK-NSK--KKLIFQPAVDKENINSSLFILLTTKKNINDFIHNFFKSLT-------------------TDIPCQSNSKVFSSQSSYQINQERKFFHVF-YLFSMLEDIATSISINDTEEIKS-WKINSFINAFWSKAIRNPNKIFSVEVDSSLFASLNVIAEVLLTSCSQESSILSFKTGSSISTQIFHEDITTTYIHWWNSFLNSKRKIPEEDIVSLMSDIVEKYELEEFKANAL 447          
BLAST of Plexin-B2 vs. TrEMBL
Match: U3E6J7 (Plexin-B2 OS=Callithrix jacchus OX=9483 GN=PLXNB2 PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 9.027e-17
Identity = 98/379 (25.86%), Postives = 163/379 (43.01%), Query Frame = 3
Query:  510 LEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNKTFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQ---SRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETK--YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSLSISQQ-TKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQL---WKRFLENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFL 1619
            ++V VL+ D+ISQVK+KIID+           VY  +          + LE     T   L D D T+     +  VNT+ HYN+  G  L LS+   S+  ED S ++L  E                                    H+++E  N+   ++ L+   + +D   S    S+ E ER +     Y  + ++ K T  ++VDN  +S     H+           + F  LD+  D  SI  + T  +WKT    L+ WVN++KN  FIF     + V   L  IA+  M++C+RT +K S +      K L+ KEI  + ++   + + +   V  +D+ M   + ++++ +   +  +N L  LH L
Sbjct: 1478 IQVKVLNCDTISQVKEKIIDQ-----------VYRGQPCSCWPRPDSVVLEWRPGSTAQILSDLDLTSQREGRWKRVNTLMHYNVRDGATLILSKVGVSQQPED-SQQDLPGER-----------------------------------HALLEEENR---VWHLVRPAEEVDEGKSKR-GSVKEKERTKAITEIYLTRLLSVKGTLQQFVDNFFHSVLAPGHA-----VPPAVKYFFDFLDEQADKHSIQDEDTIHIWKTNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSVIAQTFMDACTRTEHKLSRDSP--SNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAH---TDSLNTLVALHQL 1795          
BLAST of Plexin-B2 vs. TrEMBL
Match: A0A2K5LGS1 (Plexin B2 OS=Cercocebus atys OX=9531 GN=PLXNB2 PE=4 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 1.524e-15
Identity = 96/382 (25.13%), Postives = 162/382 (42.41%), Query Frame = 3
Query:  501 IHNLEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNKTFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQ---SRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETK--YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSLSISQQ-TKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQL---WKRFLENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFL 1619
            +  + V VL+ D+ISQVK+KIID+           VY  +          + LE     T   L D D T+     +  VNT+ HYN+  G  L LS+   S+  ED S ++L  E                               +    H+++E  N+   ++ L+     +D   S    S+ E ER +     Y  + ++ K T  ++VDN   S     H+           + F  LD+  +  +I  + T  +WKT    L+ WVN++KN  FIF     + V   L  IA+  M++C+RT +K S +      K L+ KEI  + ++   + + +   V  +D+ M   + ++++ +   +  +N L  LH L
Sbjct:  266 VDAIPVKVLNCDTISQVKEKIIDQ-----------VYRGQPCSCWPRPDSVVLEWRPGSTAQILSDLDLTSQREGRWKRVNTLMHYNVRDGATLILSKVGVSQQPED-SQQDLPGEPPGG---------------------------RHGPRHALLEEENR---VWHLVRPTDEVDEGKSKR-GSVKEKERTKAITEIYLTRLLSVKGTLQQFVDNFFQSVLAPGHAVP-----PAVKYFFDFLDEQAEKHNIQDEDTIHIWKTNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSVIAQTFMDACTRTEHKLSRDSP--SNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAH---TDSLNTLVALHQL 594          
BLAST of Plexin-B2 vs. TrEMBL
Match: A0A2K5D2V3 (Plexin B2 OS=Aotus nancymaae OX=37293 GN=PLXNB2 PE=4 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.981e-15
Identity = 96/379 (25.33%), Postives = 162/379 (42.74%), Query Frame = 3
Query:  510 LEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNKTFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQ---SRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETK--YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSLSISQQ-TKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQL---WKRFLENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFL 1619
            + V VL+ D+ISQVK+KIID+           VY  +          + LE     T   L D D T+     +  VNT+ HYN+  G  L LS+   S+  ED S ++L  E                                    H+++E  N+   ++ L+   + +D   S    S+ E ER +     Y  + ++ K T  ++VDN  +S     H+           + F  LD+  +  +I  + T  +WKT    L+ WVN++KN  FIF     + V   L  IA+  M++C+RT +K S +      K L+ KEI  + ++   + + +   V  +D+ M   + ++++ +   +  +N L  LH L
Sbjct: 1476 IPVKVLNCDTISQVKEKIIDQ-----------VYRGQPCSCWPRPDSVVLEWRPGSTAQILSDLDLTSQREGRWKRVNTLMHYNVRDGATLILSKVGVSQQPED-SQQDLPGER-----------------------------------HALLEEENR---VWHLVRPAEEVDEGKSKR-GSVKEKERTKAITEIYLTRLLSVKGTLQQFVDNFFHSVLAPGHA-----VPPAVKYFFDFLDEQAEKHNIQDEDTVHIWKTNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSVIAQTFMDACTRTEHKLSRDSP--SNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAH---TDSLNTLVALHQL 1793          
BLAST of Plexin-B2 vs. TrEMBL
Match: A0A2K5D2T0 (Plexin B2 OS=Aotus nancymaae OX=37293 GN=PLXNB2 PE=4 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.990e-15
Identity = 96/379 (25.33%), Postives = 162/379 (42.74%), Query Frame = 3
Query:  510 LEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNKTFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQ---SRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETK--YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSLSISQQ-TKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQL---WKRFLENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFL 1619
            + V VL+ D+ISQVK+KIID+           VY  +          + LE     T   L D D T+     +  VNT+ HYN+  G  L LS+   S+  ED S ++L  E                                    H+++E  N+   ++ L+   + +D   S    S+ E ER +     Y  + ++ K T  ++VDN  +S     H+           + F  LD+  +  +I  + T  +WKT    L+ WVN++KN  FIF     + V   L  IA+  M++C+RT +K S +      K L+ KEI  + ++   + + +   V  +D+ M   + ++++ +   +  +N L  LH L
Sbjct: 1510 IPVKVLNCDTISQVKEKIIDQ-----------VYRGQPCSCWPRPDSVVLEWRPGSTAQILSDLDLTSQREGRWKRVNTLMHYNVRDGATLILSKVGVSQQPED-SQQDLPGER-----------------------------------HALLEEENR---VWHLVRPAEEVDEGKSKR-GSVKEKERTKAITEIYLTRLLSVKGTLQQFVDNFFHSVLAPGHA-----VPPAVKYFFDFLDEQAEKHNIQDEDTVHIWKTNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSVIAQTFMDACTRTEHKLSRDSP--SNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAH---TDSLNTLVALHQL 1827          
BLAST of Plexin-B2 vs. Ensembl Cavefish
Match: ENSAMXT00000046590.1 (pep primary_assembly:Astyanax_mexicanus-2.0:22:18585232:18670788:1 gene:ENSAMXG00000034599.1 transcript:ENSAMXT00000046590.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.1073 bits (196), Expect = 3.968e-15
Identity = 93/387 (24.03%), Postives = 168/387 (43.41%), Query Frame = 3
Query:  510 LEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNKTF-VSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTL-LATKKSLDPLISGLFHSIM-ETERREETK---YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKIS-DFLFTLLDDIGDSLSISQ-QTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRFLENSVH---ANDEKMILIMTDLTKKYFLNSYKINALKNLHFLSSSMSQ 1637
            + V VL+ D+I+QVK+KI+D         Y N+  Y     ++D   + LE    +T  V L+D D T     ++  +NT+ HY ++   ++ L   +T               SS  I      P + S+ D          +SA     ES    + + T  L +   +  L+    H    E ER  +     Y  + +  K T  ++VD++  +    +H G+    L ++  ++F  LD+  D   I     +  WK+ C  L+ WVN+IKN  F+F   KS      L  +A+  M+SCS + ++   +      K L+ K+I ++    +R+  +       +D+ M   + +  +   L+S++ N L  LH + + +S+
Sbjct: 1495 IPVKVLNCDTITQVKEKILDA-------VYKNI-PYSQRPRAVD---MDLEWRQGRTARVVLQDEDITTKIENDWKRLNTLVHYQVSDRCVVALVPKQT---------------SSYNISTSASFPRSFSRYDT-------VLRSASAGSPESMRSRAPMITPDLESGVKVWHLVKNHEHGDQKEAERGSKMVSEIYLTRLLATKGTLQKFVDDLFETLFSTVHRGS---ALPLAIKYMFDFLDEQADKHGIHDPDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKSSITDACLSVVAQTFMDSCSTSEHRLGKDSP--SNKLLYAKDIPHYKSWVERYYADISRLPAISDQDMNAYLAEQAR---LHSHEFNMLSALHEIYAYVSK 1840          
BLAST of Plexin-B2 vs. Ensembl Cavefish
Match: plxnb2a (plexin b2a [Source:ZFIN;Acc:ZDB-GENE-030131-8917])

HSP 1 Score: 76.6406 bits (187), Expect = 4.390e-14
Identity = 92/378 (24.34%), Postives = 160/378 (42.33%), Query Frame = 3
Query:  513 EVDVLSLDSISQVKQKIIDKAIVKHDETYTNV-YEYESTIASIDHREISLECFLNKTFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQS-RTREDFSMRELNNEFASS--SDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETER--REETKYSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSLSISQQTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQL---WKRFLENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFL 1619
             V VL+ D+ISQVK+KII+       + Y N+ Y    T+ S+     +LE     T   L D D T+     +  +NT+ HYN+     L LS+   T++ F   + ++E  S+   D    H+  P +    D +     +  K+   +I E       L  LL+ K +L   +   F S++ T        KY   F++ +  + E VD                                       ++T  +WKT    L+ WVN++KN  FIF    ++ V   L  IA+  M++C++T +K + E      K L+ KEI  + ++   + + +   V  +D+ M   + ++++ +   + K+N    LH L
Sbjct: 1479 PVKVLNCDTISQVKEKIIE-------QVYRNLPYSQRPTVDSV-----ALEWRPGSTGQILSDLDLTSQKEGRWKRLNTLAHYNVRDNATLVLSRVLHTQQSFDQNQDSHEERSALLEDDKVFHLVRPAD-ELDDVKSKRGSMKDKATTKAITEIY-----LTRLLSMKGTLQQFVDDFFRSVLCTGTVVPPAVKYFFDFLDEQAHKHENVD---------------------------------------EETIHIWKTNSLPLRFWVNILKNPHFIFDVHVTEVVDASLSVIAQTFMDACTKTEHKLTRESP--SNKLLYAKEISTYKKMVDDYYKGIRQMVSVSDQDMNTHLAEVSRSH---TEKLNTQVALHQL 1794          
BLAST of Plexin-B2 vs. Ensembl Cavefish
Match: plxnb1b (plexin b1b [Source:ZFIN;Acc:ZDB-GENE-090812-4])

HSP 1 Score: 73.9442 bits (180), Expect = 2.650e-13
Identity = 96/414 (23.19%), Postives = 162/414 (39.13%), Query Frame = 3
Query:  522 VLSLDSISQVKQKIID---KAIVKHDETYTNVYEYESTIASIDHREISLECFLNKTFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQSRTRE------DFSMRELNNEFASSSD---------RICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETKYSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSLSIS-QQTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRF---LENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFLSSSMSQKISKTT*KLSLFYNFIVTNL 1697
            VL  D+I+QVK+KI+D   K        +T+  + E       H             + L D D T+    N+  +NT++HY +  G  + L    ++       D+   E       + +         +     ELP     K RR    E  +  A   I         L  LL+ K +L   +  LF  I+ T R                       V  + K                + F LLDD      IS  +T  +WKT    L+ W+N++KN  FIF  + S +V   L  IA+  M+SC+   +K   +      K L+ ++I  + Q+ +R+   +  ++ A+D++M   + +L++ Y   S ++N L  LH L   +++           +Y+ I+T L
Sbjct: 1734 VLDCDTITQVKEKILDQVYKGTSYSHRPHTDSLDLEWRSGVAGH-------------LILSDEDLTSVVQGNWKRLNTLQHYKVPDGATVALVPRHSKHIHHDNHDYVAGEKTPMLEDADEGGVRLWHLVKASEEPELP-----KHRRGSLRERERAKAIPEIY--------LTRLLSMKGTLQKFVDDLFTVILSTSR----------------------PVPLAVK----------------YFFDLLDDQAAHHGISDSETIHIWKTNSLPLRFWINIVKNPQFIFDVQASDNVDAVLSVIAQTFMDSCTIAEHKLGRDSPIN--KLLYARDIPRYKQMVERYYADIRQTISASDQEMNSALAELSRNY---SGELNYLVALHELYKYINK-----------YYDQIITAL 2067          
BLAST of Plexin-B2 vs. Ensembl Cavefish
Match: plxna3 (plexin A3 [Source:NCBI gene;Acc:567422])

HSP 1 Score: 72.7886 bits (177), Expect = 6.346e-13
Identity = 81/352 (23.01%), Postives = 148/352 (42.05%), Query Frame = 3
Query:  510 LEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNK-TFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISG-------LFHSIMETE---RREETK--------YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKIS-DFLFTLLDDIGDSLSISQQ-TKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRF 1502
            + V VL+ D+++QVK K++D         Y  +   +   A     ++ LE    + T + L+D D T     ++  +NT+ HY +  G ++ L Q +     S   + N F  +                   R L       S + S++ +++    L       +S  P+I+        L+H +   E   +RE  +        Y  + +  K T  ++VD++  +     H G+    L ++  ++F  LD+  D   IS    +  WK+ C  L+ WVN+IKN  F+F   KS      L  +A+  M+SCS + ++   +      K L+ K+I N+    +R+
Sbjct:  819 VPVKVLNCDTVTQVKDKLLDA-------VYKGIPYSQRPQAD----DMDLEWRQGRLTRIILQDEDVTTKIESDWKRLNTLAHYQVTDGSVVALVQKQV----SAYNIANSFTFT-------------------RSL-------SRYESLLRTSSSPDSL-------RSRAPMITPDQETGTKLWHLVKNHEHADQREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETVFSTAHRGS---ALPLAIKYMFDFLDEQADKRQISDPDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKSSITDACLSVVAQTFMDSCSTSEHRLGKDSP--SNKLLYAKDIPNYKSWVERY 1117          
BLAST of Plexin-B2 vs. Ensembl Cavefish
Match: plxnb1a (plexin b1a [Source:ZFIN;Acc:ZDB-GENE-050302-63])

HSP 1 Score: 72.7886 bits (177), Expect = 7.257e-13
Identity = 60/240 (25.00%), Postives = 115/240 (47.92%), Query Frame = 3
Query: 1005 KKSLDPLISGLFHSIMETERREETK-----YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSLSISQ-QTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRF---LENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFLSSSMSQKISKTT*KLSLFYNFIVTNL 1697
            K + +P +S      +    RE  K     Y  + ++ K T  ++VD++       + S +    L +  + F LLDD     +I+  +T  +WKT    L+ W+N++KN  FIF  + S +V   L  IA+  M+SC+   +K   +      K L+ ++I  + Q+ +R+   +  ++ A+D++M   + +L++ Y   S ++N L  LH L   +++           +Y+ I+T L
Sbjct: 1861 KANEEPELSKHRRGSLRERERERAKAIPEIYLTRLLSMKGTLQKFVDDLFTV----ILSTSRPVPLAVK-YFFDLLDDQAAQHNITDPETIHIWKTNSLPLRFWINILKNPQFIFDVQASDNVDAVLSVIAQTFMDSCTIAEHKLGRDSPIN--KLLYARDIPRYKQMVERYYSDIRQTISASDQEMNSALAELSRNY---SSEVNHLVALHELYKYINK-----------YYDQIITAL 2079          
BLAST of Plexin-B2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007728.1 (pep scaffold:Pmarinus_7.0:GL483331:9686:16681:-1 gene:ENSPMAG00000006984.1 transcript:ENSPMAT00000007728.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.8474 bits (146), Expect = 1.131e-10
Identity = 40/144 (27.78%), Postives = 73/144 (50.69%), Query Frame = 3
Query: 1200 FLFTLLDDIGDSLSIS-QQTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRF---LENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFL 1619
            + F  LD+  +   I   +T  +WKT    L+ WVN++KN +F+F  + S  V   L  IA+  M+SC+    K   +    ++  L+ +EI  + ++ +++   +   V   DE M    T+L+++   NS  +N++  LH L
Sbjct:   55 YFFDFLDEAAERHGIEDPETIHIWKTNSLPLRFWVNILKNPNFVFDVQVSDIVDASLSVIAQTFMDSCTTQEQKLGRDSPINKL--LYAREISGYKKMVEKYYADIRQMVPVRDEDM---RTELSEESQNNSNDLNSMVALHEL 193          
BLAST of Plexin-B2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006110.1 (pep scaffold:Pmarinus_7.0:GL484765:748:3341:1 gene:ENSPMAG00000005524.1 transcript:ENSPMAT00000006110.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 3.978e-10
Identity = 37/143 (25.87%), Postives = 69/143 (48.25%), Query Frame = 3
Query: 1080 YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKIS-DFLFTLLDDIGDSLSI-SQQTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRF 1502
            Y  + +  K T  ++VD++  +     H G+    L ++  ++F  LD+  D  +I     +  WK+    L+ WVN+IKN  F+F   K+      L  +A+  M+SCS + ++   +      K L+ K+I N+    +R+
Sbjct:   70 YLTRLLATKGTLQKFVDDLFETIFSTAHRGS---ALPLAIKYMFDFLDEQADRHAIHDPAVRHTWKSNSLPLRFWVNVIKNPQFVFDIHKTSITDACLSVVAQTFMDSCSTSEHRLGKDSP--SNKLLYAKDIPNYKHWVERY 207          
BLAST of Plexin-B2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004433.1 (pep scaffold:Pmarinus_7.0:GL481384:28210:40565:1 gene:ENSPMAG00000004038.1 transcript:ENSPMAT00000004433.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.447 bits (119), Expect = 4.320e-7
Identity = 26/73 (35.62%), Postives = 42/73 (57.53%), Query Frame = 3
Query: 1200 FLFTLLDDIGDSLSI-SQQTKSLWKT-RCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTS 1412
            F F  L++  +S  I   +T  +WKT R   L+ WVN++KN  F+F  EK+  +   L  IA+  +++CS +S
Sbjct:  185 FFFDFLEEQAESRGIVDPETVHIWKTNRYLPLRFWVNILKNPQFVFDLEKTTHMDACLSVIAQAFIDACSLSS 257          
BLAST of Plexin-B2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009284.1 (pep scaffold:Pmarinus_7.0:GL476385:264710:288126:-1 gene:ENSPMAG00000008378.1 transcript:ENSPMAT00000009284.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 1.121e-6
Identity = 30/126 (23.81%), Postives = 61/126 (48.41%), Query Frame = 3
Query: 1251 QTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRF---LENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFL 1619
            +T  +WKT    L+ WVN++KN  F+F    S      L  IA+  M+SC+    K   +    ++  L+ +EI  + ++ +++   +      +D++M   + + ++    N  ++N +  LH L
Sbjct:  732 ETLHIWKTNSLPLRFWVNILKNPQFVFDVHVSDITDSALTVIAQTFMDSCTTVEQKLGRDSPINKL--LYAREIPRYKKMVEKYYADVRQMSPVSDQEMNAFLAEESRN---NGGELNTMVALHEL 852          
BLAST of Plexin-B2 vs. Ensembl Nematostella
Match: EDO39009 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBD7])

HSP 1 Score: 72.0182 bits (175), Expect = 4.456e-13
Identity = 86/348 (24.71%), Postives = 141/348 (40.52%), Query Frame = 3
Query:  516 VDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNKTFV-SLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNEFASSS-DRICVHVELPLN---ISKKDRRKLNA-----ELFKKSAFHSIVESTNKNSCLF-----TLLATKKSLDPLISGLFHSIMETERREETKYSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSLSIS-QQTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRFLEN 1511
            V VL  DS+SQ K K++D            VY+     + ++   + L+  L    V  L+D D+++     +  +NT+ HY +  G  L LS  ++    S      +    S  R+   V  P N   IS+  R  L+       L K   + +  + T  +  L       LLATK +L   + GLF+S+  +  R                                            +LF LLD     L++S  +    WK     L+ W+N++KN +FIF  EKS +V   L  IA++ M++CS + ++    +     K L+ KEI  + Q  ++F +N
Sbjct: 1512 VTVLDCDSVSQAKSKMLDA-----------VYKNVPFSSRVEAETLQLDWHLTDGSVKPLRDDDASSVVEGQWRKLNTLGHYKVTDGANLKLSPRQSYFYSSSNNSERQHHHRSLPRV---VFSPFNYTPISRGSREDLDEGGRIWHLVKLLDYPTDKDDTQHSKMLAEIYLTRLLATKGTLQQFVDGLFNSMFNSNCRPPVPVK--------------------------------------YLFDLLDSQAKELNLSDSEVLHTWKNNSLPLRFWINIVKNPNFIFDIEKSGTVDSCLSVIAQLFMDACSISEHRLG--IHSPSNKLLYAKEIPAYKQRVEQFYQN 1805          
BLAST of Plexin-B2 vs. Ensembl Medaka
Match: plxna3 (plexin A3 [Source:NCBI gene;Acc:101159802])

HSP 1 Score: 77.7962 bits (190), Expect = 1.918e-14
Identity = 87/399 (21.80%), Postives = 168/399 (42.11%), Query Frame = 3
Query:  516 VDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNK-TFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLIS-------GLFHSIM--ETERREETK--------YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKIS-DFLFTLLDDIGDSLSISQ-QTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRFLENSVHA---NDEKMILIMTDLTKKYFLNSYKINALKNLHFLSSSMSQKI 1643
            V VL+ D+++QVK K++D            VY+           ++ LE    + T + L+D D T     ++  +NT+ HY +  G ++ L Q +     S   + N F  +                   R L       S + S++ +++    L       +S  P+I+        L+H +   E ++RE  +        Y  + +  K T  ++VD++  +     H G+    L ++  ++F  LD+  D   IS    +  WK+ C  L+ WVN+IKN  F+F   K+      L  +A+  M+SCS + ++   +      K L+ K+I N+    +R+  +       +D+ M   + + ++ +      ++AL  L+F  +   ++I
Sbjct: 1520 VKVLNCDTVTQVKDKLLDA-----------VYKGIPFSQRPQADDMDLEWRQGRLTRIILQDEDVTTKIESDWKRLNTLAHYQVTDGSVVALVQKQV----SAYNIANSFTFT-------------------RSL-------SRYESLLRTSSSPDSL-------RSRAPMITPDQETGTKLWHLVKNHEHDQREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETVFSTAHRGS---ALPLAIKYMFDFLDEQADKRQISDPDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHRLGKDSP--SNKLLYAKDIPNYKSWVERYYRDITKMPSISDQDMDAYLVEQSRLHGNEFNTLSALNELYFYINKYKEEI 1865          
BLAST of Plexin-B2 vs. Ensembl Medaka
Match: plxna3 (plexin A3 [Source:NCBI gene;Acc:101159802])

HSP 1 Score: 77.411 bits (189), Expect = 2.648e-14
Identity = 87/399 (21.80%), Postives = 168/399 (42.11%), Query Frame = 3
Query:  516 VDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNK-TFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLIS-------GLFHSIM--ETERREETK--------YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKIS-DFLFTLLDDIGDSLSISQ-QTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRFLENSVHA---NDEKMILIMTDLTKKYFLNSYKINALKNLHFLSSSMSQKI 1643
            V VL+ D+++QVK K++D            VY+           ++ LE    + T + L+D D T     ++  +NT+ HY +  G ++ L Q +     S   + N F  +                   R L       S + S++ +++    L       +S  P+I+        L+H +   E ++RE  +        Y  + +  K T  ++VD++  +     H G+    L ++  ++F  LD+  D   IS    +  WK+ C  L+ WVN+IKN  F+F   K+      L  +A+  M+SCS + ++   +      K L+ K+I N+    +R+  +       +D+ M   + + ++ +      ++AL  L+F  +   ++I
Sbjct: 1470 VKVLNCDTVTQVKDKLLDA-----------VYKGIPFSQRPQADDMDLEWRQGRLTRIILQDEDVTTKIESDWKRLNTLAHYQVTDGSVVALVQKQV----SAYNIANSFTFT-------------------RSL-------SRYESLLRTSSSPDSL-------RSRAPMITPDQETGTKLWHLVKNHEHDQREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETVFSTAHRGS---ALPLAIKYMFDFLDEQADKRQISDPDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHRLGKDSP--SNKLLYAKDIPNYKSWVERYYRDITKMPSISDQDMDAYLVEQSRLHGNEFNTLSALNELYFYINKYKEEI 1815          
BLAST of Plexin-B2 vs. Ensembl Medaka
Match: plxnb2b (plexin-B2 [Source:NCBI gene;Acc:101169201])

HSP 1 Score: 73.559 bits (179), Expect = 4.207e-13
Identity = 93/375 (24.80%), Postives = 158/375 (42.13%), Query Frame = 3
Query:  516 VDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNKTFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQ-SRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLIS--GLFHSIMETERREETKYSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIG-DSLSISQQTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRFLEN---SVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFL 1619
            V VL+ D+ISQVK+KII+       + Y N+   +   A      ++LE     T   L D D T+     +  +NT+ HYN+     + LS+ S T  ++   + N+E                        + NA L     FH              L+   + LD   S  G       T+   E  Y  + ++ K T  ++VDN   S  C   SG          + F  LD+      ++ ++T  +WKT    L+ WVN++KN  FIF    S+ V   L  IA+  M++C+++ +K S +      K L+ KEI  + ++   + ++    V  +D+ M   + ++++ +   + K+N    LH L
Sbjct: 1484 VKVLNCDTISQVKEKIIE-------QVYRNLPYSQRPKAD----GVTLEWRPGSTGQILSDLDLTSQKEGRWRRINTLAHYNVRDNATVVLSKVSHTLHNYDQNQENHE------------------------ERNALLDDDKVFH--------------LVRPAEELDEFKSKRGSIKDKSMTKAITEI-YLTRLLSVKGTLQQFVDNFFRSVLC---SGAV--VPPAVKYFFDFLDEQALKHNNVDEETIHIWKTNSLPLRFWVNILKNPHFIFDVHVSEVVDASLSVIAQTFMDACTKSEHKLSRDSP--SNKLLYAKEISTYKKMVDDYYKDIRLMVPVSDQDMNTHLAEVSRSH---TSKLNTQVALHQL 1798          
BLAST of Plexin-B2 vs. Ensembl Medaka
Match: plxna2 (plexin-A2 [Source:NCBI gene;Acc:101158766])

HSP 1 Score: 71.2478 bits (173), Expect = 2.001e-12
Identity = 89/387 (23.00%), Postives = 167/387 (43.15%), Query Frame = 3
Query:  510 LEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNK-TFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDR--RKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETKYSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKIS-DFLFTLLDDIGDSLSI-SQQTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRFLENSVH---ANDEKMILIMTDLTKKYFLNSYKINALKNLHFLSSSMSQKIS 1646
            + V VL+ D+I+QVK+KI+D         Y N+  Y     ++D   + LE    +   V L+D D T     ++  +NT+ HY ++   ++ L   +T         N   ++S  R         +IS+ D   R   +    +S    I         ++ L+   +  D    G   S M +E      Y  + +  K T  ++VD++  +    +H G+    L ++  ++F  LD+  D  +I     +  WK+ C  L+ WVN+IKN  F+F   KS      L  +A+  M+SCS + ++   +      K L+ K+I N+    +R+  +       +D+ M   + +  + +      ++AL  ++   S  S++I+
Sbjct: 1583 IAVKVLNCDTITQVKEKILDA-------VYKNM-PYSQRPRAVD---MDLEWRQGRMARVVLQDEDITTKIENDWKRLNTLLHYQVSDRSVVALVPKQTSS------YNIPSSASISRT--------SISRYDSSFRYTGSPDSLRSRAPMITPDLESGVKVWHLVKNHEHGDQK-EGDRGSKMVSE-----IYLTRLLATKGTLQKFVDDLFETLFSTVHRGS---TLPLAIKYMFDFLDEQADKHAIYDTDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKSSITDACLSVVAQTFMDSCSTSEHRLGKDSP--SNKLLYAKDIPNYKSWVERYYADISRLPAISDQDMNAYLAEQARLHSTEFNMLSALNEIYSYVSKYSEEIT 1933          
BLAST of Plexin-B2 vs. Ensembl Medaka
Match: ENSORLT00000032559.1 (plexin-A1 [Source:NCBI gene;Acc:101175236])

HSP 1 Score: 70.4774 bits (171), Expect = 3.888e-12
Identity = 86/404 (21.29%), Postives = 168/404 (41.58%), Query Frame = 3
Query:  480 IRPMEIDIHNLEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNK-TFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKS--AFHSIVESTNKNSCLFTLLATKKSLDPLIS-------GLFHSIM---ETERREETK--------YSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKIS-DFLFTLLDDIGDSLSISQ-QTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRFLENSVHA---NDEKMILIMTDLTKKYFLNSYKINALKNLH 1613
            + P   +   + V  L+ D+I+QVK+K++D            VY+           ++ LE    +   + L+D D T     ++  +NT+ HY +    ++ L   +          N+ +               NIS       N+  F KS   + S++ + +    L       +S  P+I+        L+H +     +++RE  +        Y  + +  K T  ++VD++  +     H G+    L ++  ++F  LD+  D  SI+    +  WK+ C  L+ WVN+IKN  F+F   K+      L  +A+  M+SCS + +K   +      K L+ K+I N+    +R+  +       +D+ M   + + ++   L+  + N++  LH
Sbjct: 1503 VNPENENAPEVTVKCLNCDTITQVKEKLLDA-----------VYKGSPYSQRPKASDMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDSSVIALVPKQ----------NSAY---------------NIS-------NSSTFTKSLSRYESMLRTASSPDSL-------RSRTPMITPDLESGTKLWHLVKNHDHSDQREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGS---ALPLAIKYMFDFLDEQADKHSITDYDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHKLGKDSP--SNKLLYAKDIPNYKNWVERYYSDISRMPAISDQDMSAYLAEQSR---LHLSQFNSMSALH 1848          
BLAST of Plexin-B2 vs. Planmine SMEST
Match: SMESG000033322.1 (SMESG000033322.1)

HSP 1 Score: 823.157 bits (2125), Expect = 0.000e+0
Identity = 408/408 (100.00%), Postives = 408/408 (100.00%), Query Frame = 3
Query:  432 TIFINVKIQICLVDPRIRPMEIDIHNLEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNKTFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETKYSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSLSISQQTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRFLENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFLSSSMSQKISKTT 1655
            TIFINVKIQICLVDPRIRPMEIDIHNLEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNKTFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETKYSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSLSISQQTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRFLENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFLSSSMSQKISKTT
Sbjct:  454 TIFINVKIQICLVDPRIRPMEIDIHNLEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHREISLECFLNKTFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETKYSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSLSISQQTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRFLENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFLSSSMSQKISKTT 861          
BLAST of Plexin-B2 vs. Planmine SMEST
Match: SMESG000033280.1 (SMESG000033280.1)

HSP 1 Score: 174.866 bits (442), Expect = 4.191e-47
Identity = 136/395 (34.43%), Postives = 217/395 (54.94%), Query Frame = 3
Query:  432 TIFINVKIQICLVDPRIRPMEIDIHNLEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHRE-ISLECFLNKTFVSLKDFDSTNNTF---KNYILVNTMKHYNINSGQLLFLSQSRTREDFS---------MRELNNEFASSSDRICVHVELPL-NISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETKYSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSLSIS-QQTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDN-FSQLWKRFLENSVHANDEKMILIMTDLTKK 1568
            TI  +V++Q  +++     ++I + NL ++VLSLD+ISQVK KI+D+A ++H E   N   YE++   +++ + + L    + + + L DFDSTN++    K YI VNT KH+NI SG   FL  S++  D S          ++      +S + I  + +L   ++S+ + +K + EL        I E+ NK SCL  +LATKKSL+P I G F SI         K+ N F ++ ++  E        S+  +     D YL    + F++LDDI   L I+ Q+T  +WK+  FIL+ W+NLIKN +FIFS +++  +   L TIA VLM+SCS      + +   + +  LF +EI N +SQ WK F   +   N+E +I +MT++ +K
Sbjct:  219 TIQADVEVQFKMINSANGFIDIKLKNLSIEVLSLDTISQVKAKILDRAFMEHYEL-DNKCSYENSGIDLNNNDKLFLYFLSSSSKLLLSDFDSTNDSTVLDKEYIRVNTFKHFNIQSGSK-FLLCSKSENDLSSFSRISSQGPKKPYVHLQTSHETISPNFDLKFPSLSETNSKKPSVEL--------ISENINKESCLMLILATKKSLNPFIDGFFQSIFNW------KFQNHFNSSSNSLFESF------SESQIFFNAEDNYLLFVYYFFSMLDDIAKQLGITDQETTQIWKSNSFILRFWINLIKNPNFIFSIDRTDYIETNLTTIASVLMQSCSIGMKHINIDSPIITL--LFPQEIQNKYSQWWKYFANCTPFVNEEDIISMMTNIIEK 589          
BLAST of Plexin-B2 vs. Planmine SMEST
Match: SMESG000033280.1 (SMESG000033280.1)

HSP 1 Score: 174.866 bits (442), Expect = 4.634e-47
Identity = 136/395 (34.43%), Postives = 217/395 (54.94%), Query Frame = 3
Query:  432 TIFINVKIQICLVDPRIRPMEIDIHNLEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASIDHRE-ISLECFLNKTFVSLKDFDSTNNTF---KNYILVNTMKHYNINSGQLLFLSQSRTREDFS---------MRELNNEFASSSDRICVHVELPL-NISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETKYSNKFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSLSIS-QQTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDN-FSQLWKRFLENSVHANDEKMILIMTDLTKK 1568
            TI  +V++Q  +++     ++I + NL ++VLSLD+ISQVK KI+D+A ++H E   N   YE++   +++ + + L    + + + L DFDSTN++    K YI VNT KH+NI SG   FL  S++  D S          ++      +S + I  + +L   ++S+ + +K + EL        I E+ NK SCL  +LATKKSL+P I G F SI         K+ N F ++ ++  E        S+  +     D YL    + F++LDDI   L I+ Q+T  +WK+  FIL+ W+NLIKN +FIFS +++  +   L TIA VLM+SCS      + +   + +  LF +EI N +SQ WK F   +   N+E +I +MT++ +K
Sbjct:  245 TIQADVEVQFKMINSANGFIDIKLKNLSIEVLSLDTISQVKAKILDRAFMEHYEL-DNKCSYENSGIDLNNNDKLFLYFLSSSSKLLLSDFDSTNDSTVLDKEYIRVNTFKHFNIQSGSK-FLLCSKSENDLSSFSRISSQGPKKPYVHLQTSHETISPNFDLKFPSLSETNSKKPSVEL--------ISENINKESCLMLILATKKSLNPFIDGFFQSIFNW------KFQNHFNSSSNSLFESF------SESQIFFNAEDNYLLFVYYFFSMLDDIAKQLGITDQETTQIWKSNSFILRFWINLIKNPNFIFSIDRTDYIETNLTTIASVLMQSCSIGMKHINIDSPIITL--LFPQEIQNKYSQWWKYFANCTPFVNEEDIISMMTNIIEK 615          
BLAST of Plexin-B2 vs. Planmine SMEST
Match: SMESG000033328.1 (SMESG000033328.1)

HSP 1 Score: 173.326 bits (438), Expect = 8.885e-46
Identity = 136/405 (33.58%), Postives = 214/405 (52.84%), Query Frame = 3
Query:  432 TIFINVKIQICLVDPRIRPMEIDIHNLEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYES---TIASIDHREISLECFLNKTFVSLKDFDST---NNTFKNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETKYSNK--FINNKDTQMEYVDNVLYSSKC-NLHSGTF-DGYLKISDFLFTLLDDIGDSLSISQ-QTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEI-DNFSQLWKRFLENSVHANDEKMILIMTDLTKKYFLNSYKINALKNL 1610
            TI ++V + + L+D   +P+++     +VDVLSLDSISQVK KI+DKAI++  E     +  +     I+  D  +++L+       V L+D D +    N    Y  VNT+KHY I SG + FL  S +  D     L+        +I VH+++P++    D+    +    K     I   TNK S L  LL TKKSL P I G F S+   +  + TK S K  F+     + +  D++L  +   +  S +  D Y     +LF++LDDI  S  I+   T  +WK+  F+L+ W+N+IKN +FIF+ EKS      L T+A +LMESCS + NK+ D L    IKQLF+ ++ + +S  W+ FL+++   N +++   M D  +K  +  +  N L++L
Sbjct:  456 TIVVDVHVNLKLMDSSQKPLDVS-EKFDVDVLSLDSISQVKLKILDKAIMEFTEKENLQFSDDKINYAISKTDSNDLTLKLVTKTNHVPLEDLDYSTVIGNLNGEYTQVNTLKHYGIKSG-MQFLLTSVSIADSKCIPLSKPVIPPVKKI-VHLQMPVDFKCADKSGEISPSNMKLPITPINGETNKESYLMHLLGTKKSLSPFIDGFFQSLTNNKPLKFTKSSTKSLFLT---AESQITDSLLSQTDSFSADSPSIKDFYATPIYYLFSILDDIAKSQGITDDMTIQVWKSNSFVLRFWINIIKNPNFIFAIEKSYLFDGCLTTVASILMESCS-SGNKNVD-LNSPIIKQLFLDDVKEKYSIWWQSFLDSAYPVNKDEIAAFMNDTIEKNDMKEHYFNNLRSL 852          
BLAST of Plexin-B2 vs. Planmine SMEST
Match: SMESG000047160.1 (SMESG000047160.1)

HSP 1 Score: 169.859 bits (429), Expect = 3.231e-45
Identity = 136/414 (32.85%), Postives = 216/414 (52.17%), Query Frame = 3
Query:  441 INVKIQICLVDPRIRPMEIDIHNLEVDVLSLDSISQVKQKIIDKAIV---KHDETYTNVYEYESTIASIDHREISLECFLNKTFVSLKDFDSTN-NTF--KNYILVNTMKHYNINSGQLLFLSQSRTREDFSMRELNNEFASSSDRICVHVELP--LNISKKDRRKLNAELFKKSAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETKYSNKFINNKDTQMEYVDNVLYS-------SKCNLHSGTFDGYLKISDFLFTLLDDIGDSLSI-SQQTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVLMESCSRTSNKSSDELEFVEIKQLFIKEIDN-FSQLWKRFLENSVHANDEKMILIMTDLTKKYFLNSYKINALKNLHFLSSSM 1631
            +NVK++I L++     + I++  + V +LSLDSISQ+K+KIIDKAI+   K +    +  +    IA I H    L    +   + L DFD T+   F  K  I++NT KHYNI SG  L L+Q  +        +N      ++ + +H+++P   N   K+      +   K  F+ I E+TNK++ LF L+ATKKSL PLI G   SI   +   E   +   ++N ++  E +   L +       S+ NL +      +K   ++F+L D+I  SL I      +LWK+ C+I Q+W N ++N D IF      +V   L TI+ +L ESC   S  S  E++   IKQ+F+ +I N +S  W+ F+      +DE+M  I++++ +K  L  YK  +LK L  LS ++
Sbjct:  242 VNVKVKISLMNGE--ELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKCFIDKRCIIINTAKHYNIKSGTKLLLTQD-SMMSIGFSPVNKRNFQPNNDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTN------MKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQEKVSDEEMANILSEIVQKNQLYRYKSISLKVLQMLSKTL 646          
The following BLAST results are available for this feature:
BLAST of Plexin-B2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLXNB26.221e-1825.33plexin B2 [Source:HGNC Symbol;Acc:HGNC:9104][more]
PLXNB26.221e-1825.33plexin B2 [Source:HGNC Symbol;Acc:HGNC:9104][more]
PLXNA31.506e-1422.77plexin A3 [Source:HGNC Symbol;Acc:HGNC:9101][more]
PLXNA19.137e-1323.68plexin A1 [Source:HGNC Symbol;Acc:HGNC:9099][more]
PLXNB39.568e-1221.12plexin B3 [Source:HGNC Symbol;Acc:HGNC:9105][more]
back to top
BLAST of Plexin-B2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plx-11.466e-1023.76PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90][more]
plx-15.427e-1024.04PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90][more]
plx-13.678e-923.42PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90][more]
plx-13.732e-923.42PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90][more]
plx-16.590e-923.08PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90][more]
back to top
BLAST of Plexin-B2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PlexA2.687e-1124.93gene:FBgn0025741 transcript:FBtr0089224[more]
PlexA2.687e-1124.93gene:FBgn0025741 transcript:FBtr0089225[more]
PlexA3.519e-1124.93gene:FBgn0025741 transcript:FBtr0089223[more]
PlexB7.044e-1132.17gene:FBgn0025740 transcript:FBtr0308297[more]
PlexB7.044e-1132.17gene:FBgn0025740 transcript:FBtr0089179[more]
back to top
BLAST of Plexin-B2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plxnb2a1.868e-1523.21plexin b2a [Source:ZFIN;Acc:ZDB-GENE-030131-8917][more]
plxnb2a4.402e-1524.57plexin b2a [Source:ZFIN;Acc:ZDB-GENE-030131-8917][more]
plxnb2a4.402e-1524.57plexin b2a [Source:ZFIN;Acc:ZDB-GENE-030131-8917][more]
plxnb2a6.136e-1524.57plexin b2a [Source:ZFIN;Acc:ZDB-GENE-030131-8917][more]
plxna32.503e-1422.66plexin A3 [Source:NCBI gene;Acc:567422][more]
back to top
BLAST of Plexin-B2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLXNB22.433e-1425.73plexin B2 [Source:NCBI gene;Acc:550076][more]
PLXNB22.473e-1425.73plexin B2 [Source:NCBI gene;Acc:550076][more]
PLXNB22.618e-1425.73plexin B2 [Source:NCBI gene;Acc:550076][more]
PLXNB22.774e-1425.73plexin B2 [Source:NCBI gene;Acc:550076][more]
PLXNB22.815e-1425.73plexin B2 [Source:NCBI gene;Acc:550076][more]
back to top
BLAST of Plexin-B2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Plxnb26.157e-1825.13plexin B2 [Source:MGI Symbol;Acc:MGI:2154239][more]
Plxnb26.157e-1825.13plexin B2 [Source:MGI Symbol;Acc:MGI:2154239][more]
Plxna37.785e-1421.63plexin A3 [Source:MGI Symbol;Acc:MGI:107683][more]
Plxna11.175e-1223.43plexin A1 [Source:MGI Symbol;Acc:MGI:107685][more]
Plxna11.175e-1223.43plexin A1 [Source:MGI Symbol;Acc:MGI:107685][more]
back to top
BLAST of Plexin-B2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O15031|PLXB2_HUMAN2.988e-1725.33Plexin-B2 OS=Homo sapiens OX=9606 GN=PLXNB2 PE=1 S... [more]
sp|B2RXS4|PLXB2_MOUSE4.269e-1725.13Plexin-B2 OS=Mus musculus OX=10090 GN=Plxnb2 PE=1 ... [more]
sp|P51805|PLXA3_HUMAN7.234e-1422.77Plexin-A3 OS=Homo sapiens OX=9606 GN=PLXNA3 PE=1 S... [more]
sp|B0S5N4|PLXA3_DANRE1.873e-1322.66Plexin A3 OS=Danio rerio OX=7955 GN=plxna3 PE=2 SV... [more]
sp|P70208|PLXA3_MOUSE5.446e-1321.63Plexin-A3 OS=Mus musculus OX=10090 GN=Plxna3 PE=1 ... [more]
back to top
BLAST of Plexin-B2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0K0LJ731.878e-2832.09Plexin B-4 (Fragment) OS=Schmidtea mediterranea OX... [more]
U3E6J79.027e-1725.86Plexin-B2 OS=Callithrix jacchus OX=9483 GN=PLXNB2 ... [more]
A0A2K5LGS11.524e-1525.13Plexin B2 OS=Cercocebus atys OX=9531 GN=PLXNB2 PE=... [more]
A0A2K5D2V31.981e-1525.33Plexin B2 OS=Aotus nancymaae OX=37293 GN=PLXNB2 PE... [more]
A0A2K5D2T01.990e-1525.33Plexin B2 OS=Aotus nancymaae OX=37293 GN=PLXNB2 PE... [more]
back to top
BLAST of Plexin-B2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000046590.13.968e-1524.03pep primary_assembly:Astyanax_mexicanus-2.0:22:185... [more]
plxnb2a4.390e-1424.34plexin b2a [Source:ZFIN;Acc:ZDB-GENE-030131-8917][more]
plxnb1b2.650e-1323.19plexin b1b [Source:ZFIN;Acc:ZDB-GENE-090812-4][more]
plxna36.346e-1323.01plexin A3 [Source:NCBI gene;Acc:567422][more]
plxnb1a7.257e-1325.00plexin b1a [Source:ZFIN;Acc:ZDB-GENE-050302-63][more]
back to top
BLAST of Plexin-B2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000007728.11.131e-1027.78pep scaffold:Pmarinus_7.0:GL483331:9686:16681:-1 g... [more]
ENSPMAT00000006110.13.978e-1025.87pep scaffold:Pmarinus_7.0:GL484765:748:3341:1 gene... [more]
ENSPMAT00000004433.14.320e-735.62pep scaffold:Pmarinus_7.0:GL481384:28210:40565:1 g... [more]
ENSPMAT00000009284.11.121e-623.81pep scaffold:Pmarinus_7.0:GL476385:264710:288126:-... [more]
back to top
BLAST of Plexin-B2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Plexin-B2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO390094.456e-1324.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Plexin-B2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plxna31.918e-1421.80plexin A3 [Source:NCBI gene;Acc:101159802][more]
plxna32.648e-1421.80plexin A3 [Source:NCBI gene;Acc:101159802][more]
plxnb2b4.207e-1324.80plexin-B2 [Source:NCBI gene;Acc:101169201][more]
plxna22.001e-1223.00plexin-A2 [Source:NCBI gene;Acc:101158766][more]
ENSORLT00000032559.13.888e-1221.29plexin-A1 [Source:NCBI gene;Acc:101175236][more]
back to top
BLAST of Plexin-B2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033322.10.000e+0100.00SMESG000033322.1[more]
SMESG000033280.14.191e-4734.43SMESG000033280.1[more]
SMESG000033280.14.634e-4734.43SMESG000033280.1[more]
SMESG000033328.18.885e-4633.58SMESG000033328.1[more]
SMESG000047160.13.231e-4532.85SMESG000047160.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013972 ID=SMED30013972|Name=Plexin-B2|organism=Schmidtea mediterranea sexual|type=transcript|length=1703bp
GTTAGTAAAATTATATTTTTTTAAAGATATTATATTTTGATAATAATTTT
TACAAACTAATAATTCTTAATATCTTTTATTCAGAGGTTCCCAAAAAGTG
AGACGAAACCCGTTGGTGGGTAGCGATTAATATTTAAAACATTTTTTGCA
TAAGTGGGGATTTTGCGCAAATAATCTAAAATCTTTATATTTTATAACAG
CGAATTGCGAAAAATTTGTATTTTTACAGATGGGTCCCAGTAGCCGAAAT
TTTGAAATCCCTCGATTTGAATTATATATAAATTCAAAGAAAAACAATAT
ATCATTGATCAATCACTATTGGAAAGGAAAGTAAAAAAGTAAAGTTTTCA
AAGTCTCACTTTGTTGTATGAGTTTTTGCCAAAAATGGAGGAGCAGTAAA
TAAAAGAAAAAAGATAAATTCATATTTGTAGACCATATTTATCAATGTGA
AAATCCAAATTTGCCTTGTGGATCCAAGAATACGTCCAATGGAAATTGAT
ATTCATAACTTAGAAGTCGATGTTCTTTCTTTGGATAGCATTTCTCAGGT
GAAACAGAAAATAATTGATAAGGCAATCGTAAAACATGATGAAACTTACA
CAAATGTTTACGAATATGAATCGACTATTGCTTCGATTGACCACAGAGAA
ATCTCTTTGGAATGCTTTTTGAACAAGACTTTTGTATCTCTCAAGGATTT
TGATTCAACAAATAACACATTCAAAAATTACATTTTGGTGAACACAATGA
AACATTACAATATTAATTCTGGGCAGCTGCTATTCCTAAGTCAAAGCAGA
ACTAGAGAAGACTTTTCAATGCGTGAGTTGAATAATGAATTTGCGAGTTC
CTCGGATAGAATCTGTGTACACGTCGAATTGCCACTGAATATTTCAAAGA
AGGATCGAAGAAAGCTTAACGCTGAATTATTTAAAAAATCAGCATTTCAT
TCGATAGTTGAAAGCACCAACAAAAATTCATGTTTATTTACTTTATTGGC
TACAAAAAAATCTTTGGACCCCTTAATTTCTGGGCTTTTCCATTCGATAA
TGGAGACAGAAAGAAGAGAAGAAACAAAATATTCAAATAAATTCATAAAT
AATAAAGATACTCAAATGGAATATGTAGACAACGTTCTTTATTCATCAAA
ATGTAATTTGCATTCTGGCACTTTTGACGGATATTTAAAAATCTCTGACT
TCTTATTTACTTTACTTGATGATATAGGAGATTCTCTATCAATAAGTCAA
CAAACCAAAAGTTTATGGAAAACTAGATGTTTCATTCTTCAAATTTGGGT
AAATCTGATCAAAAATGCAGACTTTATTTTTTCATTTGAAAAATCTCAAT
CAGTTCACGAAGGCTTAATAACAATTGCAAAGGTTTTGATGGAATCCTGT
TCTAGAACTTCAAATAAAAGCTCAGACGAATTAGAATTTGTTGAGATTAA
GCAATTATTTATAAAGGAAATTGATAATTTTTCACAATTATGGAAAAGAT
TTCTTGAAAATTCGGTTCATGCAAATGATGAAAAAATGATATTAATCATG
ACAGACTTGACAAAAAAATATTTTTTGAATTCATACAAAATTAATGCACT
GAAGAATTTGCACTTTCTGTCGAGTTCTATGTCCCAAAAAATTTCAAAAA
CAACGTGAAAGCTTTCTCTTTTTTATAACTTTATCGTTACAAATTTATTA
AAA
back to top

protein sequence of SMED30013972-orf-1

>SMED30013972-orf-1 ID=SMED30013972-orf-1|Name=SMED30013972-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=390bp
MEIDIHNLEVDVLSLDSISQVKQKIIDKAIVKHDETYTNVYEYESTIASI
DHREISLECFLNKTFVSLKDFDSTNNTFKNYILVNTMKHYNINSGQLLFL
SQSRTREDFSMRELNNEFASSSDRICVHVELPLNISKKDRRKLNAELFKK
SAFHSIVESTNKNSCLFTLLATKKSLDPLISGLFHSIMETERREETKYSN
KFINNKDTQMEYVDNVLYSSKCNLHSGTFDGYLKISDFLFTLLDDIGDSL
SISQQTKSLWKTRCFILQIWVNLIKNADFIFSFEKSQSVHEGLITIAKVL
MESCSRTSNKSSDELEFVEIKQLFIKEIDNFSQLWKRFLENSVHANDEKM
ILIMTDLTKKYFLNSYKINALKNLHFLSSSMSQKISKTT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0006516glycoprotein catabolic process
GO:0071526semaphorin-plexin signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005615extracellular space
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR031148Plexin
IPR031146Invert_Plexin-B
IPR013548Plexin_cytoplasmic_RasGAP_dom
IPR014760Serum_albumin_N
IPR006588Peptide_N_glycanase_PAW_dom
Vocabulary: molecular function
TermDefinition
GO:0017154semaphorin receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 2..129
e-value: 8.0E-13
score: 50.2
NoneNo IPR availableGENE3DG3DSA:1.10.506.10coord: 192..388
e-value: 4.4E-20
score: 73.8
IPR013548Plexin, cytoplasmic RasGAP domainPFAMPF08337Plexin_cytoplcoord: 6..375
e-value: 8.9E-33
score: 113.8
IPR031148Plexin familyPANTHERPTHR22625PLEXINcoord: 10..385
IPR031146Invertebrate plexin-BPANTHERPTHR22625:SF58PLEXIN-Bcoord: 10..385