slc39a-13

Overview
Nameslc39a-13 (AKN21678.1)
Smed IDSMED30013960
Length (bp)1326
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc39a-13 (SMED30013960) t-SNE clustered cells

Violin plots show distribution of expression levels for slc39a-13 (SMED30013960) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc39a-13 (SMED30013960) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc39a-13 (SMED30013960) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013960

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30013960SMESG000081891.1 SMESG000049864.1 SMESG000042571.1 Contig5795GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013960SMESG000069905.1 Contig5795GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30013960SMESG000069905.1 dd_Smed_v4_5702_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30013960SMESG000069905.1 dd_Smed_v6_5702_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc39a-13 vs. Ensembl Human
Match: SLC39A1 (solute carrier family 39 member 1 [Source:HGNC Symbol;Acc:HGNC:12876])

HSP 1 Score: 154.451 bits (389), Expect = 1.396e-42
Identity = 97/319 (30.41%), Postives = 160/319 (50.16%), Query Frame = 1
Query:  307 VNKTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLFIH 1263
            + +   N +        LS ++CFAGGVFL+T  +D+ P+ L +I+EA     +T  FPL  F+  +GFF++L++E++    K +   S +  T+ ++          N  P            +   D   V +                         +    +   L   +L+ ++++HS+FEGLA+GLQ++ + A  L LAL LHK I+A ++SL+L +S L  ++   C  +FS  TP G+ LG     L E+      +   VL+G+A GTF YI F EILP+E    + +ILK++ ++ GFAL++  +LFI 
Sbjct:   52 LRRPGANHEGSASRQKALSLVSCFAGGVFLATCLLDLLPDYLAAIDEALAALHVTLQFPLQEFILAMGFFLVLVMEQITLAYKEQSGPSPLEETRALLGT-------VNGGP------------QHWHDGPGVPQA------------------------SGAPATPSALRACVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILAVSLSLRLLQSHLRAQVVAGCGILFSCMTPLGIGLG---AALAESAGPLHQLAQSVLEGMAAGTFLYITFLEILPQELASSEQRILKVILLLAGFALLT-GLLFIQ 323          
BLAST of slc39a-13 vs. Ensembl Human
Match: SLC39A1 (solute carrier family 39 member 1 [Source:HGNC Symbol;Acc:HGNC:12876])

HSP 1 Score: 154.451 bits (389), Expect = 1.396e-42
Identity = 97/319 (30.41%), Postives = 160/319 (50.16%), Query Frame = 1
Query:  307 VNKTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLFIH 1263
            + +   N +        LS ++CFAGGVFL+T  +D+ P+ L +I+EA     +T  FPL  F+  +GFF++L++E++    K +   S +  T+ ++          N  P            +   D   V +                         +    +   L   +L+ ++++HS+FEGLA+GLQ++ + A  L LAL LHK I+A ++SL+L +S L  ++   C  +FS  TP G+ LG     L E+      +   VL+G+A GTF YI F EILP+E    + +ILK++ ++ GFAL++  +LFI 
Sbjct:   52 LRRPGANHEGSASRQKALSLVSCFAGGVFLATCLLDLLPDYLAAIDEALAALHVTLQFPLQEFILAMGFFLVLVMEQITLAYKEQSGPSPLEETRALLGT-------VNGGP------------QHWHDGPGVPQA------------------------SGAPATPSALRACVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILAVSLSLRLLQSHLRAQVVAGCGILFSCMTPLGIGLG---AALAESAGPLHQLAQSVLEGMAAGTFLYITFLEILPQELASSEQRILKVILLLAGFALLT-GLLFIQ 323          
BLAST of slc39a-13 vs. Ensembl Human
Match: SLC39A1 (solute carrier family 39 member 1 [Source:HGNC Symbol;Acc:HGNC:12876])

HSP 1 Score: 154.451 bits (389), Expect = 1.396e-42
Identity = 97/319 (30.41%), Postives = 160/319 (50.16%), Query Frame = 1
Query:  307 VNKTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLFIH 1263
            + +   N +        LS ++CFAGGVFL+T  +D+ P+ L +I+EA     +T  FPL  F+  +GFF++L++E++    K +   S +  T+ ++          N  P            +   D   V +                         +    +   L   +L+ ++++HS+FEGLA+GLQ++ + A  L LAL LHK I+A ++SL+L +S L  ++   C  +FS  TP G+ LG     L E+      +   VL+G+A GTF YI F EILP+E    + +ILK++ ++ GFAL++  +LFI 
Sbjct:   52 LRRPGANHEGSASRQKALSLVSCFAGGVFLATCLLDLLPDYLAAIDEALAALHVTLQFPLQEFILAMGFFLVLVMEQITLAYKEQSGPSPLEETRALLGT-------VNGGP------------QHWHDGPGVPQA------------------------SGAPATPSALRACVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILAVSLSLRLLQSHLRAQVVAGCGILFSCMTPLGIGLG---AALAESAGPLHQLAQSVLEGMAAGTFLYITFLEILPQELASSEQRILKVILLLAGFALLT-GLLFIQ 323          
BLAST of slc39a-13 vs. Ensembl Human
Match: SLC39A1 (solute carrier family 39 member 1 [Source:HGNC Symbol;Acc:HGNC:12876])

HSP 1 Score: 154.451 bits (389), Expect = 1.396e-42
Identity = 97/319 (30.41%), Postives = 160/319 (50.16%), Query Frame = 1
Query:  307 VNKTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLFIH 1263
            + +   N +        LS ++CFAGGVFL+T  +D+ P+ L +I+EA     +T  FPL  F+  +GFF++L++E++    K +   S +  T+ ++          N  P            +   D   V +                         +    +   L   +L+ ++++HS+FEGLA+GLQ++ + A  L LAL LHK I+A ++SL+L +S L  ++   C  +FS  TP G+ LG     L E+      +   VL+G+A GTF YI F EILP+E    + +ILK++ ++ GFAL++  +LFI 
Sbjct:   52 LRRPGANHEGSASRQKALSLVSCFAGGVFLATCLLDLLPDYLAAIDEALAALHVTLQFPLQEFILAMGFFLVLVMEQITLAYKEQSGPSPLEETRALLGT-------VNGGP------------QHWHDGPGVPQA------------------------SGAPATPSALRACVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILAVSLSLRLLQSHLRAQVVAGCGILFSCMTPLGIGLG---AALAESAGPLHQLAQSVLEGMAAGTFLYITFLEILPQELASSEQRILKVILLLAGFALLT-GLLFIQ 323          
BLAST of slc39a-13 vs. Ensembl Human
Match: SLC39A1 (solute carrier family 39 member 1 [Source:HGNC Symbol;Acc:HGNC:12876])

HSP 1 Score: 154.451 bits (389), Expect = 1.396e-42
Identity = 97/319 (30.41%), Postives = 160/319 (50.16%), Query Frame = 1
Query:  307 VNKTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLFIH 1263
            + +   N +        LS ++CFAGGVFL+T  +D+ P+ L +I+EA     +T  FPL  F+  +GFF++L++E++    K +   S +  T+ ++          N  P            +   D   V +                         +    +   L   +L+ ++++HS+FEGLA+GLQ++ + A  L LAL LHK I+A ++SL+L +S L  ++   C  +FS  TP G+ LG     L E+      +   VL+G+A GTF YI F EILP+E    + +ILK++ ++ GFAL++  +LFI 
Sbjct:   52 LRRPGANHEGSASRQKALSLVSCFAGGVFLATCLLDLLPDYLAAIDEALAALHVTLQFPLQEFILAMGFFLVLVMEQITLAYKEQSGPSPLEETRALLGT-------VNGGP------------QHWHDGPGVPQA------------------------SGAPATPSALRACVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILAVSLSLRLLQSHLRAQVVAGCGILFSCMTPLGIGLG---AALAESAGPLHQLAQSVLEGMAAGTFLYITFLEILPQELASSEQRILKVILLLAGFALLT-GLLFIQ 323          
BLAST of slc39a-13 vs. Ensembl Celegans
Match: zipt-1 (Zrt (ZRT), Irt-(IRT-) like Protein Transporter [Source:UniProtKB/TrEMBL;Acc:O62192])

HSP 1 Score: 122.865 bits (307), Expect = 1.905e-31
Identity = 94/355 (26.48%), Postives = 160/355 (45.07%), Query Frame = 1
Query:  205 KLGMAAALLVSVFIVTLIPFIVIRHLSKKWGIESVNKTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSF-SMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLFIHE 1266
            K  + A LL+ +F +T    ++   L  +W    +                LS I+C  GGVFL    +D+ P+ +ES E+ KI  +    FP+      +GF ++L I+++V   K+R     V                      S  +E+    D ES++                                 EA ++ ++ V +L++A+S+H++FEGL+L +  + S   ++F AL LHK I+   + ++L +++L      L   +FS     G + G  +      G  SF ++V+ +LQ IACGTF YI  FE++P E    + +ILK+  + +GFA+V  F+L   E
Sbjct:   29 KDALRAVLLIVLFALTFAAGMIATFLKGEWARSHI----------------LSFISCIGGGVFLGACLLDLLPDSIESFEKTKIATE----FPVPLAFVAVGFLLVLTIDQVVKAAKDRNVFGHV-----------------GYHIHSHNHEHQRSEDGESQEEGD------------------------------EAAAQSSIGVAMLVLALSVHALFEGLSLAVTSDASQLLQIFGALILHKCIMGFCLGVRLVQANLTTPWIALAQFLFSVQVLIGGLAGIGIMKFISGGEQSFAAIVSSILQAIACGTFLYITTFEVIPHELHNGKYRILKMFFIYMGFAIVVAFILIFPE 316          
BLAST of slc39a-13 vs. Ensembl Celegans
Match: zipt-2.1 (Zrt (ZRT), Irt-(IRT-) like Protein Transporter [Source:UniProtKB/TrEMBL;Acc:Q6BEU0])

HSP 1 Score: 108.227 bits (269), Expect = 6.801e-26
Identity = 86/312 (27.56%), Postives = 140/312 (44.87%), Query Frame = 1
Query:  355 WLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVS----PTKVVINDEFIMPTESNAWPSSAVNEN-TFDFDKESRDS---NQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCS-GIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGV--LQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLF 1257
            WLS ++CF+GGVF++T F+D+ P + ++  E      +    P+      +GFF + +IEE+   +              P  V I  E +   +     SS+  E      D  +R S    +    V  D +                        R  L      IA+S HS+ EG ALG+Q   +A   LFL+L LHK I A ++ LQ+S+++   K   +C+  +++  TP G VLG     L+  G+ SF     +  L+ +A GTF Y+ F EIL  E   + + + +++ + LGF ++     F
Sbjct:   47 WLSYLSCFSGGVFMATCFLDVMPHVQQTYGEILETYNVEFRLPMNQLFICVGFFFVYLIEEITAKVFGSGGHGHSHGPPIPLTVDIKKEKVTRVQLIENGSSSSPETLMIPIDSRTRHSLVVEETAPWVVSDEK------------------------RNLLKSLTFAIAMSFHSLLEGFALGVQDSDAAIWTLFLSLLLHKSIEAFSVGLQISRANTEKKGIVMCTILVYALMTPLGSVLG---TLLQNTGDKSFGKDCTIVFLEAMAAGTFIYVTFLEILAAEKENRFNSLKQLLCIGLGFMVILALQFF 331          
BLAST of slc39a-13 vs. Ensembl Celegans
Match: zipt-2.1 (Zrt (ZRT), Irt-(IRT-) like Protein Transporter [Source:UniProtKB/TrEMBL;Acc:Q6BEU0])

HSP 1 Score: 108.227 bits (269), Expect = 6.801e-26
Identity = 86/312 (27.56%), Postives = 140/312 (44.87%), Query Frame = 1
Query:  355 WLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVS----PTKVVINDEFIMPTESNAWPSSAVNEN-TFDFDKESRDS---NQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCS-GIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGV--LQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLF 1257
            WLS ++CF+GGVF++T F+D+ P + ++  E      +    P+      +GFF + +IEE+   +              P  V I  E +   +     SS+  E      D  +R S    +    V  D +                        R  L      IA+S HS+ EG ALG+Q   +A   LFL+L LHK I A ++ LQ+S+++   K   +C+  +++  TP G VLG     L+  G+ SF     +  L+ +A GTF Y+ F EIL  E   + + + +++ + LGF ++     F
Sbjct:   47 WLSYLSCFSGGVFMATCFLDVMPHVQQTYGEILETYNVEFRLPMNQLFICVGFFFVYLIEEITAKVFGSGGHGHSHGPPIPLTVDIKKEKVTRVQLIENGSSSSPETLMIPIDSRTRHSLVVEETAPWVVSDEK------------------------RNLLKSLTFAIAMSFHSLLEGFALGVQDSDAAIWTLFLSLLLHKSIEAFSVGLQISRANTEKKGIVMCTILVYALMTPLGSVLG---TLLQNTGDKSFGKDCTIVFLEAMAAGTFIYVTFLEILAAEKENRFNSLKQLLCIGLGFMVILALQFF 331          
BLAST of slc39a-13 vs. Ensembl Celegans
Match: zipt-2.3 (Zrt (ZRT), Irt-(IRT-) like Protein Transporter [Source:UniProtKB/TrEMBL;Acc:Q9XWH3])

HSP 1 Score: 100.908 bits (250), Expect = 1.625e-23
Identity = 96/358 (26.82%), Postives = 161/358 (44.97%), Query Frame = 1
Query:  202 VKLGMAAALLVSVFIVTLIPFIVIRHLSKKWGIESVNKTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESN-AWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMI-AISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKS----SLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLF 1257
            + LG+ A + +   I  L+P  VI +L         N T+  S  ++  +  LS  +CFAGGVFLS  F+D+ P+ LE+ E  +     TS +P    + L+GFF + + EEL + I N  +G   S      ND  +   ESN  +P + +      F+ E        + +                       N +    G +  +I+   A  +H  FE  A G+Q++  + T +FL + +HK I+  ++ ++L+++    S  + +  L   +F+     G   G  ++    N  T   +   VL   + GTF YI FFEIL  E       IL+ +A   GFAL+++ M++
Sbjct:    9 IMLGVMALMTI---IFGLLPIKVISYL---------NTTK--SAIHQHSSLILSLFSCFAGGVFLSVCFLDMLPDCLEAWESVQTDTNYTSDYPFVQLIALLGFFFVYLTEELSSVICNVGHGHSHS------NDPIM---ESNVTFPRARLATVGSIFNVEGNLVEPCKRSLE----------------------NYDDDGEGPVRQSIIFTSAFILHVFFECFAFGIQEDAVSVTSIFLGIAMHKAIVMFSLGMKLTRTHPRRSWIVVILILVLALFNV---IGGTAGILISSSNMN-QTPKDITTAVLMSFSLGTFLYISFFEILAPERANNHSNILQWIASFGGFALLAVNMIW 317          
BLAST of slc39a-13 vs. Ensembl Celegans
Match: zipt-2.2 (Zrt (ZRT), Irt-(IRT-) like Protein Transporter [Source:UniProtKB/TrEMBL;Acc:Q19913])

HSP 1 Score: 94.7449 bits (234), Expect = 3.278e-21
Identity = 95/353 (26.91%), Postives = 159/353 (45.04%), Query Frame = 1
Query:  214 MAAALLVSVFIVTLIPFIVIRHLSKKWGIESVNKTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLS-KSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLFI-HE 1266
            +A A+ V    + ++P  ++R + +     S N++ +          +LS + CFAGGVFL+T F+DI P + E  EE      +   F    F+T  GFF I  IEE  TF+    +G+   P               +    S    N      + R S  + K    +R+   +  +    +     ++ E      L      +A+S HS+ EG ALG+Q        LF +L LHK + A ++ LQ+S  +S  +K       I+S   P G ++G  +   E N     +++  +L+ +A GTF Y+ F EI+  E     + + +++ +I+GFALV+   +F  HE
Sbjct:   11 LAFAMFVVTAAIGIVPLFIVRVMKR-----SQNESEQG---------YLSYLTCFAGGVFLATCFLDIIPHINEGYEELMETYDLNWHFAYPQFVTCCGFFFIYFIEEFTTFV----FGNGQQP--------------GHGHSHSLNKGNKITTTSDGRLSPGMPK----ERKGSVNITNLRMEEASTWVVSDE--KSNILKSLTFAVAMSFHSLLEGFALGVQDSKGRIYALFFSLLLHKGVEAFSVGLQISMANSNKVKTVLATILIYSLMAPLGSIMGSILQNSETNIYKDCAIL--LLESLAAGTFIYVTFIEIMASEKSNDFNHLKQLLWIIIGFALVTTMQVFFGHE 323          
BLAST of slc39a-13 vs. Ensembl Fly
Match: Zip89B (gene:FBgn0038412 transcript:FBtr0083266)

HSP 1 Score: 106.301 bits (264), Expect = 1.723e-24
Identity = 95/347 (27.38%), Postives = 165/347 (47.55%), Query Frame = 1
Query:  256 IPFIVIRHLSKKWGIESVNKTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAK---IKNKMTSVFPLGPFLTLIGFFMILIIEE-LVTFIKNRF---YGSKVSPTKVVINDEFIMPTESN--------------AWPSSAVNENTFDFDKESRD-SNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGF 1230
            IPF++ R    +W   + N+T   S    +   +      F GGV L+T F+ + PE+ E +EE +   I  ++T  FPL   L   GFF++  IEE + T++ +      G+       + N   + PTE N              A   +   +N    D E +  + +  ++ +     H H   H+H      D +A  +   +L    ++ A+S+H +FEG+A+GL+   S+   +F A+  HK ++A  + ++L  +   + +A L    F+  +P G+ +G  +N+ EE      S+V+ +LQG ACGT  Y+VFFEIL     K +  +   +A+ +GF
Sbjct:   73 IPFLLNR--CYRW---TENQTNARSAIVVKCLLY------FGGGVLLATTFLHLLPEVQEVVEELQECGIIGELT--FPLAELLMCCGFFLMYFIEEAMHTYVHHHQKDEAGAAFERGHSIRNSHLLKPTEGNATTPTAPPAPLAGTAELGTLSVQNLLQNDLEQQKFATKPQQQANGHGHSHGHGHGHSHLPVIADDADAGDMLASSLRGLFIVSALSLHELFEGMAIGLESSASSVWFMFGAVSAHKLVLAFCVGVELIVARTRMLLAVLYVLTFAVVSPLGIGIGILINHGEETSGP--SLVSAILQGFACGTLIYVVFFEILS----KNRSGLRAYLALFVGF 400          
BLAST of slc39a-13 vs. Ensembl Fly
Match: Zip42C.1 (gene:FBgn0033096 transcript:FBtr0086139)

HSP 1 Score: 98.2117 bits (243), Expect = 2.802e-22
Identity = 80/289 (27.68%), Postives = 136/289 (47.06%), Query Frame = 1
Query:  376 FAGGVFLSTGFMDIFPEMLESIEE-AKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALV 1239
            F GGV + T F+ + PE++E +E   +  + + + F L   L   GFF++  ++EL+T +  R +  K+S  +                   +V    F+  +  R S  +  +   + E+ D         H    +   A    +     +++A+S+H +FEG+A+GL+   S    +F A+  HK ++A  + ++L  +     +A L    FS  TP G+ +G  ++     G  S    +GVLQGIACGT  Y+VFFEIL E     +     +VA + GFAL+
Sbjct:   71 FGGGVLICTTFLHMLPEVIEVVEALQECGSLVKTPFALAEMLLCTGFFLMYALDELMTSLV-RHHQGKLSRKE-------------------SVASLAFERGRSIRHSVLLNPQAKEEVEVKDTEPQPHKDHHGHSHMPVPADDGSSARGLGIILALSLHELFEGMAIGLEGTVSTVWFMFGAVSAHKLVLAFCVGMELLVARTRSSLAILYLVTFSIVTPIGIGVGLGISQQVAAGQPSLP--SGVLQGIACGTLLYVVFFEILIESHAGWR----ALVAAVAGFALM 333          
BLAST of slc39a-13 vs. Ensembl Fly
Match: Zip42C.2 (gene:FBgn0033097 transcript:FBtr0306802)

HSP 1 Score: 91.6633 bits (226), Expect = 2.501e-20
Identity = 87/342 (25.44%), Postives = 149/342 (43.57%), Query Frame = 1
Query:  229 LVSVFIVTLI----PFIVIRHLSKKWGIESVNKTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLG--PFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFAL 1236
            +V +F+VTLI    P+++ R    KW     N  RE       F   L  +N F GGV ++T F+ + PE++E +   +   +M +  P G    L   GF+++  IEE + F+  R    K+     + +    + TE    P            +ES      L+ + +                                    ++A+S+H +F G+A+GL+   S    +  A+ +HK ++A  I +++  +     +A +   +FS  TP GV +G  V+  E       S V+G+LQG+ACGT  Y+VFFEI+ +     +  +  +V  +L F L
Sbjct:   14 IVVLFLVTLIFCFIPYLLDRF--YKWTQRPENNARE-------FKVVLCLLN-FGGGVLIATTFIHMLPEVVEVVNALQ-DCRMLAPTPFGLPEVLLCTGFYLMYCIEETMHFVVRRRQQRKLREVVTIKDAGEELRTEIVVQP------------EESPKEPNWLRGLGI------------------------------------IVALSLHELFGGMAIGLEMSVSTVWFMTGAISVHKLVLAFCIGMEIMMAHTRWLLAVVYLLVFSIVTPIGVGIGIAVS--ESAAANQPSTVSGILQGLACGTLIYVVFFEIVAKNHAGIRILLSSMVGFVLMFGL 294          
BLAST of slc39a-13 vs. Ensembl Fly
Match: Zip88E (gene:FBgn0038312 transcript:FBtr0290018)

HSP 1 Score: 69.3218 bits (168), Expect = 1.629e-12
Identity = 79/335 (23.58%), Postives = 141/335 (42.09%), Query Frame = 1
Query:  325 NSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPT-----KVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNA--------EALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSF-SMVAGVLQGIACGTFFYIVFFEILPEEFG-------KKQDKILKIVAVILGFALVSLFMLFIHE 1266
            + +  RRF    S + CF  G+ L+T  + I PE+ E     ++ +K   V   G      GFF+I  I+E + +    F+G  +  T     +    +    PT  N +   AV+E       E   S+      S D + +  +     +D    D NA        E  ++       L +A+S+HS  EGLA+G+Q  ++    L  A+  HK+++   + L+  +S+          GI  FA   G V+G  +  L  +   ++ S    ++Q +A GT FY+   E++P E         ++     +   V+ GFA + +   ++ +
Sbjct:   50 SERNRRRFPLTASLLLCFGAGILLATALVHILPEVRE-----QMDSKFAEVAMCG------GFFIIYFIDEFIHY----FFGEAIQHTHAHDAETPATEPPRRPTNDNGY--GAVDERAPLLSAEPNTSHGHSHHHSHDHDHNHPASASGCNDASVEDANARICHTSHTEPCAQSMTGTLGLFVALSLHSAIEGLAIGVQNSSTKVLFLLGAVACHKFVMGFCLGLEF-RSNPQTSFRAQFVGISVFA--LGAVIGIGLGMLIVDVPAAWSSKTLPIVQALAGGTLFYVTVCEVIPREKARWHSNSTRRWAGFAQFATVLAGFATMCIINFYLSD 364          
BLAST of slc39a-13 vs. Ensembl Zebrafish
Match: slc39a1 (solute carrier family 39 member 1 [Source:NCBI gene;Acc:321324])

HSP 1 Score: 124.02 bits (310), Expect = 1.027e-31
Identity = 86/295 (29.15%), Postives = 144/295 (48.81%), Query Frame = 1
Query:  358 LSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVS 1242
            LS ++CFAGGVFLS   +DI P+ L  I     K  +   FPL  F+   GFF +LI+E++V           +S T+   N+E   P  + A P+   + +    D E    +     V VD                         +  +    +L +++S+HS+FEGLA+GLQ   +    + +A+ +HK II  ++S++L +S++      L   +F+  +P G+ +G  V   E        ++  VL+G+A GTF YI F EILP E    +  +LK++ ++ GF++++
Sbjct:   45 LSFVSCFAGGVFLSACLLDIIPDYLSDIHGELQKRDLDDGFPLPEFIMACGFFTVLILEKMV-----------LSCTEGHRNEE-TAPLLAPAAPNGHAHGHPSVNDLEGSGHH-----VHVDFH-----------------------AHSSFRSFMLFLSLSLHSVFEGLAIGLQTTNAKVLEICIAILVHKSIIVFSLSVKLVQSAVKPLWVVLYVTVFAIMSPLGIGIGIVVIETERQAG---GLIQAVLEGLAAGTFIYITFLEILPHELNSSERPLLKVLFLLCGFSIMA 296          
BLAST of slc39a-13 vs. Ensembl Zebrafish
Match: slc39a1 (solute carrier family 39 member 1 [Source:NCBI gene;Acc:321324])

HSP 1 Score: 124.02 bits (310), Expect = 1.027e-31
Identity = 86/295 (29.15%), Postives = 144/295 (48.81%), Query Frame = 1
Query:  358 LSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVS 1242
            LS ++CFAGGVFLS   +DI P+ L  I     K  +   FPL  F+   GFF +LI+E++V           +S T+   N+E   P  + A P+   + +    D E    +     V VD                         +  +    +L +++S+HS+FEGLA+GLQ   +    + +A+ +HK II  ++S++L +S++      L   +F+  +P G+ +G  V   E        ++  VL+G+A GTF YI F EILP E    +  +LK++ ++ GF++++
Sbjct:   45 LSFVSCFAGGVFLSACLLDIIPDYLSDIHGELQKRDLDDGFPLPEFIMACGFFTVLILEKMV-----------LSCTEGHRNEE-TAPLLAPAAPNGHAHGHPSVNDLEGSGHH-----VHVDFH-----------------------AHSSFRSFMLFLSLSLHSVFEGLAIGLQTTNAKVLEICIAILVHKSIIVFSLSVKLVQSAVKPLWVVLYVTVFAIMSPLGIGIGIVVIETERQAG---GLIQAVLEGLAAGTFIYITFLEILPHELNSSERPLLKVLFLLCGFSIMA 296          
BLAST of slc39a-13 vs. Ensembl Xenopus
Match: slc39a3 (solute carrier family 39 member 3 [Source:NCBI gene;Acc:100124712])

HSP 1 Score: 117.472 bits (293), Expect = 3.355e-29
Identity = 87/311 (27.97%), Postives = 162/311 (52.09%), Query Frame = 1
Query:  343 RFTTWLSRINCFAGGVFLSTGFMDIFPEMLESI-EEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELV-TFIKNR--FYGSKV--SPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLF 1257
            R    LS  N FAGGVFL+T F  + P + E   +  KI N +++ +PL   + ++GFF+ + +E+ V TF K +  F   +   + + +  + EF  P     + S+    N ++        +  +K++S                           S   + +  L+ A+S HS+FEGLALGLQ++ +    LF+ + +H+ ++A  + + ++K +  +K A   + + S   P G+V+G  +   +   N + S+ + +LQGIA GTF ++ FFEIL +E  +K D++LK++ ++LG+ ++++ +LF
Sbjct:   38 RSRKILSLSNSFAGGVFLATCFNALLPAVREKFFDLLKIGN-ISTDYPLAETIMMVGFFLTVFVEQTVMTFRKEKPSFIDMETFNAGSDIGSDSEFESP-----FISANHGHNLYEGGHSHHSHSLNIKELS---------------------------SSSPIRLFSLVFALSAHSVFEGLALGLQEDGNKLLSLFIGVVIHETLVAVALGVSMAKVNTHLKDAIKMAVLVSTMIPIGIVVGMAIQSAQ---NMASSIASALLQGIAGGTFIFVTFFEILVKELEEKNDRLLKVLFLVLGYTVLAVLVLF 312          
BLAST of slc39a-13 vs. Ensembl Xenopus
Match: slc39a1 (solute carrier family 39 member 1 [Source:NCBI gene;Acc:734036])

HSP 1 Score: 117.087 bits (292), Expect = 5.333e-29
Identity = 87/296 (29.39%), Postives = 138/296 (46.62%), Query Frame = 1
Query:  358 LSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGF-WVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVS 1242
            LS I+CF+GGVFLST  +D+ P  L SI  A     +T  FPL  F+  +GFF++L++E++    K++  GS+                E+ A   SA              S      V VD                   +NA +  R    +  L++A+++HS  EG+ALG Q       +  LAL +HK +IA +++L+L +  L ++    C   +S   P G+ LG  W    +     + S    VL+G+A G F YI F EILP E      +I +++ ++ GF+ ++
Sbjct:   60 LSLISCFSGGVFLSTCLLDLMPSYLSSIAGALKGLNITLQFPLQEFILAMGFFLVLVMEQVAMGYKDQAGGSE----------------ETGALLGSA----------SLLHSGVGAPHVHVD-------------------VNAHSAVR----MMALVLALALHSALEGVALGYQGARGRVMKTCLALLVHKSLIAFSLTLKLGQGRLHVRAMLACLLFYSLMCPLGMGLGMAWAGSTDPVQQLTRS----VLEGLATGAFMYITFLEILPHELSAGYPQIDRVIVLLCGFSAIA 302          
BLAST of slc39a-13 vs. Ensembl Xenopus
Match: camk2n2 (calcium/calmodulin-dependent protein kinase II inhibitor 2 [Source:Xenbase;Acc:XB-GENE-960926])

HSP 1 Score: 91.6633 bits (226), Expect = 5.156e-20
Identity = 81/289 (28.03%), Postives = 141/289 (48.79%), Query Frame = 1
Query:  367 INCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSV-FPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGF 1230
            I+ FA G FL    + +  E L SI       +++ + +P+G  +  +GFF +L IE +V       Y S+  P ++   D   +P   N+ P +    N+ +  +   + N    +VS +                   ++    S  +    IL +++S+HS+FEGLA+GLQ   S+A ++ +A+ +HK +I  ++SL+L++S        +     S  +P G+ +G  V        T  ++V  VL+GIA GTF Y+ F EILP+E    +  +LK++ + LGF
Sbjct:   48 ISSFAAGTFLGACLLHVVAEALSSI-----ATELSYIAYPMGELILSLGFFFVLFIERIVL---QFCYHSQ--PQQL---DGSPVPATQNS-PEA----NSTEKQEHPEEINNA-AEVSHNH------------------IHVNLHSYSSFRSLILFLSLSVHSVFEGLAIGLQSNYSSALQIAIAVLIHKGVIVFSLSLKLTQSKTRPLWLLVYVITLSLMSPIGITIGIIVTL---KKTTIITLVQAVLEGIASGTFVYVTFLEILPQELNTAEKPLLKLLFIALGF 296          
BLAST of slc39a-13 vs. Ensembl Xenopus
Match: alkbh6 (alkB homolog 6 [Source:Xenbase;Acc:XB-GENE-5891943])

HSP 1 Score: 76.2554 bits (186), Expect = 9.592e-15
Identity = 47/124 (37.90%), Postives = 77/124 (62.10%), Query Frame = 1
Query:  862 EGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFA 1233
            EG+A+GLQ   S   ++ +A+ +HK IIA ++SL L +SS+  +   L   +F+  +P G+ +G  V + + +GN    MV  VL+G+A GTF YI F EILP E    + ++ K++ ++LGF+
Sbjct:  181 EGIAIGLQNVQSEVLQIAIAILIHKSIIAVSLSLLLLQSSVQTRWFVLSIVMFALMSPLGIGIGIGVMHNQTDGN---RMVQCVLEGLAAGTFVYITFLEILPHELNSNKWRLPKVIFILLGFS 301          

HSP 2 Score: 60.4622 bits (145), Expect = 1.366e-9
Identity = 28/71 (39.44%), Postives = 46/71 (64.79%), Query Frame = 1
Query:  331 KAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELV 543
            +A++R   W+S I+C AGGVFL+   +DI P+ L  ++E  I  ++ + FPL  F+   GF ++LI+E +V
Sbjct:   39 EAHQR---WISFISCLAGGVFLAACLLDIIPDFLNDMKEEMINQQIKTDFPLPEFILGTGFLIVLIVERIV 106          
BLAST of slc39a-13 vs. Ensembl Mouse
Match: Slc39a1 (solute carrier family 39 (zinc transporter), member 1 [Source:MGI Symbol;Acc:MGI:1353474])

HSP 1 Score: 154.451 bits (389), Expect = 7.314e-43
Identity = 99/319 (31.03%), Postives = 163/319 (51.10%), Query Frame = 1
Query:  307 VNKTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLFIH 1263
            + ++  N +A       LS ++CFAGGVFL+T  +D+ P+ L +I+EA     +T  FPL  F+  +GFF++L++E++        Y  + SP           P E+ A   + VN       +   D   + +                              +   L   +L+ ++++HS+FEGLA+GLQ++ + A  L LAL LHK I+A ++SL+L +S L +++   C  +FS  TP G+ LG     L E+      +   VL+G+A GTF YI F EILP+E    + +ILK++ ++ GFAL++  +LF+ 
Sbjct:   52 LRRSGANHEASASGQKALSLVSCFAGGVFLATCLLDLLPDYLAAIDEALEALHVTLQFPLQEFILAMGFFLVLVMEQI-----TLAYKEQTSPPH---------PEETRALLGT-VNGG----PQHWHDGPGIPQA------------------------GGTPAAPSALRACVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILAVSLSLRLLQSHLRVQVVAGCGILFSCMTPLGIGLG---AALAESAGPLHQLAQSVLEGMAAGTFLYITFLEILPQELATSEQRILKVILLLAGFALLT-GLLFVQ 323          
BLAST of slc39a-13 vs. Ensembl Mouse
Match: Slc39a3 (solute carrier family 39 (zinc transporter), member 3 [Source:MGI Symbol;Acc:MGI:2147269])

HSP 1 Score: 118.242 bits (295), Expect = 1.715e-29
Identity = 85/308 (27.60%), Postives = 158/308 (51.30%), Query Frame = 1
Query:  331 KAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELV-TFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFD--FDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSR-GTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVS 1242
            KA+R     LS  N F GGVFL+T F  + P + + +++      +++ +PL   L ++GFF+ + +E+LV TF + R                FI     NA  S A +++ ++  F      S+ +  + +                     L    L R G L +  L+ A+S HS+FEGLALGLQ+E      LF+ + +H+ ++A  + + +++S++ ++ A   +   S   P G+ LG  +   E   + + S+ + +LQG+A GTF ++ F EIL +E  ++ +++LK++ ++LG+A+++
Sbjct:   36 KAHRS-KKVLSLCNTFGGGVFLATCFNALLPAVRDKLQQVLSLGHISTDYPLAETLMMVGFFLTVFVEQLVLTFRRER--------------PPFIDLETFNAG-SDAGSDSEYESPFVGVGNRSHSLYPEPTAHTH--------------GAGLRLRELGRPGPLRLLSLVFALSAHSVFEGLALGLQEEGERVVSLFVGVAIHETLVAVALGISMARSAVPLRDAAKLAVTVSAMIPVGIGLGLGI---ESARSVASSVASALLQGLAGGTFLFVTFLEILAKELEERSEQLLKVLFLVLGYAVLA 310          
BLAST of slc39a-13 vs. Ensembl Mouse
Match: Slc39a3 (solute carrier family 39 (zinc transporter), member 3 [Source:MGI Symbol;Acc:MGI:2147269])

HSP 1 Score: 118.627 bits (296), Expect = 2.139e-29
Identity = 85/308 (27.60%), Postives = 158/308 (51.30%), Query Frame = 1
Query:  331 KAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELV-TFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFD--FDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSR-GTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVS 1242
            KA+R     LS  N F GGVFL+T F  + P + + +++      +++ +PL   L ++GFF+ + +E+LV TF + R                FI     NA  S A +++ ++  F      S+ +  + +                     L    L R G L +  L+ A+S HS+FEGLALGLQ+E      LF+ + +H+ ++A  + + +++S++ ++ A   +   S   P G+ LG  +   E   + + S+ + +LQG+A GTF ++ F EIL +E  ++ +++LK++ ++LG+A+++
Sbjct:   67 KAHRS-KKVLSLCNTFGGGVFLATCFNALLPAVRDKLQQVLSLGHISTDYPLAETLMMVGFFLTVFVEQLVLTFRRER--------------PPFIDLETFNAG-SDAGSDSEYESPFVGVGNRSHSLYPEPTAHTH--------------GAGLRLRELGRPGPLRLLSLVFALSAHSVFEGLALGLQEEGERVVSLFVGVAIHETLVAVALGISMARSAVPLRDAAKLAVTVSAMIPVGIGLGLGI---ESARSVASSVASALLQGLAGGTFLFVTFLEILAKELEERSEQLLKVLFLVLGYAVLA 341          
BLAST of slc39a-13 vs. Ensembl Mouse
Match: Slc39a3 (solute carrier family 39 (zinc transporter), member 3 [Source:MGI Symbol;Acc:MGI:2147269])

HSP 1 Score: 118.627 bits (296), Expect = 2.139e-29
Identity = 85/308 (27.60%), Postives = 158/308 (51.30%), Query Frame = 1
Query:  331 KAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELV-TFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFD--FDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSR-GTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVS 1242
            KA+R     LS  N F GGVFL+T F  + P + + +++      +++ +PL   L ++GFF+ + +E+LV TF + R                FI     NA  S A +++ ++  F      S+ +  + +                     L    L R G L +  L+ A+S HS+FEGLALGLQ+E      LF+ + +H+ ++A  + + +++S++ ++ A   +   S   P G+ LG  +   E   + + S+ + +LQG+A GTF ++ F EIL +E  ++ +++LK++ ++LG+A+++
Sbjct:   67 KAHRS-KKVLSLCNTFGGGVFLATCFNALLPAVRDKLQQVLSLGHISTDYPLAETLMMVGFFLTVFVEQLVLTFRRER--------------PPFIDLETFNAG-SDAGSDSEYESPFVGVGNRSHSLYPEPTAHTH--------------GAGLRLRELGRPGPLRLLSLVFALSAHSVFEGLALGLQEEGERVVSLFVGVAIHETLVAVALGISMARSAVPLRDAAKLAVTVSAMIPVGIGLGLGI---ESARSVASSVASALLQGLAGGTFLFVTFLEILAKELEERSEQLLKVLFLVLGYAVLA 341          
BLAST of slc39a-13 vs. Ensembl Mouse
Match: Slc39a2 (solute carrier family 39 (zinc transporter), member 2 [Source:MGI Symbol;Acc:MGI:2684326])

HSP 1 Score: 95.9005 bits (237), Expect = 1.113e-21
Identity = 84/317 (26.50%), Postives = 129/317 (40.69%), Query Frame = 1
Query:  358 LSRINCFAGGVFLSTGFMDIFPEMLESIE--------EAKIKNKMTSV---------FPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLF 1257
            LS + C + GVFL  G M +  E LE IE        +    +K  S          +P G  +  +GFF + ++E L     +   G                  +   W  +    + F F K     +                                  SRG L   +L++++S HS+FEGLA+GLQ   +A  +L +A+  HK ++  ++ L+L K   G + A  C    +  +P G+ LG  V     +G T   +   VL+GIA GTF Y+ F EILP E    +  + K   V  GFA ++L  L+
Sbjct:   45 LSLLGCTSAGVFLGAGLMHMTAEALEGIESEIQKFVEQNSTGSKGNSSRDAASSYVEYPYGELVISLGFFFVFLLESLALQCCHGAAGGST--------------VQEEEWGGT----HAFGFHKHPAVPSP---------------------------------SRGPLRALVLLLSLSFHSVFEGLAVGLQATVAATIQLCVAVLAHKGLVVFSVGLRLGKIGTGPRWATFCILSLALMSPVGLALGLTVAG-GASGQTQ-GLAQAVLEGIAAGTFLYVTFLEILPRELACPEAPLAKYSCVAAGFAFMALIALW 308          
BLAST of slc39a-13 vs. UniProt/SwissProt
Match: sp|Q9QZ03|S39A1_MOUSE (Zinc transporter ZIP1 OS=Mus musculus OX=10090 GN=Slc39a1 PE=2 SV=3)

HSP 1 Score: 154.451 bits (389), Expect = 5.116e-42
Identity = 99/319 (31.03%), Postives = 163/319 (51.10%), Query Frame = 1
Query:  307 VNKTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLFIH 1263
            + ++  N +A       LS ++CFAGGVFL+T  +D+ P+ L +I+EA     +T  FPL  F+  +GFF++L++E++        Y  + SP           P E+ A   + VN       +   D   + +                              +   L   +L+ ++++HS+FEGLA+GLQ++ + A  L LAL LHK I+A ++SL+L +S L +++   C  +FS  TP G+ LG     L E+      +   VL+G+A GTF YI F EILP+E    + +ILK++ ++ GFAL++  +LF+ 
Sbjct:   52 LRRSGANHEASASGQKALSLVSCFAGGVFLATCLLDLLPDYLAAIDEALEALHVTLQFPLQEFILAMGFFLVLVMEQI-----TLAYKEQTSPPH---------PEETRALLGT-VNGG----PQHWHDGPGIPQA------------------------GGTPAAPSALRACVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILAVSLSLRLLQSHLRVQVVAGCGILFSCMTPLGIGLG---AALAESAGPLHQLAQSVLEGMAAGTFLYITFLEILPQELATSEQRILKVILLLAGFALLT-GLLFVQ 323          
BLAST of slc39a-13 vs. UniProt/SwissProt
Match: sp|Q9NY26|S39A1_HUMAN (Zinc transporter ZIP1 OS=Homo sapiens OX=9606 GN=SLC39A1 PE=1 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 6.704e-42
Identity = 97/319 (30.41%), Postives = 160/319 (50.16%), Query Frame = 1
Query:  307 VNKTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLFIH 1263
            + +   N +        LS ++CFAGGVFL+T  +D+ P+ L +I+EA     +T  FPL  F+  +GFF++L++E++    K +   S +  T+ ++          N  P            +   D   V +                         +    +   L   +L+ ++++HS+FEGLA+GLQ++ + A  L LAL LHK I+A ++SL+L +S L  ++   C  +FS  TP G+ LG     L E+      +   VL+G+A GTF YI F EILP+E    + +ILK++ ++ GFAL++  +LFI 
Sbjct:   52 LRRPGANHEGSASRQKALSLVSCFAGGVFLATCLLDLLPDYLAAIDEALAALHVTLQFPLQEFILAMGFFLVLVMEQITLAYKEQSGPSPLEETRALLGT-------VNGGP------------QHWHDGPGVPQA------------------------SGAPATPSALRACVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILAVSLSLRLLQSHLRAQVVAGCGILFSCMTPLGIGLG---AALAESAGPLHQLAQSVLEGMAAGTFLYITFLEILPQELASSEQRILKVILLLAGFALLT-GLLFIQ 323          
BLAST of slc39a-13 vs. UniProt/SwissProt
Match: sp|Q3SYU3|S39A1_BOVIN (Zinc transporter ZIP1 OS=Bos taurus OX=9913 GN=SLC39A1 PE=2 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 8.968e-42
Identity = 102/340 (30.00%), Postives = 166/340 (48.82%), Query Frame = 1
Query:  244 IVTLIPFIVIRHLSKKWGIESVNKTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLFIH 1263
            I +L+P  V+R            +   N +A       LS ++CFAGGVFL+T  +D+ P+ L +I+EA     +T  FPL  F+  +GFF++L++E++    K +        T+ ++          N  P            +   D   V +                            + +   L   +L+ ++++HS+FEGLA+GLQ++ + A  L LAL LHK I+A ++SL+L +S L  ++   C  +FS  TP G+ LG     L E+      +   VL+G+A GTF YI F EILP+E    + +ILK++ ++ GFAL++  +LFI 
Sbjct:   43 ICSLVPVCVLR------------RPGANPEASASRQKALSLVSCFAGGVFLATCLLDLLPDYLGAIDEALAALHVTLQFPLQEFILAMGFFLVLVMEQITLAYKEQSGPPPREETRALLGT-------VNGGP------------QHWHDGLGVPQA------------------------GGASSAPSALRACVLVFSLALHSVFEGLAVGLQRDQARAMELCLALLLHKGILAVSLSLRLLQSHLRAQVVAGCGILFSCMTPLGIGLG---TALAESAGPLHQLAQSVLEGMAAGTFLYITFLEILPQELATSEQRILKVILLLAGFALLT-GLLFIQ 323          
BLAST of slc39a-13 vs. UniProt/SwissProt
Match: sp|Q5E960|S39A3_BOVIN (Zinc transporter ZIP3 OS=Bos taurus OX=9913 GN=SLC39A3 PE=2 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 4.907e-31
Identity = 97/313 (30.99%), Postives = 160/313 (51.12%), Query Frame = 1
Query:  331 KAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELV-TFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGT-LSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGV-LQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLFI 1260
            KA+R     LS  N F GGVFL+T F  + P + E ++E      +++ +PL   + L+GFFM + +E+LV TF K R                FI     NA  S A +++ ++           L                       H L+ + LSR + L +  L+ A+S HS+FEGLALGLQ+E      LF+ + +H+ ++A  + + +++S++ ++ A   +   S   P G+ LG  +    E+     S VA V LQG+A GTF ++ FFEIL +E  +K D++LK++ ++LG+ +++  M+FI
Sbjct:   36 KAHRS-KKILSLCNTFGGGVFLATCFNALLPAVREKLKEVLTLAHISTDYPLAETIMLLGFFMTVFLEQLVLTFRKER--------------PAFIDLETFNA-SSDAGSDSEYESPFMGGPRGHALYAEPHGHS---------------HGLSVQELSRSSPLRLLSLVFALSAHSVFEGLALGLQEEGEKVVSLFVGVAIHETLVAVALGINMARSAMALRDAAKLAVTVSAMIPLGISLGLGI----ESAQGMPSSVASVLLQGLAGGTFLFVTFFEILAKELEEKSDRLLKVLFLVLGYTVLA-GMVFI 312          
BLAST of slc39a-13 vs. UniProt/SwissProt
Match: sp|P59889|S39A1_DANRE (Zinc transporter ZIP1 OS=Danio rerio OX=7955 GN=slc39a1 PE=2 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 7.754e-31
Identity = 86/295 (29.15%), Postives = 144/295 (48.81%), Query Frame = 1
Query:  358 LSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVS 1242
            LS ++CFAGGVFLS   +DI P+ L  I     K  +   FPL  F+   GFF +LI+E++V           +S T+   N+E   P  + A P+   + +    D E    +     V VD                         +  +    +L +++S+HS+FEGLA+GLQ   +    + +A+ +HK II  ++S++L +S++      L   +F+  +P G+ +G  V   E        ++  VL+G+A GTF YI F EILP E    +  +LK++ ++ GF++++
Sbjct:   45 LSFVSCFAGGVFLSACLLDIIPDYLSDIHGELQKRDLDDGFPLPEFIMACGFFTVLILEKMV-----------LSCTEGHRNEE-TAPLLAPAAPNGHAHGHPSVNDLEGSGHH-----VHVDFH-----------------------AHSSFRSFMLFLSLSLHSVFEGLAIGLQTTNAKVLEICIAILVHKSIIVFSLSVKLVQSAVKPLWVVLYVTVFAIMSPLGIGIGIVVIETERQAG---GLIQAVLEGLAAGTFIYITFLEILPHELNSSERPLLKVLFLLCGFSIMA 296          
BLAST of slc39a-13 vs. TrEMBL
Match: A0A0H3YKI3 (Slc39a-13 OS=Schmidtea mediterranea OX=79327 GN=slc39a-13 PE=2 SV=1)

HSP 1 Score: 702.59 bits (1812), Expect = 0.000e+0
Identity = 367/367 (100.00%), Postives = 367/367 (100.00%), Query Frame = 1
Query:  166 VPWVPFMNPVNQVKLGMAAALLVSVFIVTLIPFIVIRHLSKKWGIESVNKTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLFIHE 1266
            VPWVPFMNPVNQVKLGMAAALLVSVFIVTLIPFIVIRHLSKKWGIESVNKTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELHDHSIDHAHHDHHDHDLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLFIHE
Sbjct:   15 VPWVPFMNPVNQVKLGMAAALLVSVFIVTLIPFIVIRHLSKKWGIESVNKTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELHDHSIDHAHHDHHDHDLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLFIHE 381          
BLAST of slc39a-13 vs. TrEMBL
Match: A0A0H3YKH6 (Slc39a-3 OS=Schmidtea mediterranea OX=79327 GN=slc39a-3 PE=2 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 8.824e-53
Identity = 131/368 (35.60%), Postives = 199/368 (54.08%), Query Frame = 1
Query:  181 FMNPVNQVKLGMAAALLVSVFIVTLIPFIVIRHL------SKKWGIESVNKTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSR-GTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLFIH 1263
            F N +  +K+G+  A L  V  V LIP+ +IR+        ++  ++S+ K              LS  NCFA GVFL+TG +DI  ++L+ + EA    ++ S FPLG F+ + G F+IL IEE +  I N     +V               ES  + SS   E  F+   + +  N      S ++E                 L     S+   +S+ IL+IAI+IHSIFEGLALGLQ        LF+A+ +HK ++A TI L+L+++ +  KM+ + + IFS ++P G+ +GF +NY E   + S  M + +LQG+ACGTFFYIVFFEILP+E   K  KI+K++++ +GF LVS+ +  +H
Sbjct:   11 FFNYLTNLKIGLVFAFLFLVLTVVLIPYFIIRYYMRVKFYKREMKLDSIQKV-------------LSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVR-------------FESRVFHSSITEEVQFERTSDGKTYNT----FSENKE---------------KSLEKFPESKIDEISLKILIIAIAIHSIFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFVLH 333          
BLAST of slc39a-13 vs. TrEMBL
Match: A0A0H3YJF6 (Slc39a-11 OS=Schmidtea mediterranea OX=79327 GN=slc39a-11 PE=2 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 1.640e-52
Identity = 128/359 (35.65%), Postives = 193/359 (53.76%), Query Frame = 1
Query:  217 AAALLVSVFIVTLIPFIVIRHLSKKWGIESVNKTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAW---PSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTL------SVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGK--KQDKILKIVAVILGFALVSLFMLFI 1260
            A  +LV+V I   +P ++   L         N +R+ +    +   W++R++CFA GVFLSTGF+DIFP++++SI+ A  K  +   FPL  F TLIGFF+IL IE+L+   KN          K +     I   ES        S VN N   FDK +     + K  S D +L DH       D   ++   E+   G +       +  LM A+S H++FEGLA+GL    +   +LF+AL +HK IIA ++ L L+ + L + +    + IFS A+P G+ LG  +   +E G+    +V G+L+GIACGTF Y+VFFEILP E G    +D+  K+  V++GF  V +++L +
Sbjct:   39 AVVMLVTVLIAIFLPILIFGKL---------NLSRQRNSFRDKVQLWVARLSCFAAGVFLSTGFLDIFPDVIKSIDTAGKKLNLNLWFPLASFFTLIGFFLILSIEQLILIYKNHLAMIGSGSIKNIKRISPIFEEESQEAFLTEISDVNVNA-SFDKLA--GQGISKSRSTDSDLMDHKHFSETTDDDFNNNELESDEIGNILHHNKSRIFALMFAMSFHAVFEGLAIGLGTTIAGILQLFIALSMHKLIIAASLGLNLATAELKLWIKISVAMIFSCASPIGIGLGALI-MSQEKGHDVLFLVGGILEGIACGTFLYVVFFEILPHELGHSAHKDRGAKLACVLMGFIFVCIYILLV 384          
BLAST of slc39a-13 vs. TrEMBL
Match: U6J383 (Zinc transporter ZIP1 OS=Echinococcus granulosus OX=6210 GN=EGR_03259 PE=4 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 3.896e-45
Identity = 117/330 (35.45%), Postives = 176/330 (53.33%), Query Frame = 1
Query:  304 SVNKTRENSKAYRRFTT---WLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIA--TTISLQLSKSSLGIKMAC---LCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQ----DKILKIVAVILGFALVSLFMLF 1257
            ++N+TR  S +Y+R      W SRINCFA G+FLSTG MD+FPE+ +++  A    K+ S +P     TL+GFFM+L IE+ V    NR    +  P              SNA  +SA+   T      S D  Q++                          + E  +  T  + +L+IA+S+HSIFEGLA+GLQ+  +    LF AL LHK I+A  T +SL  +    G  +A    + +  F+ A+P GV++G W   + +  + +  MV  VLQG+ACGTFF++VF E+LP EF + +    D++ KI +++LGFAL + ++ F
Sbjct:  218 AINRTRRRS-SYKRMCVIRKWGSRINCFAAGIFLSTGLMDLFPEVQDAMAVALSALKINSQYPFPALFTLLGFFMVLSIEQCVHICHNR---RRCHPPYY---------RRSNA--TSAIG--THQHHNHSHDP-QIIPGS-----------------------DGEEGAPSTFRIMLLLIALSVHSIFEGLAVGLQRSVAEVITLFSALILHKIIMAISTGVSLATAHKERGGGIARSQWMGALFFALASPIGVLIG-WA-LIAQRSSPALLMVVAVLQGLACGTFFFVVFCEMLPHEFSESESDTPDRLGKIFSLVLGFALTATYIAF 504          
BLAST of slc39a-13 vs. TrEMBL
Match: A0A5J4NIS7 (Solute carrier family 39 (Zinc transporter), member 1/2/3 OS=Paragonimus westermani OX=34504 GN=DEA37_0012731 PE=4 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 1.413e-44
Identity = 122/346 (35.26%), Postives = 183/346 (52.89%), Query Frame = 1
Query:  325 NSKAYRRF--TTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNE--NTFDFDKES-RDSNQVLKKVSV-DRELXXXXXXXXXXXXXXXXL-----NAEALSRGT-LSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLS----------KSSLGIKM-----------ACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKK-QDKILKIVAVILGFALVSLFMLFI 1260
             S A RR     W SR NC A GVFLS+GFM+++ ++ ESIEEAK++  + S FP  PFLTLIGFF++L IE++V  ++N    ++ +  +    D    P ++   P +   +    F F  ES R   Q  ++VS  D  L                      N    S G+ + V +L+ A+SIHS+FEGLA+GLQ        LF A+ LHK IIA  I + L+          +SS  + +             +C+ I + ++P GV++G+ +   +++G     M    LQG ACGTFFY+VF E+LPEEF +   D+I K++ ++ GFALV+L+ L +
Sbjct:  220 RSTAERRLLLRLWFSRFNCLAAGVFLSSGFMELYVDVEESIEEAKLQLSIHSEFPFAPFLTLIGFFLVLSIEQIVWTVRNAKLTTEQAQHRSSSAD--TTPCDTPLSPQADSTQPFTQFPFTGESIRSPVQFNEQVSCRDPSLSASVTRTRPSIVSHSHHSHFVTNESMDSFGSGMRVILLLSAMSIHSLFEGLAVGLQSTLQHTIALFTAILLHKLIIAAGIGVSLATAITTTQAFPESSRSVPLQHDADRKALIYQTVCTFILASSSPLGVLIGWGLMQQQQSG--VLQMTTATLQGFACGTFFYVVFCELLPEEFREGVGDRIGKLLFLVFGFALVALYSLLM 561          
BLAST of slc39a-13 vs. Ensembl Cavefish
Match: SLC39A3 (solute carrier family 39 member 3 [Source:NCBI gene;Acc:103038117])

HSP 1 Score: 128.642 bits (322), Expect = 2.061e-33
Identity = 95/311 (30.55%), Postives = 156/311 (50.16%), Query Frame = 1
Query:  322 ENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELV-TFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFD--FDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSR-GTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVS 1242
            + +  YRR   +    N F GGVFL+T F  + P + + + E     + T+ +PL   + ++GFF+ + +E+ V TF K R       P+       FI     NA  S A +++ +D  F    R S       S                 H    N   L+R G L +  L++A+S HS+FEGLALGLQ++ +    LF+ + +H+ + A  + +  +K+ L ++ A   +   S   P G+ LG  +   E   N + S+V+ VLQG+A GTF +I FFEIL  E   K D++LK++ ++LG+ +++
Sbjct:   34 DKAARYRRAVAF---SNSFGGGVFLATCFNALLPAVRDKVGEVLKMLQATTDYPLAETMMMLGFFLTVFVEQAVLTFRKER-------PS-------FIDLETFNAGGSEAGSDSEYDTPFIAPPRSSAAHQNHHSH----------------HHGHFNPAELTRAGPLRLASLVLALSAHSVFEGLALGLQEDGAKLGSLFIGVAIHETLAAVALGVSTAKAGLMLRDASKLAVTVSLMIPLGIGLGMGI---ETAQNLAGSIVSVVLQGLAAGTFLFITFFEILSRELEDKHDRLLKVLFLVLGYGVLA 308          
BLAST of slc39a-13 vs. Ensembl Cavefish
Match: slc39a1 (zinc transporter ZIP1-like [Source:NCBI gene;Acc:103033216])

HSP 1 Score: 114.775 bits (286), Expect = 1.818e-28
Identity = 84/295 (28.47%), Postives = 141/295 (47.80%), Query Frame = 1
Query:  358 LSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVS 1242
            LS I+CFAGGVFL+   +DI P+ L  I +      +   FP+  F+   GFF +LI+E +V        GS+   T                 P            +   D       V VD                   L A +  R  +    L +++S+HS+FEGLA+GLQ   +    + +A+ +HK II  ++S++L +S++      +   +F+  +P G+ +G  V+   E    S ++V G+L+G+A GTF YI F EILP E    + ++LK++ +++GF++++
Sbjct:   45 LSFISCFAGGVFLAACLLDIIPDYLSDISDQL--QGLDGGFPVAEFIMACGFFTVLILERIVL----SCTGSRSEETS----------------PLLGHGHGHAHGHRSVNDMEGSAHHVHVD-------------------LQAHSSFRSFM----LFLSLSLHSVFEGLAIGLQTTDAKVLEICIAILVHKSIIVFSLSVKLVQSAVRPAWVGIYITVFALMSPIGIGVGIGVS---EAKLHSGALVQGILEGMAAGTFIYITFLEILPHELNSPERQLLKVLFILVGFSVMA 291          
BLAST of slc39a-13 vs. Ensembl Cavefish
Match: SLC39A1 (zinc transporter ZIP1 [Source:NCBI gene;Acc:103025837])

HSP 1 Score: 101.293 bits (251), Expect = 1.475e-23
Identity = 75/324 (23.15%), Postives = 149/324 (45.99%), Query Frame = 1
Query:  292 WGIESVNKTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLFIH 1263
            W +    +    S++  R    L  + C A GVFL++  +++ P  +  + E      +T  FP+  F+  +GF ++++IE++V  +K +        + + + ++  +   SN  P           D+  + S+Q  + V                       +A+  S  T+ + +L+ ++S+ S+FEGLA+GLQ+ +     L L+L   K +IA ++ ++L++  L       C  +FS   P G VLG  ++  + +    + +    LQG+A G+F YI   E+L         +I K+  ++ GF  V++ +L ++
Sbjct:   37 WVLRGTGRCGLYSESRYR---ALDLLGCCAAGVFLASSLLNMVPSYMIGMTETFSNLGVTLRFPVPEFILAMGFLLVVVIEQVVLALKEQ--------SGIYMTEKEALLVGSNVQPH----------DRHPQCSHQYSRTVQFKGRGFGG--------------DADVSSLSTIRIFVLVFSLSLCSVFEGLAVGLQEASGQGLNLSLSLLFRKGLIALSLVIKLTQDQLRRVAVTTCLLLFSATCPLGAVLG--ISLRQTHTTPQYQLARSTLQGLAAGSFLYITVMEVLTYALSSSGQRISKVTLLLTGFTAVTVLLLCLN 323          
BLAST of slc39a-13 vs. Ensembl Sea Lamprey
Match: SLC39A3 (solute carrier family 39 member 3 [Source:HGNC Symbol;Acc:HGNC:17128])

HSP 1 Score: 78.1814 bits (191), Expect = 3.119e-16
Identity = 47/140 (33.57%), Postives = 79/140 (56.43%), Query Frame = 1
Query:  850 HSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWV-NYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQ-DKILKIVAVILGFALVSLFMLFIH 1263
            HS FEG+ALGLQ+  + A  L +A+ +H+ + A  + + ++++ L    A   +  F  A P GV +G  V N        + S+   VLQG+A GTF ++ F E+L +E    Q D++LK+  + +G+AL +  + F+H
Sbjct:  188 HSAFEGVALGLQETAAKAVGLAVAVGVHETLAAAALGVSMARAGLAPCRAARLAAAFCTAIPVGVAIGAAVENGAAGLAGDAASL---VLQGLAAGTFLFVAFLEVLAKEMAHGQRDRMLKVALLAVGYALPA-GLAFMH 323          
BLAST of slc39a-13 vs. Ensembl Nematostella
Match: EDO34311 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPR1])

HSP 1 Score: 145.591 bits (366), Expect = 7.090e-40
Identity = 100/310 (32.26%), Postives = 161/310 (51.94%), Query Frame = 1
Query:  340 RRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELV--TFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSR--GTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLF 1257
            RR    LS  NCFA GVF +T F+D+ P + E  ++A  +  +TS FP+  F T  GFF++LI+E++V     K RF+                   E+ A       +N +   + S DS   L + +                   H +N++ L+    TL   IL++A+S+HSIFEGLALGL  E     ++  A+ +HK IIA ++ + + K  + +++    S +FS   P G+ +G  V  L+E+ + S ++ + +LQGIA GTF Y+ FFEIL  E      K+LK++ +++GF++V   + F
Sbjct:   33 RRRQQALSLCNCFAAGVFFATSFLDLLPMIREKFKQAFAEANITSPFPIPEFTTCFGFFVVLIVEQVVHSCHKKARFFHGHSH-------------VETTAPLLGTPPQNGYGNKERSEDSFTPLNERA-------------------HQINSQELAEVDSTLRTYILVVALSLHSIFEGLALGLLVEVDRLVQIAAAVVIHKSIIAFSMGVSMVKHDMPLRVIVNASFLFSAMGPLGIGIGIAV--LKESTHFSSNLSSAILQGIANGTFIYVTFFEILQNELKGHGKKLLKLLFMVIGFSVVCGLLYF 308          
BLAST of slc39a-13 vs. Ensembl Medaka
Match: SLC39A3 (solute carrier family 39 member 3 [Source:NCBI gene;Acc:101157119])

HSP 1 Score: 134.806 bits (338), Expect = 1.128e-35
Identity = 95/316 (30.06%), Postives = 160/316 (50.63%), Query Frame = 1
Query:  319 RENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELV-TFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFD--FDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLF 1257
             E +  YRR    LS  N F GGVFL+T F  + P + E +     + K++  +PL   + ++GFF+ + +E+ V TF + +       P+       FI     NA  S A +++ +D  F   +R S  V ++                         +E    G L +  L++A+S HS+FEGLALGLQ++ +    LFL + +H+ + A  + + ++KSSLG++ A       S   P G+V+G  +   +  G    S+   +LQG+A GTF ++ FFEIL  E    +D++LK++ +ILG+A +++ + F
Sbjct:   33 HEKANRYRR---ALSLCNSFGGGVFLATCFNALLPAVREKVAALFEQLKISGDYPLAETMMMVGFFLTVFVEQAVLTFRREK-------PS-------FIDLETFNAGGSEAGSDSEYDTPFISSARSSADVARRHGHHHGHFS---------------PSELAGAGPLRLAGLVLALSAHSVFEGLALGLQEDGAKLGSLFLGVAVHETLAAVALGVSVAKSSLGMQDAIKLGVTVSLMIPLGMVVGMGIESAQTLGGDVASV---LLQGLAAGTFLFVTFFEILSRELEDTRDRLLKVLFLILGYAALAVLVFF 313          
BLAST of slc39a-13 vs. Ensembl Medaka
Match: slc39a1 (solute carrier family 39 member 1 [Source:NCBI gene;Acc:101170659])

HSP 1 Score: 133.265 bits (334), Expect = 3.096e-35
Identity = 97/309 (31.39%), Postives = 154/309 (49.84%), Query Frame = 1
Query:  313 KTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVT-FIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFA--TPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGF 1230
            +    S+ +R   T LS I+CFAGGVFL+   +DI P+ L  I  A    K+ + FPL  F+   GFF +LI+E+ V  F + R  G + +P         ++    N     AV   T D +  +         V VD +                       +       +L +++S+HS+FEGLA+GLQ   S    + +A+ +HK II  ++S++L +S+  ++ A + + IF FA  +P G+ +G  V    E   TS +++  +L+G+A GTF YI F EILP E      +ILK++ ++LGF
Sbjct:   33 RQTNGSETHR---TVLSLISCFAGGVFLAACLLDIIPDYLSDISAALDVQKLETSFPLPEFIIAAGFFTVLILEKTVMHFRERRGAGEERAP---------LLSGNRNGHGHGAVT--TPDLEDSAH-------HVHVDFQ-----------------------AHSPFRSFMLFLSLSLHSVFEGLAIGLQSTDSKVLEICIAILVHKSIIVFSLSVKLVQSA--VQPAWVAAYIFVFAMMSPLGIAIGISVV---EAALTSGALIQAILEGLAAGTFIYITFMEILPHELNSAGKQILKVLFILLGF 292          
BLAST of slc39a-13 vs. Planmine SMEST
Match: SMESG000069905.1 (SMESG000069905.1)

HSP 1 Score: 702.59 bits (1812), Expect = 0.000e+0
Identity = 367/367 (100.00%), Postives = 367/367 (100.00%), Query Frame = 1
Query:  166 VPWVPFMNPVNQVKLGMAAALLVSVFIVTLIPFIVIRHLSKKWGIESVNKTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLFIHE 1266
            VPWVPFMNPVNQVKLGMAAALLVSVFIVTLIPFIVIRHLSKKWGIESVNKTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELHDHSIDHAHHDHHDHDLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLFIHE
Sbjct:   15 VPWVPFMNPVNQVKLGMAAALLVSVFIVTLIPFIVIRHLSKKWGIESVNKTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELHDHSIDHAHHDHHDHDLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLFIHE 381          
BLAST of slc39a-13 vs. Planmine SMEST
Match: SMESG000056994.1 (SMESG000056994.1)

HSP 1 Score: 623.624 bits (1607), Expect = 0.000e+0
Identity = 321/367 (87.47%), Postives = 346/367 (94.28%), Query Frame = 1
Query:  166 VPWVPFMNPVNQVKLGMAAALLVSVFIVTLIPFIVIRHLSKKWGIESVNKTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLFIHE 1266
            VPWVPFMNPVN+VKLGMAA LLVSVFIVT IPFIVIR L KKWGIE+VNKTRE SKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNK+T+ FPLGPFLTL+GF++ILIIEELVTFIKNRFYG KVS  K V+N EFI+PTESN+W  S V+E+TFDF ++ RDSNQ +KK S  RELHDHSIDHAHHDHH+HDLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQ+SKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAG+LQGIACGTFFYIVFFEILP+EFGK++DKI+K +A+ILGFALVSLFMLF+HE
Sbjct:   15 VPWVPFMNPVNKVKLGMAAGLLVSVFIVTFIPFIVIRRLDKKWGIENVNKTRETSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKITNSFPLGPFLTLVGFYLILIIEELVTFIKNRFYGPKVSDNKEVVNHEFIIPTESNSWSRSTVSESTFDFVEKIRDSNQTMKKASFSRELHDHSIDHAHHDHHEHDLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQISKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGILQGIACGTFFYIVFFEILPQEFGKRKDKIIKTIALILGFALVSLFMLFLHE 381          
BLAST of slc39a-13 vs. Planmine SMEST
Match: SMESG000027903.1 (SMESG000027903.1)

HSP 1 Score: 189.889 bits (481), Expect = 2.454e-56
Identity = 131/368 (35.60%), Postives = 199/368 (54.08%), Query Frame = 1
Query:  181 FMNPVNQVKLGMAAALLVSVFIVTLIPFIVIRHL------SKKWGIESVNKTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSR-GTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLFIH 1263
            F N +  +K+G+  A L  V  V LIP+ +IR+        ++  ++S+ K              LS  NCFA GVFL+TG +DI  ++L+ + EA    ++ S FPLG F+ + G F+IL IEE +  I N     +V               ES  + SS   E  F+   + +  N      S ++E                 L     S+   +S+ IL+IAI+IHSIFEGLALGLQ        LF+A+ +HK ++A TI L+L+++ +  KM+ + + IFS ++P G+ +GF +NY E   + S  M + +LQG+ACGTFFYIVFFEILP+E   K  KI+K++++ +GF LVS+ +  +H
Sbjct:   11 FFNYLTNLKIGLVFAFLFLVLTVVLIPYFIIRYYMRVKFYKREMKLDSIQKV-------------LSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVR-------------FESRVFHSSITEEVQFERTSDGKTYNT----FSENKE---------------KSLEKFPESKIDEISLKILIIAIAIHSIFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFVLH 333          
BLAST of slc39a-13 vs. Planmine SMEST
Match: SMESG000016934.1 (SMESG000016934.1)

HSP 1 Score: 190.66 bits (483), Expect = 4.200e-56
Identity = 128/359 (35.65%), Postives = 193/359 (53.76%), Query Frame = 1
Query:  217 AAALLVSVFIVTLIPFIVIRHLSKKWGIESVNKTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAW---PSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTL------SVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGK--KQDKILKIVAVILGFALVSLFMLFI 1260
            A  +LV+V I   +P ++   L         N +R+ +    +   W++R++CFA GVFLSTGF+DIFP++++SI+ A  K  +   FPL  F TLIGFF+IL IE+L+   KN          K +     I   ES        S VN N   FDK +     + K  S D +L DH       D   ++   E+   G +       +  LM A+S H++FEGLA+GL    +   +LF+AL +HK IIA ++ L L+ + L + +    + IFS A+P G+ LG  +   +E G+    +V G+L+GIACGTF Y+VFFEILP E G    +D+  K+  V++GF  V +++L +
Sbjct:   29 AVVMLVTVLIAIFLPILIFGKL---------NLSRQRNSFRDKVQLWVARLSCFAAGVFLSTGFLDIFPDVIKSIDTAGKKLNLNLWFPLASFFTLIGFFLILSIEQLILIYKNHLAMIGSGSIKNIKRISPIFEEESQEAFLTEISDVNVNA-SFDKLA--GQGISKSRSTDSDLMDHKHFSETTDDDFNNNELESDEIGNILHHNKSRIFALMFAMSFHAVFEGLAIGLGTTIAGILQLFIALSMHKLIIAASLGLNLATAELKLWIKISVAMIFSCASPIGIGLGALI-MSQEKGHDVLFLVGGILEGIACGTFLYVVFFEILPHELGHSAHKDRGAKLACVLMGFIFVCIYILLV 374          
BLAST of slc39a-13 vs. Planmine SMEST
Match: SMESG000016934.1 (SMESG000016934.1)

HSP 1 Score: 190.66 bits (483), Expect = 4.560e-56
Identity = 128/359 (35.65%), Postives = 193/359 (53.76%), Query Frame = 1
Query:  217 AAALLVSVFIVTLIPFIVIRHLSKKWGIESVNKTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAW---PSSAVNENTFDFDKESRDSNQVLKKVSVDRELXXXXXXXXXXXXXXXXLNAEALSRGTL------SVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGK--KQDKILKIVAVILGFALVSLFMLFI 1260
            A  +LV+V I   +P ++   L         N +R+ +    +   W++R++CFA GVFLSTGF+DIFP++++SI+ A  K  +   FPL  F TLIGFF+IL IE+L+   KN          K +     I   ES        S VN N   FDK +     + K  S D +L DH       D   ++   E+   G +       +  LM A+S H++FEGLA+GL    +   +LF+AL +HK IIA ++ L L+ + L + +    + IFS A+P G+ LG  +   +E G+    +V G+L+GIACGTF Y+VFFEILP E G    +D+  K+  V++GF  V +++L +
Sbjct:   39 AVVMLVTVLIAIFLPILIFGKL---------NLSRQRNSFRDKVQLWVARLSCFAAGVFLSTGFLDIFPDVIKSIDTAGKKLNLNLWFPLASFFTLIGFFLILSIEQLILIYKNHLAMIGSGSIKNIKRISPIFEEESQEAFLTEISDVNVNA-SFDKLA--GQGISKSRSTDSDLMDHKHFSETTDDDFNNNELESDEIGNILHHNKSRIFALMFAMSFHAVFEGLAIGLGTTIAGILQLFIALSMHKLIIAASLGLNLATAELKLWIKISVAMIFSCASPIGIGLGALI-MSQEKGHDVLFLVGGILEGIACGTFLYVVFFEILPHELGHSAHKDRGAKLACVLMGFIFVCIYILLV 384          
The following BLAST results are available for this feature:
BLAST of slc39a-13 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC39A11.396e-4230.41solute carrier family 39 member 1 [Source:HGNC Sym... [more]
SLC39A11.396e-4230.41solute carrier family 39 member 1 [Source:HGNC Sym... [more]
SLC39A11.396e-4230.41solute carrier family 39 member 1 [Source:HGNC Sym... [more]
SLC39A11.396e-4230.41solute carrier family 39 member 1 [Source:HGNC Sym... [more]
SLC39A11.396e-4230.41solute carrier family 39 member 1 [Source:HGNC Sym... [more]
back to top
BLAST of slc39a-13 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zipt-11.905e-3126.48Zrt (ZRT), Irt-(IRT-) like Protein Transporter [S... [more]
zipt-2.16.801e-2627.56Zrt (ZRT), Irt-(IRT-) like Protein Transporter [S... [more]
zipt-2.16.801e-2627.56Zrt (ZRT), Irt-(IRT-) like Protein Transporter [S... [more]
zipt-2.31.625e-2326.82Zrt (ZRT), Irt-(IRT-) like Protein Transporter [S... [more]
zipt-2.23.278e-2126.91Zrt (ZRT), Irt-(IRT-) like Protein Transporter [S... [more]
back to top
BLAST of slc39a-13 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Zip89B1.723e-2427.38gene:FBgn0038412 transcript:FBtr0083266[more]
Zip42C.12.802e-2227.68gene:FBgn0033096 transcript:FBtr0086139[more]
Zip42C.22.501e-2025.44gene:FBgn0033097 transcript:FBtr0306802[more]
Zip88E1.629e-1223.58gene:FBgn0038312 transcript:FBtr0290018[more]
back to top
BLAST of slc39a-13 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc39a11.027e-3129.15solute carrier family 39 member 1 [Source:NCBI gen... [more]
slc39a11.027e-3129.15solute carrier family 39 member 1 [Source:NCBI gen... [more]
back to top
BLAST of slc39a-13 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slc39a33.355e-2927.97solute carrier family 39 member 3 [Source:NCBI gen... [more]
slc39a15.333e-2929.39solute carrier family 39 member 1 [Source:NCBI gen... [more]
camk2n25.156e-2028.03calcium/calmodulin-dependent protein kinase II inh... [more]
alkbh69.592e-1537.90alkB homolog 6 [Source:Xenbase;Acc:XB-GENE-5891943... [more]
back to top
BLAST of slc39a-13 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc39a17.314e-4331.03solute carrier family 39 (zinc transporter), membe... [more]
Slc39a31.715e-2927.60solute carrier family 39 (zinc transporter), membe... [more]
Slc39a32.139e-2927.60solute carrier family 39 (zinc transporter), membe... [more]
Slc39a32.139e-2927.60solute carrier family 39 (zinc transporter), membe... [more]
Slc39a21.113e-2126.50solute carrier family 39 (zinc transporter), membe... [more]
back to top
BLAST of slc39a-13 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9QZ03|S39A1_MOUSE5.116e-4231.03Zinc transporter ZIP1 OS=Mus musculus OX=10090 GN=... [more]
sp|Q9NY26|S39A1_HUMAN6.704e-4230.41Zinc transporter ZIP1 OS=Homo sapiens OX=9606 GN=S... [more]
sp|Q3SYU3|S39A1_BOVIN8.968e-4230.00Zinc transporter ZIP1 OS=Bos taurus OX=9913 GN=SLC... [more]
sp|Q5E960|S39A3_BOVIN4.907e-3130.99Zinc transporter ZIP3 OS=Bos taurus OX=9913 GN=SLC... [more]
sp|P59889|S39A1_DANRE7.754e-3129.15Zinc transporter ZIP1 OS=Danio rerio OX=7955 GN=sl... [more]
back to top
BLAST of slc39a-13 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YKI30.000e+0100.00Slc39a-13 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
A0A0H3YKH68.824e-5335.60Slc39a-3 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YJF61.640e-5235.65Slc39a-11 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
U6J3833.896e-4535.45Zinc transporter ZIP1 OS=Echinococcus granulosus O... [more]
A0A5J4NIS71.413e-4435.26Solute carrier family 39 (Zinc transporter), membe... [more]
back to top
BLAST of slc39a-13 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SLC39A32.061e-3330.55solute carrier family 39 member 3 [Source:NCBI gen... [more]
slc39a11.818e-2828.47zinc transporter ZIP1-like [Source:NCBI gene;Acc:1... [more]
SLC39A11.475e-2323.15zinc transporter ZIP1 [Source:NCBI gene;Acc:103025... [more]
back to top
BLAST of slc39a-13 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SLC39A33.119e-1633.57solute carrier family 39 member 3 [Source:HGNC Sym... [more]
back to top
BLAST of slc39a-13 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc39a-13 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO343117.090e-4032.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc39a-13 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SLC39A31.128e-3530.06solute carrier family 39 member 3 [Source:NCBI gen... [more]
slc39a13.096e-3531.39solute carrier family 39 member 1 [Source:NCBI gen... [more]
back to top
BLAST of slc39a-13 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069905.10.000e+0100.00SMESG000069905.1[more]
SMESG000056994.10.000e+087.47SMESG000056994.1[more]
SMESG000027903.12.454e-5635.60SMESG000027903.1[more]
SMESG000016934.14.200e-5635.65SMESG000016934.1[more]
SMESG000016934.14.560e-5635.65SMESG000016934.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30013960
GenBankAKN21678.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013960 ID=SMED30013960|Name=slc39a-13|organism=Schmidtea mediterranea sexual|type=transcript|length=1326bp
GCATGTGATGTGAACAATTATGCGTAATATAATATTATTAGTTGTATAAG
TAGGTTTTGAACTGATGTGATAACATAATTAAATTTCACAATATAAAAAT
TAAATTTCAGGGGAATTCCATTAATGTCGAATTCATCAACGACCAGTCCG
TCAAATACCACAAGCGTTCCATGGGTACCTTTTATGAACCCTGTTAATCA
AGTTAAATTGGGAATGGCGGCTGCACTACTTGTTTCAGTTTTCATTGTGA
CCCTTATTCCATTCATTGTCATTCGACACCTTTCCAAAAAGTGGGGAATA
GAAAGTGTTAACAAAACAAGGGAGAATTCAAAAGCATATCGAAGATTCAC
TACTTGGCTATCAAGAATCAATTGTTTTGCTGGAGGAGTCTTTCTTTCAA
CGGGGTTTATGGACATTTTCCCAGAAATGTTAGAGTCCATTGAAGAGGCC
AAGATCAAAAACAAAATGACAAGCGTATTTCCTTTAGGACCCTTTCTAAC
TTTAATCGGATTTTTCATGATTTTAATAATCGAAGAATTAGTGACTTTCA
TCAAAAATCGTTTCTATGGATCTAAGGTCAGTCCTACTAAGGTGGTTATA
AACGATGAGTTCATAATGCCAACAGAATCCAATGCATGGCCAAGCAGTGC
CGTTAATGAAAATACTTTTGATTTTGATAAAGAATCCCGTGACTCGAATC
AAGTATTAAAAAAGGTTAGCGTAGATCGAGAACTTCATGATCATAGCATT
GACCATGCTCACCATGATCACCATGATCATGACCTAAATGCAGAAGCTTT
ATCTCGTGGAACTTTAAGTGTTACCATTTTGATGATCGCCATTTCAATTC
ATTCTATTTTTGAAGGACTGGCACTTGGTTTGCAAAAAGAAACCTCAGCT
GCAACGAGATTATTTTTAGCTCTGTGTCTTCATAAATATATAATAGCCAC
AACAATTAGTCTCCAATTATCAAAAAGCAGTTTGGGAATAAAAATGGCAT
GTTTATGTTCTGGAATATTTTCATTTGCTACTCCTTTCGGAGTGGTTTTA
GGATTTTGGGTTAATTACTTAGAAGAAAATGGCAATACAAGTTTTTCTAT
GGTCGCTGGTGTTTTACAAGGAATTGCATGTGGAACATTCTTTTATATAG
TTTTCTTCGAAATTCTACCAGAAGAATTCGGTAAAAAGCAAGATAAAATA
CTAAAAATAGTTGCTGTAATTCTTGGATTTGCATTAGTTAGCTTATTTAT
GTTGTTCATTCATGAATAATTTGATTGAGTACAGTGAAATAGTTTCTTTT
CCATTCAATTACTTACGATAAAAGAA
back to top

protein sequence of SMED30013960-orf-1

>SMED30013960-orf-1 ID=SMED30013960-orf-1|Name=SMED30013960-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=382bp
MSNSSTTSPSNTTSVPWVPFMNPVNQVKLGMAAALLVSVFIVTLIPFIVI
RHLSKKWGIESVNKTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFP
EMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGS
KVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSV
DRELHDHSIDHAHHDHHDHDLNAEALSRGTLSVTILMIAISIHSIFEGLA
LGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFS
FATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPE
EFGKKQDKILKIVAVILGFALVSLFMLFIHE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000421tail
Vocabulary: INTERPRO
TermDefinition
IPR003689ZIP
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0030001metal ion transport
Vocabulary: molecular function
TermDefinition
GO:0046873metal ion transmembrane transporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003689Zinc/iron permeasePFAMPF02535Zipcoord: 27..375
e-value: 9.5E-58
score: 196.0
NoneNo IPR availablePANTHERPTHR11040ZINC/IRON TRANSPORTERcoord: 27..378
NoneNo IPR availablePANTHERPTHR11040:SF137ZINC TRANSPORTER ZIP3coord: 27..378
NoneNo IPR availableTMHMMTMhelixcoord: 263..282
NoneNo IPR availableTMHMMTMhelixcoord: 29..51
NoneNo IPR availableTMHMMTMhelixcoord: 360..379
NoneNo IPR availableTMHMMTMhelixcoord: 78..100
NoneNo IPR availableTMHMMTMhelixcoord: 231..253
NoneNo IPR availableTMHMMTMhelixcoord: 326..348
NoneNo IPR availableTMHMMTMhelixcoord: 115..137
NoneNo IPR availableTMHMMTMhelixcoord: 294..316