WD repeat-containing protein 35

Overview
NameWD repeat-containing protein 35
Smed IDSMED30013955
Length (bp)3749
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WD repeat-containing protein 35 (SMED30013955) t-SNE clustered cells

Violin plots show distribution of expression levels for WD repeat-containing protein 35 (SMED30013955) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WD repeat-containing protein 35 (SMED30013955) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WD repeat-containing protein 35 (SMED30013955) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013955

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30013955SMESG000066519.1 SmedASXL_017750SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30013955SMESG000066519.1 SmedASXL_017751SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30013955SMESG000066519.1 dd_Smed_v4_9653_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30013955SMESG000066519.1 dd_Smed_v4_9653_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30013955SMESG000066519.1 dd_Smed_v6_9653_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30013955SMESG000066519.1 dd_Smed_v4_9653_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WD repeat-containing protein 35 vs. Ensembl Human
Match: WDR35 (WD repeat domain 35 [Source:HGNC Symbol;Acc:HGNC:29250])

HSP 1 Score: 1114.75 bits (2882), Expect = 0.000e+0
Identity = 567/1181 (48.01%), Postives = 804/1181 (68.08%), Query Frame = 2
Query:  131 MFVYLSKKISIPNDVQLTTLSWNTNKGYIACXXXXXXXXXXXXDPQVN-GNTRGIAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTIPD-KLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTD-ENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGLAVGQVTNKDFNLIQFYNPFGYHLRTLKVISTKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIYAFTKPEQCHYCVIFWNSKLDSFQTKYFYNLKAIISNGILCTIIYQADADSKQKYTLLVCNSIGTPIDTKELPFEPLYQVMTESHVIVASQNIIYAWQFKKPENLLSIESQT---KRKSTMDNFIHVDDISIQKDGPSSTENNLHSLMKKL--SNDPICAICSARRTLIVATESGKMKQYSMPLMEYETTHKLRSKPFKLEINCTGNRVASIDFGGILSFFDLDKKYTDENGASGQGQIVENFEYKDVWDMKFSEDNSQLFVMMEKTKLRIIQDVESEEPVVFSGYICQFKELEVKAVLLDEIMNDLDKPNKNNVVTLEAKILRDCRKLLEEGQIEKAKEFIEDRPHNKMWKMLAEHALEKLDLETADQAFVRYTYYPGVKFVXXXXXXXXXXXXXAEISIYFGRYEEAEHRFMAIDRPDLVIAMLKSIGDWSRVLQLMKSGNS-ASDAEMNEAWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLERXXXXXXXXXXXXXXIAEIFVNAGMCEQAVFTYVKSDQLKSAIDCCIQLNHWQTAIDLAKNRDMTNINEMLTRYAKQLLDNKCYVQAVELYRRAGCFLEAAKIVQKLTEQEAKTSKNYSKLKKMSVLIGLLIEQHHDQNKIQAKARLKDIKGQDAASALNGMLHEEFHGVTESRLLDRPWHWAEAYHFYLLAQRQLFQKFFDAAMRTAKLLVDYEDVIAPRDIYSLIAICAIHNRAFGTSSKAFTKLETLNSFSEKEKENLISLTFKIFTKYSPIDPPRAREYDELENTFDGDSKIPICIVSGQPITQGQFWMCPICKHSAHEDEMNKHQNCPLCHSP 3646
            MF YLSKKISIPN+V+L  +SWN  +G+IACGG +GLLKVLKL+ Q +    RG+AAP+NL+MN+TLE H  ++  +TWNE++ K+T++DE+G+IIVW+L+K SW +EMINN N   V  + WN DG+KICI YEDG++I+GSVDGNRIWGK +   +LSHV WS DS++L+FG+ +G+IHIYD  GN +  +K  C  +    I I GI WY G +GY+  +CPCLAVC+ +G CQIMR+END+ PVLI+T +    + WN  G+VLA+ G     + +KD N++QFY PFG HL TLKV   ++ + SW+   L++A+AVDS IYFANIRP+YKW YC++T++YA+T+P++  YCV+FW++K +    KY   L +I + G  C +  +AD +  Q + L++CNSIGTP+D K +   PL+  MT++HVI AS+   Y WQ++  + L ++E       RK   +   HVDD       PS + + +    K +  + DPICAI ++ + LIV  ESG +++YS+P +     + L  + ++L +NC  +R+A ID  G+L+FFDLD + TD  G    G++++  E +DVWDMK+++DN  LF MMEKT++ + ++++ EEP+  SGYIC F++LE+K+VLLDEI+ D + PNK+ ++  E + LRD R L+E+  I+ A +FIED PH ++W++LAE AL+KLDL TA+QAFVR   Y G+KFVK+L KL + ++K AE+  YFGR+EEAE  ++ +DR DL I +   +GDW RVLQL+K+G+  A D+ + +A NAIG  + D+  W  AV Y+ QGR  E L ECYY LEDY GLE LA  LPEN  LL EIA++FV  GMCEQAV  ++K  Q K+A+D C+ LN W  A++LAKN  M  I  +L RYA  LL+    + A+ELYR+A  F +AAK++ K+ ++EAK      ++KK+ VL  LLIEQ+H+Q K   + ++K  K  +A SAL G+L EE    T+ R  D  W  AEAYHF++LAQRQL++   D A++TA  L DYED+I P +IYSL+A+CA  +RAFGT SKAF KL++L + S ++K+    L  +IFTK++  D  R  E D L     G+ K+P C+ +G PIT+ QFWMC +CKH     E++ +  CPLCHSP
Sbjct:    1 MFFYLSKKISIPNNVKLQCVSWNKEQGFIACGGEDGLLKVLKLETQTDDAKLRGLAAPSNLSMNQTLEGHSGSVQVVTWNEQYQKLTTSDENGLIIVWMLYKGSWIEEMINNRNKSVVRSMSWNADGQKICIVYEDGAVIVGSVDGNRIWGKDLKGIQLSHVTWSADSKVLLFGMANGEIHIYDNQGNFMIKMKLSCLVNVTGAISIAGIHWYHGTEGYVEPDCPCLAVCFDNGRCQIMRHENDQNPVLIDTGMYVVGIQWNHMGSVLAVAGFQKAAMQDKDVNIVQFYTPFGEHLGTLKVPGKEISALSWEGGGLKIALAVDSFIYFANIRPNYKWGYCSNTVVYAYTRPDRPEYCVVFWDTKNNEKYVKYVKGLISITTCGDFCILATKADENHPQ-FVLVLCNSIGTPLDPKYIDIVPLFVAMTKTHVIAASKEAFYTWQYRVAKKLTALEINQITRSRKEGRERIYHVDDT------PSGSMDGVLDYSKTIQGTRDPICAITASDKILIVGRESGTIQRYSLPNVGLIQKYSLNCRAYQLSLNCNSSRLAIIDISGVLTFFDLDARVTDSTGQQVVGELLK-LERRDVWDMKWAKDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGYICNFEDLEIKSVLLDEILKDPEHPNKDYLINFEIRSLRDSRALIEKVGIKDASQFIEDNPHPRLWRLLAEAALQKLDLYTAEQAFVRCKDYQGIKFVKRLGKLLSESMKQAEVVGYFGRFEEAERTYLEMDRRDLAIGLRLKLGDWFRVLQLLKTGSGDADDSLLEQANNAIGDYFADRQKWLNAVQYYVQGRNQERLAECYYMLEDYEGLENLAISLPENHKLLPEIAQMFVRVGMCEQAVTAFLKCSQPKAAVDTCVHLNQWNKAVELAKNHSMKEIGSLLARYASHLLEKNKTLDAIELYRKANYFFDAAKLMFKIADEEAKKGSKPLRVKKLYVLSALLIEQYHEQMKNAQRGKVKG-KSSEATSALAGLLEEEVLSTTD-RFTDNAWRGAEAYHFFILAQRQLYEGCVDTALKTALHLKDYEDIIPPVEIYSLLALCACASRAFGTCSKAFIKLKSLETLSSEQKQQYEDLALEIFTKHTSKD-NRKPELDSLME--GGEGKLPTCVATGSPITEYQFWMCSVCKHGVLAQEISHYSFCPLCHSP 1168          
BLAST of WD repeat-containing protein 35 vs. Ensembl Human
Match: WDR35 (WD repeat domain 35 [Source:HGNC Symbol;Acc:HGNC:29250])

HSP 1 Score: 1112.83 bits (2877), Expect = 0.000e+0
Identity = 567/1191 (47.61%), Postives = 805/1191 (67.59%), Query Frame = 2
Query:  131 MFVYLSKKISIPNDVQLTTLSWNTNKGYIACXXXXXXXXXXXXDPQVN-GNTRGIAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTIPD-KLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTD-ENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGLAVGQVTNKDFNLIQFYNPFGYHLRTLKVISTKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIYAFTKPEQCHYCVIFWNSKLDSFQTKYFYNLKAIISNGILCTIIYQADADSKQK----------YTLLVCNSIGTPIDTKELPFEPLYQVMTESHVIVASQNIIYAWQFKKPENLLSIESQT---KRKSTMDNFIHVDDISIQKDGPSSTENNLHSLMKKL--SNDPICAICSARRTLIVATESGKMKQYSMPLMEYETTHKLRSKPFKLEINCTGNRVASIDFGGILSFFDLDKKYTDENGASGQGQIVENFEYKDVWDMKFSEDNSQLFVMMEKTKLRIIQDVESEEPVVFSGYICQFKELEVKAVLLDEIMNDLDKPNKNNVVTLEAKILRDCRKLLEEGQIEKAKEFIEDRPHNKMWKMLAEHALEKLDLETADQAFVRYTYYPGVKFVXXXXXXXXXXXXXAEISIYFGRYEEAEHRFMAIDRPDLVIAMLKSIGDWSRVLQLMKSGNS-ASDAEMNEAWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLERXXXXXXXXXXXXXXIAEIFVNAGMCEQAVFTYVKSDQLKSAIDCCIQLNHWQTAIDLAKNRDMTNINEMLTRYAKQLLDNKCYVQAVELYRRAGCFLEAAKIVQKLTEQEAKTSKNYSKLKKMSVLIGLLIEQHHDQNKIQAKARLKDIKGQDAASALNGMLHEEFHGVTESRLLDRPWHWAEAYHFYLLAQRQLFQKFFDAAMRTAKLLVDYEDVIAPRDIYSLIAICAIHNRAFGTSSKAFTKLETLNSFSEKEKENLISLTFKIFTKYSPIDPPRAREYDELENTFDGDSKIPICIVSGQPITQGQFWMCPICKHSAHEDEMNKHQNCPLCHSP 3646
            MF YLSKKISIPN+V+L  +SWN  +G+IACGG +GLLKVLKL+ Q +    RG+AAP+NL+MN+TLE H  ++  +TWNE++ K+T++DE+G+IIVW+L+K SW +EMINN N   V  + WN DG+KICI YEDG++I+GSVDGNRIWGK +   +LSHV WS DS++L+FG+ +G+IHIYD  GN +  +K  C  +    I I GI WY G +GY+  +CPCLAVC+ +G CQIMR+END+ PVLI+T +    + WN  G+VLA+ G     + +KD N++QFY PFG HL TLKV   ++ + SW+   L++A+AVDS IYFANIRP+YKW YC++T++YA+T+P++  YCV+FW++K +    KY   L +I + G  C +  +AD +  Q+          + L++CNSIGTP+D K +   PL+  MT++HVI AS+   Y WQ++  + L ++E       RK   +   HVDD       PS + + +    K +  + DPICAI ++ + LIV  ESG +++YS+P +     + L  + ++L +NC  +R+A ID  G+L+FFDLD + TD  G    G++++  E +DVWDMK+++DN  LF MMEKT++ + ++++ EEP+  SGYIC F++LE+K+VLLDEI+ D + PNK+ ++  E + LRD R L+E+  I+ A +FIED PH ++W++LAE AL+KLDL TA+QAFVR   Y G+KFVK+L KL + ++K AE+  YFGR+EEAE  ++ +DR DL I +   +GDW RVLQL+K+G+  A D+ + +A NAIG  + D+  W  AV Y+ QGR  E L ECYY LEDY GLE LA  LPEN  LL EIA++FV  GMCEQAV  ++K  Q K+A+D C+ LN W  A++LAKN  M  I  +L RYA  LL+    + A+ELYR+A  F +AAK++ K+ ++EAK      ++KK+ VL  LLIEQ+H+Q K   + ++K  K  +A SAL G+L EE    T+ R  D  W  AEAYHF++LAQRQL++   D A++TA  L DYED+I P +IYSL+A+CA  +RAFGT SKAF KL++L + S ++K+    L  +IFTK++  D  R  E D L     G+ K+P C+ +G PIT+ QFWMC +CKH     E++ +  CPLCHSP
Sbjct:    1 MFFYLSKKISIPNNVKLQCVSWNKEQGFIACGGEDGLLKVLKLETQTDDAKLRGLAAPSNLSMNQTLEGHSGSVQVVTWNEQYQKLTTSDENGLIIVWMLYKGSWIEEMINNRNKSVVRSMSWNADGQKICIVYEDGAVIVGSVDGNRIWGKDLKGIQLSHVTWSADSKVLLFGMANGEIHIYDNQGNFMIKMKLSCLVNVTGAISIAGIHWYHGTEGYVEPDCPCLAVCFDNGRCQIMRHENDQNPVLIDTGMYVVGIQWNHMGSVLAVAGFQKAAMQDKDVNIVQFYTPFGEHLGTLKVPGKEISALSWEGGGLKIALAVDSFIYFANIRPNYKWGYCSNTVVYAYTRPDRPEYCVVFWDTKNNEKYVKYVKGLISITTCGDFCILATKADENHPQEENEMETFGATFVLVLCNSIGTPLDPKYIDIVPLFVAMTKTHVIAASKEAFYTWQYRVAKKLTALEINQITRSRKEGRERIYHVDDT------PSGSMDGVLDYSKTIQGTRDPICAITASDKILIVGRESGTIQRYSLPNVGLIQKYSLNCRAYQLSLNCNSSRLAIIDISGVLTFFDLDARVTDSTGQQVVGELLK-LERRDVWDMKWAKDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGYICNFEDLEIKSVLLDEILKDPEHPNKDYLINFEIRSLRDSRALIEKVGIKDASQFIEDNPHPRLWRLLAEAALQKLDLYTAEQAFVRCKDYQGIKFVKRLGKLLSESMKQAEVVGYFGRFEEAERTYLEMDRRDLAIGLRLKLGDWFRVLQLLKTGSGDADDSLLEQANNAIGDYFADRQKWLNAVQYYVQGRNQERLAECYYMLEDYEGLENLAISLPENHKLLPEIAQMFVRVGMCEQAVTAFLKCSQPKAAVDTCVHLNQWNKAVELAKNHSMKEIGSLLARYASHLLEKNKTLDAIELYRKANYFFDAAKLMFKIADEEAKKGSKPLRVKKLYVLSALLIEQYHEQMKNAQRGKVKG-KSSEATSALAGLLEEEVLSTTD-RFTDNAWRGAEAYHFFILAQRQLYEGCVDTALKTALHLKDYEDIIPPVEIYSLLALCACASRAFGTCSKAFIKLKSLETLSSEQKQQYEDLALEIFTKHTSKD-NRKPELDSLME--GGEGKLPTCVATGSPITEYQFWMCSVCKHGVLAQEISHYSFCPLCHSP 1179          
BLAST of WD repeat-containing protein 35 vs. Ensembl Human
Match: WDR35 (WD repeat domain 35 [Source:HGNC Symbol;Acc:HGNC:29250])

HSP 1 Score: 814.298 bits (2102), Expect = 0.000e+0
Identity = 407/853 (47.71%), Postives = 585/853 (68.58%), Query Frame = 2
Query:  131 MFVYLSKKISIPNDVQLTTLSWNTNKGYIACXXXXXXXXXXXXDPQVN-GNTRGIAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTIPD-KLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTD-ENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGLAVGQVTNKDFNLIQFYNPFGYHLRTLKVISTKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIYAFTKPEQCHYCVIFWNSKLDSFQTKYFYNLKAIISNGILCTIIYQADADSKQK----------YTLLVCNSIGTPIDTKELPFEPLYQVMTESHVIVASQNIIYAWQFKKPENLLSIESQT---KRKSTMDNFIHVDDISIQKDGPSSTENNLHSLMKKL--SNDPICAICSARRTLIVATESGKMKQYSMPLMEYETTHKLRSKPFKLEINCTGNRVASIDFGGILSFFDLDKKYTDENGASGQGQIVENFEYKDVWDMKFSEDNSQLFVMMEKTKLRIIQDVESEEPVVFSGYICQFKELEVKAVLLDEIMNDLDKPNKNNVVTLEAKILRDCRKLLEEGQIEKAKEFIEDRPHNKMWKMLAEHALEKLDLETADQAFVRYTYYPGVKFVXXXXXXXXXXXXXAEISIYFGRYEEAEHRFMAIDRPDLVIAMLKSIGDWSRVLQLMKSGNS-ASDAEMNEAWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLE 2632
            MF YLSKKISIPN+V+L  +SWN  +G+IACGG +GLLKVLKL+ Q +    RG+AAP+NL+MN+TLE H  ++  +TWNE++ K+T++DE+G+IIVW+L+K SW +EMINN N   V  + WN DG+KICI YEDG++I+GSVDGNRIWGK +   +LSHV WS DS++L+FG+ +G+IHIYD  GN +  +K  C  +    I I GI WY G +GY+  +CPCLAVC+ +G CQIMR+END+ PVLI+T +    + WN  G+VLA+ G     + +KD N++QFY PFG HL TLKV   ++ + SW+   L++A+AVDS IYFANIRP+YKW YC++T++YA+T+P++  YCV+FW++K +    KY   L +I + G  C +  +AD +  Q+          + L++CNSIGTP+D K +   PL+  MT++HVI AS+   Y WQ++  + L ++E       RK   +   HVDD       PS + + +    K +  + DPICAI ++ + LIV  ESG +++YS+P +     + L  + ++L +NC  +R+A ID  G+L+FFDLD + TD  G    G++++  E +DVWDMK+++DN  LF MMEKT++ + ++++ EEP+  SGYIC F++LE+K+VLLDEI+ D + PNK+ ++  E + LRD R L+E+  I+ A +FIED PH ++W++LAE AL+KLDL TA+QAFVR   Y G+KFVK+L KL + ++K AE+  YFGR+EEAE  ++ +DR DL I +   +GDW RVLQL+K+G+  A D+ + +A NAIG  + D+  W  AV Y+ QGR  E L ECYY LEDY GLE
Sbjct:    1 MFFYLSKKISIPNNVKLQCVSWNKEQGFIACGGEDGLLKVLKLETQTDDAKLRGLAAPSNLSMNQTLEGHSGSVQVVTWNEQYQKLTTSDENGLIIVWMLYKGSWIEEMINNRNKSVVRSMSWNADGQKICIVYEDGAVIVGSVDGNRIWGKDLKGIQLSHVTWSADSKVLLFGMANGEIHIYDNQGNFMIKMKLSCLVNVTGAISIAGIHWYHGTEGYVEPDCPCLAVCFDNGRCQIMRHENDQNPVLIDTGMYVVGIQWNHMGSVLAVAGFQKAAMQDKDVNIVQFYTPFGEHLGTLKVPGKEISALSWEGGGLKIALAVDSFIYFANIRPNYKWGYCSNTVVYAYTRPDRPEYCVVFWDTKNNEKYVKYVKGLISITTCGDFCILATKADENHPQEENEMETFGATFVLVLCNSIGTPLDPKYIDIVPLFVAMTKTHVIAASKEAFYTWQYRVAKKLTALEINQITRSRKEGRERIYHVDDT------PSGSMDGVLDYSKTIQGTRDPICAITASDKILIVGRESGTIQRYSLPNVGLIQKYSLNCRAYQLSLNCNSSRLAIIDISGVLTFFDLDARVTDSTGQQVVGELLK-LERRDVWDMKWAKDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGYICNFEDLEIKSVLLDEILKDPEHPNKDYLINFEIRSLRDSRALIEKVGIKDASQFIEDNPHPRLWRLLAEAALQKLDLYTAEQAFVRCKDYQGIKFVKRLGKLLSESMKQAEVVGYFGRFEEAERTYLEMDRRDLAIGLRLKLGDWFRVLQLLKTGSGDADDSLLEQANNAIGDYFADRQKWLNAVQYYVQGRNQERLAECYYMLEDYEGLE 846          
BLAST of WD repeat-containing protein 35 vs. Ensembl Human
Match: WDR35 (WD repeat domain 35 [Source:HGNC Symbol;Acc:HGNC:29250])

HSP 1 Score: 346.665 bits (888), Expect = 1.145e-107
Identity = 176/382 (46.07%), Postives = 257/382 (67.28%), Query Frame = 2
Query: 1496 RKSTMDNFIHVDDISIQKDGPSSTENNLHSLMKKL--SNDPICAICSARRTLIVATESGKMKQYSMPLMEYETTHKLRSKPFKLEINCTGNRVASIDFGGILSFFDLDKKYTDENGASGQGQIVENFEYKDVWDMKFSEDNSQLFVMMEKTKLRIIQDVESEEPVVFSGYICQFKELEVKAVLLDEIMNDLDKPNKNNVVTLEAKILRDCRKLLEEGQIEKAKEFIEDRPHNKMWKMLAEHALEKLDLETADQAFVRYTYYPGVKFVXXXXXXXXXXXXXAEISIYFGRYEEAEHRFMAIDRPDLVIAMLKSIGDWSRVLQLMKSGNS-ASDAEMNEAWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLE 2632
            RK   +   HVDD       PS + + +    K +  + DPICAI ++ + LIV  ESG +++YS+P +     + L  + ++L +NC  +R+A ID  G+L+FFDLD + TD  G    G++++  E +DVWDMK+++DN  LF MMEKT++ + ++++ EEP+  SGYIC F++LE+K+VLLDEI+ D + PNK+ ++  E + LRD R L+E+  I+ A +FIED PH ++W++LAE AL+KLDL TA+QAFVR   Y G+KFVK+L KL + ++K AE+  YFGR+EEAE  ++ +DR DL I +   +GDW RVLQL+K+G+  A D+ + +A NAIG  + D+  W  AV Y+ QGR  E L ECYY LEDY GLE
Sbjct:    7 RKEGRERIYHVDDT------PSGSMDGVLDYSKTIQGTRDPICAITASDKILIVGRESGTIQRYSLPNVGLIQKYSLNCRAYQLSLNCNSSRLAIIDISGVLTFFDLDARVTDSTGQQVVGELLK-LERRDVWDMKWAKDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGYICNFEDLEIKSVLLDEILKDPEHPNKDYLINFEIRSLRDSRALIEKVGIKDASQFIEDNPHPRLWRLLAEAALQKLDLYTAEQAFVRCKDYQGIKFVKRLGKLLSESMKQAEVVGYFGRFEEAERTYLEMDRRDLAIGLRLKLGDWFRVLQLLKTGSGDADDSLLEQANNAIGDYFADRQKWLNAVQYYVQGRNQERLAECYYMLEDYEGLE 381          
BLAST of WD repeat-containing protein 35 vs. Ensembl Human
Match: WDR35 (WD repeat domain 35 [Source:HGNC Symbol;Acc:HGNC:29250])

HSP 1 Score: 251.136 bits (640), Expect = 3.367e-75
Identity = 116/246 (47.15%), Postives = 168/246 (68.29%), Query Frame = 2
Query:  596 KLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTD-ENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGLAVGQVTNKDFNLIQFYNPFGYHLRTLKVISTKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIYAFTKPEQCHYCVIFWNSKLDSFQTKYFYNLKAIISNGILCTIIYQADADSKQKYTLL 1330
            +LSHV WS DS++L+FG+ +G+IHIYD  GN +  +K  C  +    I I GI WY G +GY+  +CPCLAVC+ +G CQIMR+END+ PVLI+T +    + WN  G+VLA+ G     + +KD N++QFY PFG HL TLKV   ++ + SW+   L++A+AVDS IYFANIRP+YKW YC++T++YA+T+P++  YCV+FW++K +    KY   L +I + G  C +  +AD +  Q + LL
Sbjct:    4 QLSHVTWSADSKVLLFGMANGEIHIYDNQGNFMIKMKLSCLVNVTGAISIAGIHWYHGTEGYVEPDCPCLAVCFDNGRCQIMRHENDQNPVLIDTGMYVVGIQWNHMGSVLAVAGFQKAAMQDKDVNIVQFYTPFGEHLGTLKVPGKEISALSWEGGGLKIALAVDSFIYFANIRPNYKWGYCSNTVVYAYTRPDRPEYCVVFWDTKNNEKYVKYVKGLISITTCGDFCILATKADENHPQYHCLL 249          
BLAST of WD repeat-containing protein 35 vs. Ensembl Celegans
Match: ifta-1 (IntraFlagellar Transport Associated [Source:UniProtKB/TrEMBL;Acc:Q18859])

HSP 1 Score: 453.751 bits (1166), Expect = 1.839e-138
Identity = 347/1260 (27.54%), Postives = 595/1260 (47.22%), Query Frame = 2
Query:  131 MFVYLSKKISIPNDVQLTTLSWNTNKGYIACXXXXXXXXXXXXDPQVNGNTRGIAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGI----------------------------------------KWNPDGEKICIAYEDGSIIIGSVDGNR--------IWGKTIPDKLSHVE-----------WSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTDENPIKIVGIEWYKGDKGY-----MCKNCPCLAVCYSSGCCQIMRNENDEYPVLINT-RLEAKCLAWNGNGTVLAIGGLAVGQVTNKD---FNLIQFYNPFGYHLRTLKVISTKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIYAFTKPEQCHYCVIFWNSKLDSFQTKYFYNLKAIISNGILCTIIYQADADSKQKYTLLVCNSIGTPIDTKELPFEPLYQVMTESHVIVASQNIIYAWQFKKPENLLSIESQTKRKSTMDNFIHVDDIS---IQKDGPSSTENNLHSLMKKLSNDPICAICSARRTLIVATESGKMKQYSMPLMEYETTHKLRSKPFKLEINCTGNRVASID------FGGILSFFDLDKKYTDENGASGQGQIVENFEYKDVWDMKFSEDNSQLFVMMEKTKLRIIQDVESEEPVVFSGYICQFKELEVKAVLLDEIMNDLDKPNKNNVVTLEAKILRDCRKLLEEGQIEKAKEFIEDRPHNKMWKMLAEHALEKLDLETADQAFVRYTYYPGVKFVXXXXXXXXXXXXXAEISIYFGRYEEAEHRFMAIDRPDLVIAMLKSIGDWSRVLQLMKSGNSASDAEMNEAWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLERXXXXXXXXXXXXXXIAEIFVNAGMCEQAVFTYVKSDQLKSAIDCCIQLNHWQTAIDLAKNRDMTNINEMLTRYAKQLL--DNKCYVQAVELYRRAGCFLEAAKIVQKLTEQEAKTSKNYSKLKKMSVLIGLLIEQHHDQNKIQAKARLKDIKGQDAASALNGMLHEEFHGVT--ESRLLDRPWHWAEAYHFYLLAQRQLFQKFFDAAMRTAKLLVDYEDVIAPRDIYSLIAICAIHNRAFGTSSKAFTKLETLNSFSEKEKENLISLTFKIFTKYSPIDPPRAREY----DELENTFD-----GDSKIPICIVSGQPITQGQFWMCPICKHSAHEDEMNKHQNCPLCH 3640
            M V+    + +P   QL    WN N  YIACGG  G LKV+K+        +   A T L +N+ LE H +T+   TWNE   K+T++D SG+IIVW +F   W +EMINN N   V  I                                        +W PDG+ +     DG + +    G+         +  + +   L+  E           WSP   L    +LD     ++    K   +         P K    E  + +K       +  + P   V Y+ G  Q+MR+ ND  PV+++    +     W+ NG  LA+     G  ++KD   F+ I F + +G+ +   +   + +    W++  LR+AIA   ++    IRP +KW    +TI+Y + K E   Y ++F++ K D    K   + + +      C +I + D      Y   +CNSIGT +D       P +  +     ++AS++  + W F  P           + +++   IHV   S   + ++   + E     L+   S D ICA+C      ++A  SG + + S+       ++ +      +++NCT  R+A I       F  +L  FD D           + +++   + +DVWD ++ ++NS +  + +K K+ I       E    +G I  F+ L V AV +++I+   + P K  +V +  K  +D   L+   ++E+A ++ E  PH+++W M+A +A+ K   + A+ AFV+   Y GV+ VKKL+ +Q+N+L+ AEI  Y    EEA+  F+  DR DL + M K +GD++ V  L++  N   D    +A+  +   +++   W +A   ++      N ++C      +  LE LA  L ++S  +  + + F + GMC+QAV  Y++    + A+  C +LN WQ A  +A    M N+  +L ++A ++    ++  + A+ LY RAG  L+AAKI   + +        Y +LK+  VL  +L+E H        +  +K+++  D  + L   L +E  G++  +SR+L+  W  AEA+HF ++AQ+  F+     A++T+ +L DYE+ + P +++S+IA+ A +   FG  SKA  +LE    F + EKE + +L+F++F++  P++P  A+      D   + +D       +K P+CI SG+ I    FW+CP CKH AH+ E+ K+  CPLCH
Sbjct:   21 MSVFRKFNLGLPEHGQLHFAEWNYNSNYIACGGALGKLKVVKIGTDATDLNKSPNAAT-LVVNQALEGHNATVMNATWNENNQKLTTSDTSGLIIVWGMFNEQWCEEMINNRNKSVVVSICWNLEGTKIAIAYADGNVIVGTLEGNRIWNKELEIQLAACEWAPDGDMLIFGTADGKVSVFDDSGSHFLDIPMHCLEAEDLEQALAKKEHQKEEIVCLKYWSP--TLKSKTILDEMERDFERKLEKDREVTGTAIFTNFPTKPPPKELPEHEKNTEPYQPVPPDRPRFVVAYARGMMQLMRSLNDPEPVVVSIPNFKITGAKWSPNGAFLAV----CGNDSDKDEPTFSKIHFLSAYGHIVGYFQTNDSCITGICWESTGLRMAIAAAGTLLIGQIRPEFKWGSIEETIVYVYQKEELYQYGIMFYDYKTDEKTVKTVTHFENMAFYREHCVLINRQDDGVIPHYFCQLCNSIGTSLDYNVTTVRPKFACVNGICAVIASEDRYFIWHFVLP-----------KFNSVQAGIHVPGKSGDYVLEEQQRTIEYGTKRLLG--SKDEICALCIGDTFFMMALLSGGIYRVSLNDGVITNSYPVSPSINSIKLNCTFTRLAVIKLVEQVPFQFLLYEFDGD-----------ELKLIYTSDKRDVWDYEWDQNNSNMLALKDKQKILICDGNSILEQSSVNGSILLFQNLVVTAVNIEKILLTPENPTKTCIVEVMIKAKQDVMNLVNAMKLEEAIDYAERSPHSELWSMIANYAVFKHAFDCAEHAFVKLGDYAGVQLVKKLRNIQSNDLRNAEIYAYRDTLEEAKTAFLQADRRDLAVEMYKKVGDYASVYDLIR--NDDDDEGKCDAFRNMAETHYEMMEWEEAAKAYSYCGDTANQIDCLIRGNLFGELEVLARTLSDDSEFMEVMGDAFTSRGMCDQAVECYLRRSLPQKALHACKELNQWQKAQFIADANHMENVEGLLGKFAVEMRGESDEKSLSALALYMRAGRHLDAAKIAFDIAKDRKSKYVPYEELKQCYVLGAVLVENH--------RQTIKELRKIDKHNFLEDALDDE-SGLSAEQSRILENTWRGAEAFHFMIMAQQHFFENRIKDALQTSLILSDYEEFLDPAEVHSMIALAAANVNQFGICSKAMMRLEAFEEFDDAEKEEMRNLSFRLFSENPPVNPNSAKVACSVCDAKIDPYDLQCSECQTKFPVCIASGRLILDNIFWLCPRCKHRAHQHEIPKYNCCPLCH 1238          
BLAST of WD repeat-containing protein 35 vs. Ensembl Celegans
Match: tub-2 (TUBby-related [Source:UniProtKB/TrEMBL;Acc:Q9BL53])

HSP 1 Score: 97.8265 bits (242), Expect = 2.689e-20
Identity = 61/222 (27.48%), Postives = 108/222 (48.65%), Query Frame = 2
Query:  299 PTNLTM-NETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKT--IPDKLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTDE------NPI--KIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAI 931
            P +LT  N  L  H + +  +TWN+   K+ S D SG+I VW+   + W  E++N+    +V+ + W+P G    I Y+D  ++IGS +G R+W  +  +P  ++   W+PDSR L+ G   G I +    G  I       T D+      +P+  K+  +EW              LA+  S+    ++   +  +P +  ++ +   + WN +GT+LA+
Sbjct:   55 PDDLTRYNFNLRGHHNAIRMVTWNKSQSKLASCDASGIIYVWVRNDDRWSVELVNDRGV-KVSDLSWSPCGGSALICYDDNFVLIGSANGQRVWSNSFPLPAAVTCGVWAPDSRQLVLGFSTGTIQVLSNAGVNI--TSRSFTEDKLTQMAFSPLRTKVREVEW-------------TLAMLSSANKIYMISAYDQLHPAIYRSKFQVIRMEWNTDGTILAL 260          
BLAST of WD repeat-containing protein 35 vs. Ensembl Fly
Match: Oseg4 (gene:FBgn0035264 transcript:FBtr0072797)

HSP 1 Score: 811.987 bits (2096), Expect = 0.000e+0
Identity = 477/1219 (39.13%), Postives = 708/1219 (58.08%), Query Frame = 2
Query:  131 MFVYLSKKISIPNDVQLTTLSWNTNKGYIACXXXXXXXXXXXXDPQV-NGNTRG-IAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTIPDK-LSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCT-----TDENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGL---AVGQVTNKDFNLIQFYNPFGYHLRTLKVISTKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIY---AFTKPEQCHYCVIFWNSK--------------LDSFQTKYFYNLKAIISNG---ILCTIIYQADADSKQKYTLLVCNSIGTPIDTKELPFEPLYQVMTESHVIVASQNIIYAWQFKKPENLLSIESQTKRKSTMDNFIHVDD----ISIQKD-GPSSTENNLHSLMKKLSNDPICAICSARRTLIVATESGKMKQYSMPLMEYETTHKLRSKPFKLEINCTGNRVASIDFGGILSFFDLDKKYTDENGASGQGQIVENFEYKDVWDMKFSEDNSQLFVMMEKTKLRIIQDVESEEPVVFSGYICQFKELEVKAVLLDEIMNDLDKPNKNNVVTLEAKILRDCRKLLEEGQIEKAKEFIEDRPHNKMWKMLAEHALEKLDLETADQAFVRYTYYPGVKFVXXXXXXXXXXXXXAEISIYFGRYEEAEHRFMAIDRPDLVIAMLKSIGDWSRVLQLMKSGNSA-SDAEMNEAWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLERXXXXXXXXXXXXXXIAEIFVNAGMCEQAVFTYVKSDQLKSAIDCCIQLNHWQTAIDLAKNRDMTNINEMLTRYAKQLLDNKCYVQAVELYRRAGCFLEAAKIVQKLTEQEAKTSKNYSKLKKMSVLIGLLIEQHHDQNKIQAKARLKDIKGQDAASALNGMLHEEFHGVTESRLLDRPWHWAEAYHFYLLAQRQLFQKFFDAAMRTAKLLVDYEDVIAPRDIYSLIAICAIHNRAFGTSSKAFTKLETLNSFSEKEKENLISLTFKIFTKYSPIDPPRAR---------EYDELENTFDGDSKIPICIVSGQPITQ--GQFWMCPICKHSAHEDEMNKHQNCPLCHS 3643
            MFVYLSKKI+IPN+V+L  ++WN  +GYIA  G +GLLKVLKLD    NG ++G +AA +NL+MN+TL+ HK ++  +TWN+   K+TS+D  GVI+VW+L+K SW++EM N+     V  + W  DG +ICI YEDG+II+GSVDGNRI+GK +    L+ V+WSPD+RL++F L +G+ H+YD  GN    L   C      +     +I  I W+ G +    +  P LA+CY +G  QIMRNEND+ P + +T +      WN +GTVLAI G    AV   + +D N + FY+P G   RTLKV  T + S SW+ +SLR+A+AVDS IYFANIRP Y W Y   T+++        E     + FWN+               L S        ++ + SN     L T+  +++    + Y LL+CNSIGT +D+K     P +  +  S+V +ASQ  I  W +  P++  ++ +   RK   +   H+DD    + + KD   SS+  + HS  + +S DPICA+  + + L+VA ESG + +YS+  +     H + +K +K+ INC   R A ID  G+++  DLD     +   S         E KDVW + ++ DN  L  +MEKT++ I +  + EEPV  SGYIC F++LE+ +VLLD+I++  +  N ++++ L  K LRD   LLE   +E AK+FIED PH ++W++LAE AL+KL+LETA+ AFVR  +YPG+K VK+L+ + +  L+ AEIS ++G +EEAE  ++  DR DL I +  ++ DW RV+QL + G S  SD +M  AW  IG  + +  +W  A  Y+ +    E  +E  Y+LE +  LE+  E LPE SPLL ++AE+  + GMC +AV  +++    K+A+  C+ L  W  A++LA+   +  +  ++ ++A QLL      +A+E+ R AG  L+AA+++ ++ E+E +      ++KK+ VL  LL E+H     ++A A  +     D AS  N +L  +   + ++  ++R WH AEAYHF LLAQRQL      +A+ TA  L DYEDV+ P  IYSL+A+ +  +RAFGT SKAF KLE      E   +    L   IF KY P D    R           D   +  + +++ P CI SG+PITQ     W+C  C H A   E+++H+ CPLCHS
Sbjct:    1 MFVYLSKKIAIPNNVKLNCIAWNKEEGYIAVAGTDGLLKVLKLDQATPNGQSKGGLAAVSNLSMNQTLDGHKESVRVVTWNDAQQKLTSSDTDGVIMVWMLYKGSWYEEMTNDRKKSTVASMSWTSDGSRICIVYEDGAIIVGSVDGNRIFGKELKGTHLTGVQWSPDNRLILFALANGECHLYDNQGNFAMKLHIQCVNISGGSSSRGHRIASICWFSG-RVVQSRKRPVLAICYENGRVQIMRNENDDAPAIFDTGMRNVDAKWNHDGTVLAICGTTLDAVSPTSQRDTNQVCFYSPLGKIYRTLKVPGTDITSLSWEGKSLRIAMAVDSFIYFANIRPDYIWCYFEKTVVFLNSGSATRESPMSVITFWNTVSNQSFLKEVEPTLCLASSSEHCVLGVECVSSNIKEIALSTLENRSNPADDRVYQLLLCNSIGTTVDSKYTDIRPCFVGINSSYVAIASQEEILIWHYHTPKSASTLHNVKARK---EKRFHIDDTPTGVEMAKDLMLSSSSGDGHSTQRGIS-DPICALALSEKLLLVARESGAINEYSIANVALRNRHLMNAKVYKMAINCNSTRAAIIDHMGVMTLLDLDDNRETQLNFS-------RVERKDVWAVSWATDNPLLLALMEKTRMYIFRGNDPEEPVSCSGYICTFEDLEITSVLLDDIISVGELQNFSHIIQLRVKSLRDTDDLLEHVGLEDAKQFIEDNPHPRLWRLLAESALKKLELETAENAFVRCAHYPGIKLVKRLRTIHSKELQRAEISAFYGEFEEAEKLYLDADRRDLAIELRMTLCDWFRVVQLYRMGGSGVSDQQMEIAWREIGHHFANLRSWESAREYYEKSHYLEGYMEALYHLEQFDDLEKCVERLPEKSPLLPKLAEMLASVGMCSEAVQAHLRFGDQKAAVATCVNLRQWGEAVELAQRFQLPQVQTLIAKHAAQLLQEGRLKEAIEMQRNAGRHLDAARLLSQMAEREQEKRAPLLRIKKLYVLAALLAEEH-----LKAVATTE----IDYASGRNTLL--DSIALEDAAAIERLWHCAEAYHFMLLAQRQLRFGIVHSAVVTAVRLRDYEDVLPPEHIYSLLALASCADRAFGTCSKAFMKLEQQAHLPEATLQRYEELAAGIFAKYDPEDTTGDRVDCYSCGVPVPDSSPSCPECNARFPACISSGKPITQPTNNIWICTTCHHCAAPTEISRHRTCPLCHS 1196          
BLAST of WD repeat-containing protein 35 vs. Ensembl Fly
Match: Oseg4 (gene:FBgn0035264 transcript:FBtr0334077)

HSP 1 Score: 811.987 bits (2096), Expect = 0.000e+0
Identity = 477/1219 (39.13%), Postives = 708/1219 (58.08%), Query Frame = 2
Query:  131 MFVYLSKKISIPNDVQLTTLSWNTNKGYIACXXXXXXXXXXXXDPQV-NGNTRG-IAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTIPDK-LSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCT-----TDENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGL---AVGQVTNKDFNLIQFYNPFGYHLRTLKVISTKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIY---AFTKPEQCHYCVIFWNSK--------------LDSFQTKYFYNLKAIISNG---ILCTIIYQADADSKQKYTLLVCNSIGTPIDTKELPFEPLYQVMTESHVIVASQNIIYAWQFKKPENLLSIESQTKRKSTMDNFIHVDD----ISIQKD-GPSSTENNLHSLMKKLSNDPICAICSARRTLIVATESGKMKQYSMPLMEYETTHKLRSKPFKLEINCTGNRVASIDFGGILSFFDLDKKYTDENGASGQGQIVENFEYKDVWDMKFSEDNSQLFVMMEKTKLRIIQDVESEEPVVFSGYICQFKELEVKAVLLDEIMNDLDKPNKNNVVTLEAKILRDCRKLLEEGQIEKAKEFIEDRPHNKMWKMLAEHALEKLDLETADQAFVRYTYYPGVKFVXXXXXXXXXXXXXAEISIYFGRYEEAEHRFMAIDRPDLVIAMLKSIGDWSRVLQLMKSGNSA-SDAEMNEAWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLERXXXXXXXXXXXXXXIAEIFVNAGMCEQAVFTYVKSDQLKSAIDCCIQLNHWQTAIDLAKNRDMTNINEMLTRYAKQLLDNKCYVQAVELYRRAGCFLEAAKIVQKLTEQEAKTSKNYSKLKKMSVLIGLLIEQHHDQNKIQAKARLKDIKGQDAASALNGMLHEEFHGVTESRLLDRPWHWAEAYHFYLLAQRQLFQKFFDAAMRTAKLLVDYEDVIAPRDIYSLIAICAIHNRAFGTSSKAFTKLETLNSFSEKEKENLISLTFKIFTKYSPIDPPRAR---------EYDELENTFDGDSKIPICIVSGQPITQ--GQFWMCPICKHSAHEDEMNKHQNCPLCHS 3643
            MFVYLSKKI+IPN+V+L  ++WN  +GYIA  G +GLLKVLKLD    NG ++G +AA +NL+MN+TL+ HK ++  +TWN+   K+TS+D  GVI+VW+L+K SW++EM N+     V  + W  DG +ICI YEDG+II+GSVDGNRI+GK +    L+ V+WSPD+RL++F L +G+ H+YD  GN    L   C      +     +I  I W+ G +    +  P LA+CY +G  QIMRNEND+ P + +T +      WN +GTVLAI G    AV   + +D N + FY+P G   RTLKV  T + S SW+ +SLR+A+AVDS IYFANIRP Y W Y   T+++        E     + FWN+               L S        ++ + SN     L T+  +++    + Y LL+CNSIGT +D+K     P +  +  S+V +ASQ  I  W +  P++  ++ +   RK   +   H+DD    + + KD   SS+  + HS  + +S DPICA+  + + L+VA ESG + +YS+  +     H + +K +K+ INC   R A ID  G+++  DLD     +   S         E KDVW + ++ DN  L  +MEKT++ I +  + EEPV  SGYIC F++LE+ +VLLD+I++  +  N ++++ L  K LRD   LLE   +E AK+FIED PH ++W++LAE AL+KL+LETA+ AFVR  +YPG+K VK+L+ + +  L+ AEIS ++G +EEAE  ++  DR DL I +  ++ DW RV+QL + G S  SD +M  AW  IG  + +  +W  A  Y+ +    E  +E  Y+LE +  LE+  E LPE SPLL ++AE+  + GMC +AV  +++    K+A+  C+ L  W  A++LA+   +  +  ++ ++A QLL      +A+E+ R AG  L+AA+++ ++ E+E +      ++KK+ VL  LL E+H     ++A A  +     D AS  N +L  +   + ++  ++R WH AEAYHF LLAQRQL      +A+ TA  L DYEDV+ P  IYSL+A+ +  +RAFGT SKAF KLE      E   +    L   IF KY P D    R           D   +  + +++ P CI SG+PITQ     W+C  C H A   E+++H+ CPLCHS
Sbjct:    1 MFVYLSKKIAIPNNVKLNCIAWNKEEGYIAVAGTDGLLKVLKLDQATPNGQSKGGLAAVSNLSMNQTLDGHKESVRVVTWNDAQQKLTSSDTDGVIMVWMLYKGSWYEEMTNDRKKSTVASMSWTSDGSRICIVYEDGAIIVGSVDGNRIFGKELKGTHLTGVQWSPDNRLILFALANGECHLYDNQGNFAMKLHIQCVNISGGSSSRGHRIASICWFSG-RVVQSRKRPVLAICYENGRVQIMRNENDDAPAIFDTGMRNVDAKWNHDGTVLAICGTTLDAVSPTSQRDTNQVCFYSPLGKIYRTLKVPGTDITSLSWEGKSLRIAMAVDSFIYFANIRPDYIWCYFEKTVVFLNSGSATRESPMSVITFWNTVSNQSFLKEVEPTLCLASSSEHCVLGVECVSSNIKEIALSTLENRSNPADDRVYQLLLCNSIGTTVDSKYTDIRPCFVGINSSYVAIASQEEILIWHYHTPKSASTLHNVKARK---EKRFHIDDTPTGVEMAKDLMLSSSSGDGHSTQRGIS-DPICALALSEKLLLVARESGAINEYSIANVALRNRHLMNAKVYKMAINCNSTRAAIIDHMGVMTLLDLDDNRETQLNFS-------RVERKDVWAVSWATDNPLLLALMEKTRMYIFRGNDPEEPVSCSGYICTFEDLEITSVLLDDIISVGELQNFSHIIQLRVKSLRDTDDLLEHVGLEDAKQFIEDNPHPRLWRLLAESALKKLELETAENAFVRCAHYPGIKLVKRLRTIHSKELQRAEISAFYGEFEEAEKLYLDADRRDLAIELRMTLCDWFRVVQLYRMGGSGVSDQQMEIAWREIGHHFANLRSWESAREYYEKSHYLEGYMEALYHLEQFDDLEKCVERLPEKSPLLPKLAEMLASVGMCSEAVQAHLRFGDQKAAVATCVNLRQWGEAVELAQRFQLPQVQTLIAKHAAQLLQEGRLKEAIEMQRNAGRHLDAARLLSQMAEREQEKRAPLLRIKKLYVLAALLAEEH-----LKAVATTE----IDYASGRNTLL--DSIALEDAAAIERLWHCAEAYHFMLLAQRQLRFGIVHSAVVTAVRLRDYEDVLPPEHIYSLLALASCADRAFGTCSKAFMKLEQQAHLPEATLQRYEELAAGIFAKYDPEDTTGDRVDCYSCGVPVPDSSPSCPECNARFPACISSGKPITQPTNNIWICTTCHHCAAPTEISRHRTCPLCHS 1196          
BLAST of WD repeat-containing protein 35 vs. Ensembl Fly
Match: Tusp (gene:FBgn0039530 transcript:FBtr0335246)

HSP 1 Score: 114.39 bits (285), Expect = 4.250e-25
Identity = 86/321 (26.79%), Postives = 141/321 (43.93%), Query Frame = 2
Query:  269 VNGNTRGIAAPT------------NLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGK--TIPDKLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTDENPIKIVGIEW----YKGDKGY--------MCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAK---CLAWNGNGTVLAIGG---LAVGQVTNKDF-------NLIQFYNPFGYHLRTLKVI--STKLHSCSWDNESLRLAIAVDSSIYFA 1108
              GN RGI   T             L  N  L  H+S +  + WNE + K+ S D SG+I VWI ++  W  E+IN+ N+  V    W+ DG    I Y+DG +++GSV G R W     +   ++   W+PD + + FG   GQ+ + D  G  +  ++       N + I  + W    +K ++G           K    LAV + +G   ++++ +D  P  INT L       + W+ +  +LA+ G     V     +D        NL++FY   G  L    +   S  + + +W +   RL IA  + ++ A
Sbjct:   50 ATGNVRGIVGVTFTTSHCRKNMDYPLRTNYNLRGHRSDVILVKWNEPYQKLASCDSSGIIFVWIKYEGRWSIELINDRNTP-VTHFSWSHDGRMALICYQDGFVLVGSVAGQRYWSSMLNLESTITCGIWTPDDQQVYFGTTQGQVIVMDVHGAMVSQVQL-----SNDVPITSMAWSCEKFKMEEGEEAEPGVTNAAKRSFVLAVSFQNGYIYLLKSFDDVSPAHINTCLNGALGMVMEWSNSRELLAVAGTLRTGVDGTKTEDMGTPSCYTNLVKFYTETGTCLYQAHIPCSSATVSAITWGHNDKRLFIATGTQVHIA 364          
BLAST of WD repeat-containing protein 35 vs. Ensembl Fly
Match: Tusp (gene:FBgn0039530 transcript:FBtr0335245)

HSP 1 Score: 114.39 bits (285), Expect = 4.365e-25
Identity = 86/321 (26.79%), Postives = 141/321 (43.93%), Query Frame = 2
Query:  269 VNGNTRGIAAPT------------NLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGK--TIPDKLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTDENPIKIVGIEW----YKGDKGY--------MCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAK---CLAWNGNGTVLAIGG---LAVGQVTNKDF-------NLIQFYNPFGYHLRTLKVI--STKLHSCSWDNESLRLAIAVDSSIYFA 1108
              GN RGI   T             L  N  L  H+S +  + WNE + K+ S D SG+I VWI ++  W  E+IN+ N+  V    W+ DG    I Y+DG +++GSV G R W     +   ++   W+PD + + FG   GQ+ + D  G  +  ++       N + I  + W    +K ++G           K    LAV + +G   ++++ +D  P  INT L       + W+ +  +LA+ G     V     +D        NL++FY   G  L    +   S  + + +W +   RL IA  + ++ A
Sbjct:   50 ATGNVRGIVGVTFTTSHCRKNMDYPLRTNYNLRGHRSDVILVKWNEPYQKLASCDSSGIIFVWIKYEGRWSIELINDRNTP-VTHFSWSHDGRMALICYQDGFVLVGSVAGQRYWSSMLNLESTITCGIWTPDDQQVYFGTTQGQVIVMDVHGAMVSQVQL-----SNDVPITSMAWSCEKFKMEEGEEAEPGVTNAAKRSFVLAVSFQNGYIYLLKSFDDVSPAHINTCLNGALGMVMEWSNSRELLAVAGTLRTGVDGTKTEDMGTPSCYTNLVKFYTETGTCLYQAHIPCSSATVSAITWGHNDKRLFIATGTQVHIA 364          
BLAST of WD repeat-containing protein 35 vs. Ensembl Fly
Match: Tusp (gene:FBgn0039530 transcript:FBtr0302589)

HSP 1 Score: 114.39 bits (285), Expect = 4.513e-25
Identity = 86/321 (26.79%), Postives = 141/321 (43.93%), Query Frame = 2
Query:  269 VNGNTRGIAAPT------------NLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGK--TIPDKLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTDENPIKIVGIEW----YKGDKGY--------MCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAK---CLAWNGNGTVLAIGG---LAVGQVTNKDF-------NLIQFYNPFGYHLRTLKVI--STKLHSCSWDNESLRLAIAVDSSIYFA 1108
              GN RGI   T             L  N  L  H+S +  + WNE + K+ S D SG+I VWI ++  W  E+IN+ N+  V    W+ DG    I Y+DG +++GSV G R W     +   ++   W+PD + + FG   GQ+ + D  G  +  ++       N + I  + W    +K ++G           K    LAV + +G   ++++ +D  P  INT L       + W+ +  +LA+ G     V     +D        NL++FY   G  L    +   S  + + +W +   RL IA  + ++ A
Sbjct:   50 ATGNVRGIVGVTFTTSHCRKNMDYPLRTNYNLRGHRSDVILVKWNEPYQKLASCDSSGIIFVWIKYEGRWSIELINDRNTP-VTHFSWSHDGRMALICYQDGFVLVGSVAGQRYWSSMLNLESTITCGIWTPDDQQVYFGTTQGQVIVMDVHGAMVSQVQL-----SNDVPITSMAWSCEKFKMEEGEEAEPGVTNAAKRSFVLAVSFQNGYIYLLKSFDDVSPAHINTCLNGALGMVMEWSNSRELLAVAGTLRTGVDGTKTEDMGTPSCYTNLVKFYTETGTCLYQAHIPCSSATVSAITWGHNDKRLFIATGTQVHIA 364          
BLAST of WD repeat-containing protein 35 vs. Ensembl Zebrafish
Match: wdr35 (WD repeat domain 35 [Source:ZFIN;Acc:ZDB-GENE-060810-148])

HSP 1 Score: 1082.01 bits (2797), Expect = 0.000e+0
Identity = 563/1212 (46.45%), Postives = 800/1212 (66.01%), Query Frame = 2
Query:  131 MFVYLSKKISIPNDVQLTTLSWNTNKGYIACXXXXXXXXXXXXDPQVN-GNTRGIAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTIPD-KLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTD-ENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRL-EAKCLAWNGNGTVLAIGGLAVGQVTNKDFNLIQFYNPFGYHLRTLKVISTKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIYAFTKPEQCHYCVIFWNSKLDSFQTKYFYNLKAIISNGILCTIIYQAD-----------------------------ADSKQKYTLLVCNSIGTPIDTKELPFEPLYQVMTESHVIVASQNIIYAWQFKKPENL--LSIESQTK-RKSTMDNFIHVDDISIQKDGPSSTENNLHSLMKKLS--NDPICAICSARRTLIVATESGKMKQYSMPLMEYETTHKLRSKPFKLEINCTGNRVASIDFGGILSFFDLDKKYT--DENGASGQGQIVENFEYKDVWDMKFSEDNSQLFVMMEKTKLRIIQDVESEEPVVFSGYICQFKELEVKAVLLDEIMNDLDKPNKNNVVTLEAKILRDCRKLLEEGQIEKAKEFIEDRPHNKMWKMLAEHALEKLDLETADQAFVRYTYYPGVKFVXXXXXXXXXXXXXAEISIYFGRYEEAEHRFMAIDRPDLVIAMLKSIGDWSRVLQLMKSGNSAS-DAEMNEAWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLERXXXXXXXXXXXXXXIAEIFVNAGMCEQAVFTYVKSDQLKSAIDCCIQLNHWQTAIDLAKNRDMTNINEMLTRYAKQLLDNKCYVQAVELYRRAGCFLEAAKIVQKLTEQEAKTSKNYSKLKKMSVLIGLLIEQHHDQNKIQAKARLKDIKGQDAASALNGMLHEEFHGVTESRLLDRPWHWAEAYHFYLLAQRQLFQKFFDAAMRTAKLLVDYEDVIAPRDIYSLIAICAIHNRAFGTSSKAFTKLETLNSFSEKEKENLISLTFKIFTKYSPIDPPRAREYDELENTFDGDSKIPICIVSGQPITQGQFWMCPICKHSAHEDEMNKHQNCPLCHS 3643
            MF+YLSKKI+IPN+  L  +SWN ++G+IACGG +GLLKVLKL+   +    +G+AAP+NL+MN+TLE H   +  +TWNE++ K+T++D++G+IIVW+L+K SW++EMINN N   V  + WN DG KICI YEDG++I+GSVDGNRIWGK +   +L+HV WSPDS++L+FG+ +G+IHIYD  GN I  +   C  +    + I GI WY G +GY+   CPCLAVC+++G CQ+MR+E+D+ PV+I T +     + WN  G+VLAI G        K+ N++ FY PFG HLRTLKV   ++ + SW+   LR+ +AVDS IYFANIRP YKW YC++T++YA+T+P++  Y V+FW++K +    KY  +L +I + G  C +  +AD                                ++KY L++CNSIGTP D+K +  +PL+  MT++HVI AS+   Y WQ++  + L  L I   TK RK   +   H+DD       PS T +   +  K  +   DPIC I ++ + L+V  ESG +++YS+P +     + L S+P++L +NC  +R+A ID  G+L+F D++ + +  D  G S  G     FE KDVWDMK++ DN  LF MMEKT++ + ++++ EEP+  SG+IC F++LE+K+VLLDEIM D D PNK+ ++  E + LRD R L+E+  IE A +FIED PH ++W++LAE AL+KLDL+ A+QAFVR   Y G++FVK+L  LQ+  +K AE++ YF R+EEAE  ++ +DR DL I++   +GDW RVLQL+K+G+  S DA + +A+NAIG  + D+  W  AV Y+ QGR  E L ECYY LEDY GLERLA  LPEN  LL +I ++FV  GMCEQAV  ++K +Q K+A+D C+ LN W  A++LAKN  M  I  +L++YA  LL+    ++AVELYR+A  FL+AAK++ K+ E+EAK      ++KK+ VL  LL+E  H Q K   +++ K  K  +A SAL G+L EE    ++SR+LD  W  AEAYHF+LLAQRQL+    DAAMRTA  L DYED+I   +IYSL+AIC+  N AFGT S+AF KLE+L + +  +++    L  +IFTK+SP D  R  + D L    +G  K+P CIV+G+ I++ QFWMC +CKH A E E+ +   CPLCHS
Sbjct:    1 MFIYLSKKIAIPNNTVLKCVSWNKDQGFIACGGEDGLLKVLKLETYTDDAKLKGLAAPSNLSMNQTLEGHSGAVQVVTWNEQYQKLTTSDQNGLIIVWMLYKGSWYEEMINNRNKSVVRSMSWNADGLKICIVYEDGAVIVGSVDGNRIWGKELKGTQLAHVAWSPDSKILLFGMANGEIHIYDNQGNFIMKMSMSCLANVTGALSIAGIHWYPGTEGYLEPECPCLAVCFTNGHCQVMRHESDDSPVIIETGMWNVASIQWNHCGSVLAIAGSLRNSGAEKEMNVVHFYTPFGEHLRTLKVPGKQMTAVSWEGGGLRIGLAVDSYIYFANIRPDYKWGYCSNTVVYAYTRPDRLEYSVVFWDTKNNERFVKYVKSLMSITTCGDFCILATKADDTHPQEDTEAEAGSAMAFNELSNQNTSKDRSKRRKYVLVLCNSIGTPQDSKYIDIDPLFVTMTKTHVIAASREAFYIWQYRVAKKLTALEINQVTKTRKEGRERVYHIDD------SPSGTSDGTLNFAKAFTATRDPICCITASDKMLLVGRESGILQRYSLPNISLLQKYSLTSRPYQLSLNCNSSRLAIIDITGVLTFLDVETRGSMGDAEGGSTAGD-PSKFERKDVWDMKWANDNPDLFSMMEKTRMYVFRNLDPEEPIQTSGFICHFEDLEIKSVLLDEIMRDPDVPNKDYLMNFEIRSLRDSRALIEKVGIEDASQFIEDNPHPRLWRLLAEAALQKLDLKMAEQAFVRCRDYQGIEFVKRLSNLQSEAMKQAEVAAYFSRFEEAERMYLDMDRRDLAISLRIKLGDWFRVLQLLKTGSGDSDDALLEQAYNAIGDYFADRQKWLNAVQYYLQGRNQERLAECYYMLEDYDGLERLANSLPENHKLLPDIGQMFVTVGMCEQAVSAFLKCNQPKAAVDACVHLNQWNKAVELAKNHSMKEIGPLLSKYASHLLEKNKTLEAVELYRKAHHFLDAAKLMYKIAEEEAKKRTRPLRVKKLYVLAALLVEDFHTQIKSSQQSKTKG-KKSEATSALAGLL-EEDESSSDSRILDDAWRGAEAYHFFLLAQRQLYDGKVDAAMRTALHLRDYEDIIPAVEIYSLLAICSSANGAFGTCSRAFIKLESLETLTPDQRQLYEDLALEIFTKHSPRD-TRQSQRDSLTEGPEG--KLPTCIVTGRVISEYQFWMCSVCKHCALEQEITQQNFCPLCHS 1200          
BLAST of WD repeat-containing protein 35 vs. Ensembl Zebrafish
Match: wdr35 (WD repeat domain 35 [Source:ZFIN;Acc:ZDB-GENE-060810-148])

HSP 1 Score: 191.815 bits (486), Expect = 4.211e-55
Identity = 101/198 (51.01%), Postives = 138/198 (69.70%), Query Frame = 2
Query: 2354 RYEEAEHRFMAIDRPDLVIAMLKSIGDWSRVLQLMKSGNSASD-AEMNEAWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLERXXXXXXXXXXXXXXIAEIFVNAGMCEQAVFTYVKSDQLKSAIDCCIQLNHWQTAIDLAKNRDMTNINEMLTRYAKQLLDNKCYVQAVELYRRAGCFLEAAKIV 2944
            R+EEAE  ++ +DR DL I++   +GDW RVLQL+K+G+  SD A + +A+NAIG  + D+  W  AV Y+ QGR  E L ECYY LEDY GLERLA  LPEN  LL +I ++FV  GMCEQAV  ++K +Q K+A+D C+ LN W  A++LAKN  M  I  +L++YA  LL+    ++AVELYR+A  FL+AAK++
Sbjct:    2 RFEEAERMYLDMDRRDLAISLRIKLGDWFRVLQLLKTGSGDSDDALLEQAYNAIGDYFADRQKWLNAVQYYLQGRNQERLAECYYMLEDYDGLERLANSLPENHKLLPDIGQMFVTVGMCEQAVSAFLKCNQPKAAVDACVHLNQWNKAVELAKNHSMKEIGPLLSKYASHLLEKNKTLEAVELYRKAHHFLDAAKLI 199          
BLAST of WD repeat-containing protein 35 vs. Ensembl Zebrafish
Match: tulp4a (TUB like protein 4a [Source:ZFIN;Acc:ZDB-GENE-060503-215])

HSP 1 Score: 124.79 bits (312), Expect = 4.181e-28
Identity = 87/334 (26.05%), Postives = 151/334 (45.21%), Query Frame = 2
Query:  302 TNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTI--PDKLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLK------------NYCTTDENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGG---LAVGQVTNKDFN-LIQFYNPFGYHLRTLKVISTK-LHSCSWDNESLRLAIAVDSSIYFANI--RPSYKWAYCNDTIIYAFTKPEQCHYCVIFWNSKLDSFQTKYF 1240
            T   +N  L  H S +  + WNE F K+ + D  G I VWI ++  W  E++N+  +  V+   W+ DG +  I+Y DG +++GSV G R W   I    +++   W+PD + ++FG  DGQ+ + D  G  +  +             NY +           +        +    P L VC++SG   +M N +D  P+LI T L+   + W+  G +LA+ G   L     T    N +++FYN  G H+ +L+  + + + +  W +   R+ +A   ++Y   +  R S     C   I  A    E+     +   S+L ++ +  F
Sbjct:   70 TPQRINFNLRGHNSEVVLVRWNEPFQKLATCDTDGGIFVWIQYEGRWSVELVNDRGAQ-VSDFTWSHDGTQALISYRDGFVLVGSVSGQRHWSSEINLESQITCGIWTPDDQQVLFGTADGQVIVMDCHGRMLAHILLHEAEGIASMAWNYPSFLVEDSSESDSDSDDSTPPQVHTLKPLLTVCFTSGDISLMSNYDDLSPLLIRTGLKDVVVQWSSQGDLLAVAGMERLVTSDPTQATRNAIVKFYNVRGEHIYSLETPAQRPISTLCWGHRDSRVFLACGPALYVLRVEHRVSSLQLLCQQAIASAVH--EEKDLAKLSMPSRLSTYVSSAF 400          
BLAST of WD repeat-containing protein 35 vs. Ensembl Zebrafish
Match: tulp4a (TUB like protein 4a [Source:ZFIN;Acc:ZDB-GENE-060503-215])

HSP 1 Score: 123.25 bits (308), Expect = 1.101e-27
Identity = 82/307 (26.71%), Postives = 142/307 (46.25%), Query Frame = 2
Query:  275 GNTRGIAAPTNLT------------MNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTI--PDKLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLK------------NYCTTDENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGG---LAVGQVTNKDFN-LIQFYNPFGYHLRTLKVISTK-LHSCSWDNESLRLAIAVDSSIY 1102
            GN RG+   T  +            +N  L  H S +  + WNE F K+ + D  G I VWI ++  W  E++N+  + +V+   W+ DG +  I+Y DG +++GSV G R W   I    +++   W+PD + ++FG  DGQ+ + D  G  +  +             NY +           +        +    P L VC++SG   +M N +D  P+LI T L+   + W+  G +LA+ G   L     T    N +++FYN  G H+ +L+  + + + +  W +   R+ +A   ++Y
Sbjct:   49 GNGRGVVGVTFTSSHCRRDRNTPQRINFNLRGHNSEVVLVRWNEPFQKLATCDTDGGIFVWIQYEGRWSVELVNDRGA-QVSDFTWSHDGTQALISYRDGFVLVGSVSGQRHWSSEINLESQITCGIWTPDDQQVLFGTADGQVIVMDCHGRMLAHILLHEAEGIASMAWNYPSFLVEDSSESDSDSDDSTPPQVHTLKPLLTVCFTSGDISLMSNYDDLSPLLIRTGLKDVVVQWSSQGDLLAVAGMERLVTSDPTQATRNAIVKFYNVRGEHIYSLETPAQRPISTLCWGHRDSRVFLACGPALY 354          
BLAST of WD repeat-containing protein 35 vs. Ensembl Zebrafish
Match: tulp4b (TUB like protein 4b [Source:ZFIN;Acc:ZDB-GENE-130530-708])

HSP 1 Score: 119.398 bits (298), Expect = 1.718e-26
Identity = 82/315 (26.03%), Postives = 143/315 (45.40%), Query Frame = 2
Query:  275 GNTRGIAAPTNLT------------MNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTI--PDKLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTDENPIKIVGIEW----------YKGDK-------GYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGLAVGQVTNKDF---NLIQFYNPFGYHLRTLKVISTK-LHSCSWDNESLRLAIAVDSSIYFANI 1114
            GN RG+   T  +            +N  L  H S +  + WNE F K+ + D  G I VWI ++  W  E++N+  + +V+   W+ DG +  IAY DG +++GSV G R W   I    +++   W+PD + ++FG  DGQ+ + D  G  +  +  + +       IV + W           + D         ++    P L V + SG   +M N +D  P +I + L+   + W   G +LA+ G+    +         L++FYN  G H+ TL+  + + + +  W +   RL +A   ++Y   +
Sbjct:   62 GNARGVVGVTFTSSHCRRDRNTPQRINFNLRGHNSEVVLVRWNEPFQKLATCDMEGGIFVWIQYEGRWSVELVNDRGA-QVSDFTWSHDGTQALIAYRDGFVLVGSVSGQRHWSSEINLESQITCGIWTPDDQQVLFGTADGQVIVMDCHGRMLAHVLLHESDG-----IVSMSWNCPNFLVEDSTESDTDSDDQTPAHVQNLKPLLTVSFISGDISLMNNYDDLSPNIIRSGLKDVEVQWCSQGDLLAVAGMERHGLPTDSLMRNALVKFYNVQGEHIYTLETPAQRPITTICWGHRDSRLFLACGPALYVVRV 370          
BLAST of WD repeat-containing protein 35 vs. Ensembl Xenopus
Match: WDR35 (WD repeat domain 35 [Source:NCBI gene;Acc:100496375])

HSP 1 Score: 1114.75 bits (2882), Expect = 0.000e+0
Identity = 568/1192 (47.65%), Postives = 809/1192 (67.87%), Query Frame = 2
Query:  131 MFVYLSKKISIPNDVQLTTLSWNTNKGYIACXXXXXXXXXXXXDPQV-NGNTRGIAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTIPD-KLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTD-ENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGLAVGQVTNKDFNLIQFYNPFGYHLRTLKVISTKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIYAFTKPEQCHYCVIFWNSKLDSFQTKYFYNLKAIISNGILCTIIYQADADSKQ----------KYTLLVCNSIGTPIDTKELPFEPLYQVMTESHVIVASQNIIYAWQFKKPENLLSIE----SQTKRKSTMDNFIHVDDISIQKDGPSSTENNLHSLMKKL--SNDPICAICSARRTLIVATESGKMKQYSMPLMEYETTHKLRSKPFKLEINCTGNRVASIDFGGILSFFDLDKKYTDENGASGQGQIVENFEYKDVWDMKFSEDNSQLFVMMEKTKLRIIQDVESEEPVVFSGYICQFKELEVKAVLLDEIMNDLDKPNKNNVVTLEAKILRDCRKLLEEGQIEKAKEFIEDRPHNKMWKMLAEHALEKLDLETADQAFVRYTYYPGVKFVXXXXXXXXXXXXXAEISIYFGRYEEAEHRFMAIDRPDLVIAMLKSIGDWSRVLQLMKSGNSAS-DAEMNEAWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLERXXXXXXXXXXXXXXIAEIFVNAGMCEQAVFTYVKSDQLKSAIDCCIQLNHWQTAIDLAKNRDMTNINEMLTRYAKQLLDNKCYVQAVELYRRAGCFLEAAKIVQKLTEQEAKTSKNYSKLKKMSVLIGLLIEQHHDQNKIQAKARLKDIKGQDAASALNGMLHEEFHGVTESRLLDRPWHWAEAYHFYLLAQRQLFQKFFDAAMRTAKLLVDYEDVIAPRDIYSLIAICAIHNRAFGTSSKAFTKLETLNSFSEKEKENLISLTFKIFTKYSPIDPPRAREYDELENTFD-GDSKIPICIVSGQPITQGQFWMCPICKHSAHEDEMNKHQNCPLCHS 3643
            MF+YLSKKI+IPN++ L  +SWN ++GYIACGG  GLLKVLKL+ Q  +   +G+AAP+NL+MN+TLE H  ++  +TWNE F K+T++D++G+IIVW+L+K SW++EMINN N   V  + WN DG+KICI YEDG++I+GSVDGNRIWGK +   +L HV WSPDS++L+FG+ +G+IH+YD  GN I  +   C  +    + I G+ WY G+KGY+  +CPCLA+C+ +G CQIMR+ENDE PVLI+T +    + WN  G+VLAI G       +KD N++QFY PFG HLRTLKV   ++ + SW+   LR+ +AVDS IYFANIRP YKW YC++T++YA T+P++  YCV+FW++K +    KY  +L ++ + G  C +  +AD   +Q           Y L++CNSIGTP+D+K +   P++  MT++HVI AS+   Y WQ++  + L ++E    S+T RK   +   H+DD       PS +   L    K +  + DPIC I ++ + LIV  ESG +++Y++P +     + L ++ +++ +NC  +R+A ID  G+L+FFDL+ +YTD  G    G+ ++  E KDVWDMK++ DN  LF MMEKT++ + ++++ EEP+  SGYIC F++LE+K+VLLDE++ D + PNK+ ++  E + LRD R L+E+  IE A +FIED PH ++W++LAE ALEKLDL TA+QAFVR   Y G++FVK+L  LQ+ ++K AEI+ YFGR+ EAE  ++ +DR DL I +   +GDW RVLQL+K G+  S DA + +A+NAIG  + D+  W  AV Y+ QGR  E L ECYY LEDY+GLE LA  LPEN  LL EIA +FV  GMCEQAV  ++K +  K+A+D C+ LN W  A++LAKN +M  I  +L +YA  LL+    + A+ELYR+A  FLEAAK++ K+ E EAK      ++KK+ VL  LL+E +H+  K   K +LK  K  +A SAL  +L EE   ++++R++D  W  AEAYHF+LLAQRQL++ + DAAMRTA  L DYED+I   +IYSL+A+CA  NRAFGT SKAF KLE+L + + ++K+    L  +IFTK+SP D  +     +LEN  + G+ K+P CI SG+ IT+ QFWMC +CKH   + E+  +  CPLCHS
Sbjct:    1 MFIYLSKKIAIPNNICLKCISWNKDQGYIACGGESGLLKVLKLEMQAEDAKLKGLAAPSNLSMNQTLEGHSGSVQVVTWNEHFQKLTTSDQNGLIIVWMLYKGSWYEEMINNRNKSVVRSMSWNADGQKICIVYEDGAVIVGSVDGNRIWGKELKGIQLCHVAWSPDSKILLFGMANGEIHLYDNQGNFIVKMVLSCLVNVSGALSIAGMHWYSGNKGYVEPDCPCLAICFDNGRCQIMRHENDENPVLIDTGMNVVSIQWNHCGSVLAIAGSQRAASQDKDINIVQFYTPFGEHLRTLKVPGKQISAVSWEGGGLRIGLAVDSYIYFANIRPDYKWGYCSNTVVYACTRPDRPEYCVVFWDTKNNEKYVKYVKSLMSVTTCGDFCILATKADESQQQDDRETDAIGATYVLVLCNSIGTPLDSKYIDIVPMFVTMTKTHVIAASKEAFYIWQYRVAKKLTAMEINQVSRT-RKEGRERIFHIDD------NPSGSVEGLMDYAKAVEATRDPICCITASDKVLIVGRESGTLRRYTLPSVSLVQQYMLGTRAYQMRLNCNASRLAIIDISGVLTFFDLEARYTDNTGQQMTGEQLK-LERKDVWDMKWASDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGYICNFEDLEIKSVLLDELIKDPEHPNKDYILNFEIRSLRDSRALIEKVGIEDASQFIEDNPHPRLWRLLAEAALEKLDLPTAEQAFVRCKDYQGIEFVKRLGNLQSESMKQAEIAAYFGRFVEAEKMYLDMDRRDLAIGLRIKLGDWFRVLQLLKHGSGDSDDALLEQAYNAIGDYFADRQKWVNAVQYYVQGRNQERLAECYYMLEDYNGLEVLANSLPENHKLLPEIARMFVTVGMCEQAVAAFLKCNLPKAAVDACVHLNQWNKAVELAKNHNMKEIGSLLAKYASHLLEKNKTLDAIELYRKANHFLEAAKLMFKIAEDEAKKRSKPLRVKKLYVLAALLVEHYHEHMKNTQKGKLKG-KRTEATSALASLL-EEDSMLSDNRIIDHAWRGAEAYHFFLLAQRQLYEGYLDAAMRTALHLRDYEDIIPAVEIYSLLALCACANRAFGTCSKAFIKLESLENLTAEQKQQYEDLALEIFTKHSPKDTRKP----DLENFPEGGEGKLPTCIASGRVITEYQFWMCNVCKHCVLDREITNYNFCPLCHS 1178          
BLAST of WD repeat-containing protein 35 vs. Ensembl Xenopus
Match: WDR35 (WD repeat domain 35 [Source:NCBI gene;Acc:100496375])

HSP 1 Score: 1107.82 bits (2864), Expect = 0.000e+0
Identity = 563/1175 (47.91%), Postives = 805/1175 (68.51%), Query Frame = 2
Query:  152 KISIPNDVQLTTLSWNTNKGYIACXXXXXXXXXXXXDPQV-NGNTRGIAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTIPD-KLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTD-ENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGLAVGQVTNKDFNLIQFYNPFGYHLRTLKVISTKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIYAFTKPEQCHYCVIFWNSKLDSFQTKYFYNLKAIISNGILCTIIYQADADSKQKYTLLVCNSIGTPIDTKELPFEPLYQVMTESHVIVASQNIIYAWQFKKPENLLSIE----SQTKRKSTMDNFIHVDDISIQKDGPSSTENNLHSLMKKL--SNDPICAICSARRTLIVATESGKMKQYSMPLMEYETTHKLRSKPFKLEINCTGNRVASIDFGGILSFFDLDKKYTDENGASGQGQIVENFEYKDVWDMKFSEDNSQLFVMMEKTKLRIIQDVESEEPVVFSGYICQFKELEVKAVLLDEIMNDLDKPNKNNVVTLEAKILRDCRKLLEEGQIEKAKEFIEDRPHNKMWKMLAEHALEKLDLETADQAFVRYTYYPGVKFVXXXXXXXXXXXXXAEISIYFGRYEEAEHRFMAIDRPDLVIAMLKSIGDWSRVLQLMKSGNSAS-DAEMNEAWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLERXXXXXXXXXXXXXXIAEIFVNAGMCEQAVFTYVKSDQLKSAIDCCIQLNHWQTAIDLAKNRDMTNINEMLTRYAKQLLDNKCYVQAVELYRRAGCFLEAAKIVQKLTEQEAKTSKNYSKLKKMSVLIGLLIEQHHDQNKIQAKARLKDIKGQDAASALNGMLHEEFHGVTESRLLDRPWHWAEAYHFYLLAQRQLFQKFFDAAMRTAKLLVDYEDVIAPRDIYSLIAICAIHNRAFGTSSKAFTKLETLNSFSEKEKENLISLTFKIFTKYSPIDPPRAREYDELENTFD-GDSKIPICIVSGQPITQGQFWMCPICKHSAHEDEMNKHQNCPLCHS 3643
            KI+IPN++ L  +SWN ++GYIACGG  GLLKVLKL+ Q  +   +G+AAP+NL+MN+TLE H  ++  +TWNE F K+T++D++G+IIVW+L+K SW++EMINN N   V  + WN DG+KICI YEDG++I+GSVDGNRIWGK +   +L HV WSPDS++L+FG+ +G+IH+YD  GN I  +   C  +    + I G+ WY G+KGY+  +CPCLA+C+ +G CQIMR+ENDE PVLI+T +    + WN  G+VLAI G       +KD N++QFY PFG HLRTLKV   ++ + SW+   LR+ +AVDS IYFANIRP YKW YC++T++YA T+P++  YCV+FW++K +    KY  +L ++ + G  C +  +AD +S+Q+Y L++CNSIGTP+D+K +   P++  MT++HVI AS+   Y WQ++  + L ++E    S+T RK   +   H+DD       PS +   L    K +  + DPIC I ++ + LIV  ESG +++Y++P +     + L ++ +++ +NC  +R+A ID  G+L+FFDL+ +YTD  G    G+ ++  E KDVWDMK++ DN  LF MMEKT++ + ++++ EEP+  SGYIC F++LE+K+VLLDE++ D + PNK+ ++  E + LRD R L+E+  IE A +FIED PH ++W++LAE ALEKLDL TA+QAFVR   Y G++FVK+L  LQ+ ++K AEI+ YFGR+ EAE  ++ +DR DL I +   +GDW RVLQL+K G+  S DA + +A+NAIG  + D+  W  AV Y+ QGR  E L ECYY LEDY+GLE LA  LPEN  LL EIA +FV  GMCEQAV  ++K +  K+A+D C+ LN W  A++LAKN +M  I  +L +YA  LL+    + A+ELYR+A  FLEAAK++ K+ E EAK      ++KK+ VL  LL+E +H+  K   K +LK  K  +A SAL  +L EE   ++++R++D  W  AEAYHF+LLAQRQL++ + DAAMRTA  L DYED+I   +IYSL+A+CA  NRAFGT SKAF KLE+L + + ++K+    L  +IFTK+SP D  +     +LEN  + G+ K+P CI SG+ IT+ QFWMC +CKH   + E+  +  CPLCHS
Sbjct:    5 KIAIPNNICLKCISWNKDQGYIACGGESGLLKVLKLEMQAEDAKLKGLAAPSNLSMNQTLEGHSGSVQVVTWNEHFQKLTTSDQNGLIIVWMLYKGSWYEEMINNRNKSVVRSMSWNADGQKICIVYEDGAVIVGSVDGNRIWGKELKGIQLCHVAWSPDSKILLFGMANGEIHLYDNQGNFIVKMVLSCLVNVSGALSIAGMHWYSGNKGYVEPDCPCLAICFDNGRCQIMRHENDENPVLIDTGMNVVSIQWNHCGSVLAIAGSQRAASQDKDINIVQFYTPFGEHLRTLKVPGKQISAVSWEGGGLRIGLAVDSYIYFANIRPDYKWGYCSNTVVYACTRPDRPEYCVVFWDTKNNEKYVKYVKSLMSVTTCGDFCILATKAD-ESQQQYVLVLCNSIGTPLDSKYIDIVPMFVTMTKTHVIAASKEAFYIWQYRVAKKLTAMEINQVSRT-RKEGRERIFHIDD------NPSGSVEGLMDYAKAVEATRDPICCITASDKVLIVGRESGTLRRYTLPSVSLVQQYMLGTRAYQMRLNCNASRLAIIDISGVLTFFDLEARYTDNTGQQMTGEQLK-LERKDVWDMKWASDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGYICNFEDLEIKSVLLDELIKDPEHPNKDYILNFEIRSLRDSRALIEKVGIEDASQFIEDNPHPRLWRLLAEAALEKLDLPTAEQAFVRCKDYQGIEFVKRLGNLQSESMKQAEIAAYFGRFVEAEKMYLDMDRRDLAIGLRIKLGDWFRVLQLLKHGSGDSDDALLEQAYNAIGDYFADRQKWVNAVQYYVQGRNQERLAECYYMLEDYNGLEVLANSLPENHKLLPEIARMFVTVGMCEQAVAAFLKCNLPKAAVDACVHLNQWNKAVELAKNHNMKEIGSLLAKYASHLLEKNKTLDAIELYRKANHFLEAAKLMFKIAEDEAKKRSKPLRVKKLYVLAALLVEHYHEHMKNTQKGKLKG-KRTEATSALASLL-EEDSMLSDNRIIDHAWRGAEAYHFFLLAQRQLYEGYLDAAMRTALHLRDYEDIIPAVEIYSLLALCACANRAFGTCSKAFIKLESLENLTAEQKQQYEDLALEIFTKHSPKDTRKP----DLENFPEGGEGKLPTCIASGRVITEYQFWMCNVCKHCVLDREITNYNFCPLCHS 1164          
BLAST of WD repeat-containing protein 35 vs. Ensembl Xenopus
Match: WDR35 (WD repeat domain 35 [Source:NCBI gene;Acc:100496375])

HSP 1 Score: 1068.14 bits (2761), Expect = 0.000e+0
Identity = 556/1175 (47.32%), Postives = 789/1175 (67.15%), Query Frame = 2
Query:  152 KISIPNDVQLTTLSWNTNKGYIACXXXXXXXXXXXXDPQV-NGNTRGIAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTIPD-KLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTD-ENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGLAVGQVTNKDFNLIQFYNPFGYHLRTLKVISTKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIYAFTKPEQCHYCVIFWNSKLDSFQTKYFYNLKAIISNGILCTIIYQADADSKQKYTLLVCNSIGTPIDTKELPFEPLYQVMTESHVIVASQNIIYAWQFKKPENLLSIE----SQTKRKSTMDNFIHVDDISIQKDGPSSTENNLHSLMKKL--SNDPICAICSARRTLIVATESGKMKQYSMPLMEYETTHKLRSKPFKLEINCTGNRVASIDFGGILSFFDLDKKYTDENGASGQGQIVENFEYKDVWDMKFSEDNSQLFVMMEKTKLRIIQDVESEEPVVFSGYICQFKELEVKAVLLDEIMNDLDKPNKNNVVTLEAKILRDCRKLLEEGQIEKAKEFIEDRPHNKMWKMLAEHALEKLDLETADQAFVRYTYYPGVKFVXXXXXXXXXXXXXAEISIYFGRYEEAEHRFMAIDRPDLVIAMLKSIGDWSRVLQLMKSGNSAS-DAEMNEAWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLERXXXXXXXXXXXXXXIAEIFVNAGMCEQAVFTYVKSDQLKSAIDCCIQLNHWQTAIDLAKNRDMTNINEMLTRYAKQLLDNKCYVQAVELYRRAGCFLEAAKIVQKLTEQEAKTSKNYSKLKKMSVLIGLLIEQHHDQNKIQAKARLKDIKGQDAASALNGMLHEEFHGVTESRLLDRPWHWAEAYHFYLLAQRQLFQKFFDAAMRTAKLLVDYEDVIAPRDIYSLIAICAIHNRAFGTSSKAFTKLETLNSFSEKEKENLISLTFKIFTKYSPIDPPRAREYDELENTFD-GDSKIPICIVSGQPITQGQFWMCPICKHSAHEDEMNKHQNCPLCHS 3643
            KI+IPN++ L  +SWN ++GYIACGG  GLLKVLKL+ Q  +   +G+AAP+NL+MN+TLE H  ++  +TWNE F K+T++D++G+IIVW+L+K SW++EMINN N   V  + WN DG+KICI YEDG++I+GSVDGNRIWGK +   +L HV WSPDS++L+FG+ +G+IH+YD  GN I  +   C  +    + I G+ WY G+KGY+  +CPCLA+C+ +G CQIMR+ENDE PVLI+T +    + WN  G+VLAI G       +KD N++QFY PFG HLRTLKV   ++ + SW+   LR+ +AVDS IYFANIRP YKW YC++T++YA T+P++  YCV+FW++K +    KY  +L ++ + G  C +  +AD +S+Q+Y L++CNSIGTP+D+K +   P++  MT++HVI AS+   Y WQ++  + L ++E    S+T RK   +   H+DD       PS +   L    K +  + DPIC I ++ + LIV                     ++  +P+        +R+A ID  G+L+FFDL+ +YTD  G    G+ ++  E KDVWDMK++ DN  LF MMEKT++ + ++++ EEP+  SGYIC F++LE+K+VLLDE++ D + PNK+ ++  E + LRD R L+E+  IE A +FIED PH ++W++LAE ALEKLDL TA+QAFVR   Y G++FVK+L  LQ+ ++K AEI+ YFGR+ EAE  ++ +DR DL I +   +GDW RVLQL+K G+  S DA + +A+NAIG  + D+  W  AV Y+ QGR  E L ECYY LEDY+GLE LA  LPEN  LL EIA +FV  GMCEQAV  ++K +  K+A+D C+ LN W  A++LAKN +M  I  +L +YA  LL+    + A+ELYR+A  FLEAAK++ K+ E EAK      ++KK+ VL  LL+E +H+  K   K +LK  K  +A SAL  +L EE   ++++R++D  W  AEAYHF+LLAQRQL++ + DAAMRTA  L DYED+I   +IYSL+A+CA  NRAFGT SKAF KLE+L + + ++K+    L  +IFTK+SP D  +     +LEN  + G+ K+P CI SG+ IT+ QFWMC +CKH   + E+  +  CPLCHS
Sbjct:    5 KIAIPNNICLKCISWNKDQGYIACGGESGLLKVLKLEMQAEDAKLKGLAAPSNLSMNQTLEGHSGSVQVVTWNEHFQKLTTSDQNGLIIVWMLYKGSWYEEMINNRNKSVVRSMSWNADGQKICIVYEDGAVIVGSVDGNRIWGKELKGIQLCHVAWSPDSKILLFGMANGEIHLYDNQGNFIVKMVLSCLVNVSGALSIAGMHWYSGNKGYVEPDCPCLAICFDNGRCQIMRHENDENPVLIDTGMNVVSIQWNHCGSVLAIAGSQRAASQDKDINIVQFYTPFGEHLRTLKVPGKQISAVSWEGGGLRIGLAVDSYIYFANIRPDYKWGYCSNTVVYACTRPDRPEYCVVFWDTKNNEKYVKYVKSLMSVTTCGDFCILATKAD-ESQQQYVLVLCNSIGTPLDSKYIDIVPMFVTMTKTHVIAASKEAFYIWQYRVAKKLTAMEINQVSRT-RKEGRERIFHIDD------NPSGSVEGLMDYAKAVEATRDPICCITASDKVLIVVN-----------------FMQIVFRPY--------HRLAIIDISGVLTFFDLEARYTDNTGQQMTGEQLK-LERKDVWDMKWASDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGYICNFEDLEIKSVLLDELIKDPEHPNKDYILNFEIRSLRDSRALIEKVGIEDASQFIEDNPHPRLWRLLAEAALEKLDLPTAEQAFVRCKDYQGIEFVKRLGNLQSESMKQAEIAAYFGRFVEAEKMYLDMDRRDLAIGLRIKLGDWFRVLQLLKHGSGDSDDALLEQAYNAIGDYFADRQKWVNAVQYYVQGRNQERLAECYYMLEDYNGLEVLANSLPENHKLLPEIARMFVTVGMCEQAVAAFLKCNLPKAAVDACVHLNQWNKAVELAKNHNMKEIGSLLAKYASHLLEKNKTLDAIELYRKANHFLEAAKLMFKIAEDEAKKRSKPLRVKKLYVLAALLVEHYHEHMKNTQKGKLKG-KRTEATSALASLL-EEDSMLSDNRIIDHAWRGAEAYHFFLLAQRQLYEGYLDAAMRTALHLRDYEDIIPAVEIYSLLALCACANRAFGTCSKAFIKLESLENLTAEQKQQYEDLALEIFTKHSPKDTRKP----DLENFPEGGEGKLPTCIASGRVITEYQFWMCNVCKHCVLDREITNYNFCPLCHS 1139          
BLAST of WD repeat-containing protein 35 vs. Ensembl Xenopus
Match: WDR35 (WD repeat domain 35 [Source:NCBI gene;Acc:100496375])

HSP 1 Score: 813.913 bits (2101), Expect = 0.000e+0
Identity = 400/837 (47.79%), Postives = 581/837 (69.41%), Query Frame = 2
Query:  152 KISIPNDVQLTTLSWNTNKGYIACXXXXXXXXXXXXDPQV-NGNTRGIAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTIPD-KLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTD-ENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGLAVGQVTNKDFNLIQFYNPFGYHLRTLKVISTKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIYAFTKPEQCHYCVIFWNSKLDSFQTKYFYNLKAIISNGILCTIIYQADADSKQKYTLLVCNSIGTPIDTKELPFEPLYQVMTESHVIVASQNIIYAWQFKKPENLLSIE----SQTKRKSTMDNFIHVDDISIQKDGPSSTENNLHSLMKKL--SNDPICAICSARRTLIVATESGKMKQYSMPLMEYETTHKLRSKPFKLEINCTGNRVASIDFGGILSFFDLDKKYTDENGASGQGQIVENFEYKDVWDMKFSEDNSQLFVMMEKTKLRIIQDVESEEPVVFSGYICQFKELEVKAVLLDEIMNDLDKPNKNNVVTLEAKILRDCRKLLEEGQIEKAKEFIEDRPHNKMWKMLAEHALEKLDLETADQAFVRYTYYPGVKFVXXXXXXXXXXXXXAEISIYFGRYEEAEHRFMAIDRPDLVIAMLKSIGDWSRVLQLMKSGNSAS-DAEMNEAWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLE 2632
            KI+IPN++ L  +SWN ++GYIACGG  GLLKVLKL+ Q  +   +G+AAP+NL+MN+TLE H  ++  +TWNE F K+T++D++G+IIVW+L+K SW++EMINN N   V  + WN DG+KICI YEDG++I+GSVDGNRIWGK +   +L HV WSPDS++L+FG+ +G+IH+YD  GN I  +   C  +    + I G+ WY G+KGY+  +CPCLA+C+ +G CQIMR+ENDE PVLI+T +    + WN  G+VLAI G       +KD N++QFY PFG HLRTLKV   ++ + SW+   LR+ +AVDS IYFANIRP YKW YC++T++YA T+P++  YCV+FW++K +    KY  +L ++ + G  C +  +AD +S+Q+Y L++CNSIGTP+D+K +   P++  MT++HVI AS+   Y WQ++  + L ++E    S+T RK   +   H+DD       PS +   L    K +  + DPIC I ++ + LIV  ESG +++Y++P +     + L ++ +++ +NC  +R+A ID  G+L+FFDL+ +YTD  G    G+ ++  E KDVWDMK++ DN  LF MMEKT++ + ++++ EEP+  SGYIC F++LE+K+VLLDE++ D + PNK+ ++  E + LRD R L+E+  IE A +FIED PH ++W++LAE ALEKLDL TA+QAFVR   Y G++FVK+L  LQ+ ++K AEI+ YFGR+ EAE  ++ +DR DL I +   +GDW RVLQL+K G+  S DA + +A+NAIG  + D+  W  AV Y+ QGR  E L ECYY LEDY+GLE
Sbjct:    5 KIAIPNNICLKCISWNKDQGYIACGGESGLLKVLKLEMQAEDAKLKGLAAPSNLSMNQTLEGHSGSVQVVTWNEHFQKLTTSDQNGLIIVWMLYKGSWYEEMINNRNKSVVRSMSWNADGQKICIVYEDGAVIVGSVDGNRIWGKELKGIQLCHVAWSPDSKILLFGMANGEIHLYDNQGNFIVKMVLSCLVNVSGALSIAGMHWYSGNKGYVEPDCPCLAICFDNGRCQIMRHENDENPVLIDTGMNVVSIQWNHCGSVLAIAGSQRAASQDKDINIVQFYTPFGEHLRTLKVPGKQISAVSWEGGGLRIGLAVDSYIYFANIRPDYKWGYCSNTVVYACTRPDRPEYCVVFWDTKNNEKYVKYVKSLMSVTTCGDFCILATKAD-ESQQQYVLVLCNSIGTPLDSKYIDIVPMFVTMTKTHVIAASKEAFYIWQYRVAKKLTAMEINQVSRT-RKEGRERIFHIDD------NPSGSVEGLMDYAKAVEATRDPICCITASDKVLIVGRESGTLRRYTLPSVSLVQQYMLGTRAYQMRLNCNASRLAIIDISGVLTFFDLEARYTDNTGQQMTGEQLK-LERKDVWDMKWASDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGYICNFEDLEIKSVLLDELIKDPEHPNKDYILNFEIRSLRDSRALIEKVGIEDASQFIEDNPHPRLWRLLAEAALEKLDLPTAEQAFVRCKDYQGIEFVKRLGNLQSESMKQAEIAAYFGRFVEAEKMYLDMDRRDLAIGLRIKLGDWFRVLQLLKHGSGDSDDALLEQAYNAIGDYFADRQKWVNAVQYYVQGRNQERLAECYYMLEDYNGLE 832          
BLAST of WD repeat-containing protein 35 vs. Ensembl Xenopus
Match: tulp4 (B-cell receptor CD22-like [Source:Xenbase;Acc:XB-GENE-5887253])

HSP 1 Score: 122.865 bits (307), Expect = 1.755e-27
Identity = 87/337 (25.82%), Postives = 152/337 (45.10%), Query Frame = 2
Query:  317 NETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTI--PDKLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTDENPIKIVGIEW----------------YKGDKGYMCKNC-PCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGLAVGQVTNKDFN-------LIQFYNPFGYHLRTLKV-ISTKLHSCSWDNESLRLAIAVDSSIYFANI--RPSYKWAYCNDTIIYAFTKPEQCHYCVIFWNSKLDSFQTKYF 1240
            N  L  H S +  + WNE F K+ + D  G I VWI ++  W  E++N+  + +V+   W+ DG +  I+Y DG +++GSV G R W   I    +++   W+PD + ++FG  DGQ+ + D  G  +  +  + +       IV + W                         +N  P L V ++SG  ++M N +D  P ++ + L+   + W   G +LA+ G+    +  +  N       LI+FYN  G H+ TL+  +   + S  W +   RL +A   ++Y   +  R +     C  TI  + +  +    C +    +L S+ T  F
Sbjct:   75 NFNLRGHNSEVVLVRWNEPFQKLATCDADGGIFVWIQYEGRWSVELVNDRGA-QVSDFTWSHDGTQALISYRDGFVLVGSVSGQRHWSSEINLESQITCGIWTPDDQQVLFGTADGQVIVMDCHGRMLAHVLLHESDG-----IVNMSWNYPSFLVEDSSESDTDSDDYSPPQVENIKPLLTVGFTSGDIRLMNNYDDLSPTIVRSGLKDVVVQWCTQGDLLAVAGMEKQNLIPEHVNGNSLKSALIKFYNVRGEHIYTLETPVQRPITSICWGHRDSRLFLASGPALYVVRVEHRVASLQLLCQQTIATSLS--DDKDICKLNLPPRLCSYLTTAF 403          
BLAST of WD repeat-containing protein 35 vs. Ensembl Mouse
Match: Wdr35 (WD repeat domain 35 [Source:MGI Symbol;Acc:MGI:1921932])

HSP 1 Score: 1100.5 bits (2845), Expect = 0.000e+0
Identity = 559/1180 (47.37%), Postives = 798/1180 (67.63%), Query Frame = 2
Query:  131 MFVYLSKKISIPNDVQLTTLSWNTNKGYIACXXXXXXXXXXXXDPQVN-GNTRGIAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTIPD-KLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTD-ENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGLAVGQVTNKDFNLIQFYNPFGYHLRTLKVISTKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIYAFTKPEQCHYCVIFWNSKLDSFQTKYFYNLKAIISNGILCTIIYQADADSKQKYTLLVCNSIGTPIDTKELPFEPLYQVMTESHVIVASQNIIYAWQFKKPENLLSIESQT---KRKSTMDNFIHVDDISIQKDGPSSTENNLHSLMKKL--SNDPICAICSARRTLIVATESGKMKQYSMPLMEYETTHKLRSKPFKLEINCTGNRVASIDFGGILSFFDLDKKYTDENGASGQGQIVENFEYKDVWDMKFSEDNSQLFVMMEKTKLRIIQDVESEEPVVFSGYICQFKELEVKAVLLDEIMNDLDKPNKNNVVTLEAKILRDCRKLLEEGQIEKAKEFIEDRPHNKMWKMLAEHALEKLDLETADQAFVRYTYYPGVKFVXXXXXXXXXXXXXAEISIYFGRYEEAEHRFMAIDRPDLVIAMLKSIGDWSRVLQLMKSGNS-ASDAEMNEAWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLERXXXXXXXXXXXXXXIAEIFVNAGMCEQAVFTYVKSDQLKSAIDCCIQLNHWQTAIDLAKNRDMTNINEMLTRYAKQLLDNKCYVQAVELYRRAGCFLEAAKIVQKLTEQEAKTSKNYSKLKKMSVLIGLLIEQHHDQNKIQAKARLKDIKGQDAASALNGMLHEEFHGVTESRLLDRPWHWAEAYHFYLLAQRQLFQKFFDAAMRTAKLLVDYEDVIAPRDIYSLIAICAIHNRAFGTSSKAFTKLETLNSFSEKEKENLISLTFKIFTKYSPIDPPRAREYDELENTFDGDSKIPICIVSGQPITQGQFWMCPICKHSAHEDEMNKHQNCPLCHS 3643
            MF YLSKKI++PN+V+L  +SWN ++G+IACGG +GLLKVL+L+ Q +    RG+AAP+NL+MN+ LE H   +  +TWNE++ K+T++D++G+IIVW+L+K SW++EMINN N   V  + WN DG+KICI YEDG++I+GSVDGNRIWGK +   +L HV WS DS++L+FG+ +G+IHIYD  GN I  +K  C  +    I I GI WY G +GY+  +CPCLA+C+ +G CQIMR+END+ PVLI+T +    + WN  G+VLA+ G       +KD N++QFY PFG HL TLKV   ++ S SW+   L++A+AVDS IYFANIRP YKW YC++T++YA+T+P++  YCV+FW++K      KY  +L +I + G  C +  +AD +  Q + L++CNSIGTP+D K +   PL+  MT++HVI AS+   Y WQ++  + L ++E       RK   +   HVDD+      PS + + +    K +  + DPICAI ++ +TLIV  ESG +++YS P +     + L  +  +L +NC  +R+A ID  G+L+FFDLD + TD  G    G++++  E KDVWDMK+++DN  LF MMEKT++ + ++++ EEP+  SGYIC F++LE+K+VLLDEI+ D + P+K+ ++  E + LRD R L+E+  IE A +FIED PH ++W++LAE AL+KLDL TA QAFVR   Y G+KFVK L  LQ+ ++K AE+  YFGR+E+AE  +  +DR DL I +   +GDW RVLQL+K+G+  A D+ + +A NAIG  + D+  W  AV Y+ +GR  E L ECYY LEDY GLE LA  LPEN  LL EIA++FV  GMCEQAV  ++K +Q K+A+D C+ LN W  A++LAK+  M  I  +L RYA  LL+    + A+ELYR+A  F +AAK++ K+ ++EAK      ++KK+ VL  LLIEQ+H+Q K   + ++K  K  +A SAL G+L EE    T SR  D  W  AEAYHF++LAQRQL++ + D A++TA  L DYED+I   +IYSL+A+CA  +RAFGT SKAF KLE+L + S ++K+    L  +IFTK++P D  ++     LE    G+ K+P CI +G PI + QFW+C +CKH     E++ +  CPLCHS
Sbjct:    1 MFFYLSKKIAVPNNVKLKCISWNKDQGFIACGGEDGLLKVLRLETQTDDSKLRGLAAPSNLSMNQNLEGHSGAVQVVTWNEQYQKLTTSDQNGLIIVWMLYKGSWYEEMINNRNKSVVRSMSWNADGQKICIVYEDGAVIVGSVDGNRIWGKDLKGIQLCHVTWSADSKILLFGMANGEIHIYDNQGNFIMKMKLNCLVNVTGAISIAGIHWYHGTEGYVEPDCPCLAICFDNGRCQIMRHENDQNPVLIDTGMYVVGIQWNHIGSVLAVAGSQKVVTQDKDINIVQFYTPFGEHLGTLKVPGKQMCSLSWEGGGLKIALAVDSFIYFANIRPDYKWGYCSNTVVYAYTRPDRPEYCVVFWDTKNSEKYVKYVKSLISITTCGDFCILATKADENHPQ-FVLVLCNSIGTPLDPKYIDLVPLFVAMTKTHVIAASKEAFYTWQYRVAKKLTALEINQITRSRKEGRERIYHVDDV------PSGSVDGVFDYSKAIQGTRDPICAITASDKTLIVGRESGVIQRYSFPNVALIQKYSLDCRACQLSLNCNSSRLAIIDIAGVLTFFDLDTRVTDSTGQQVVGELLK-LERKDVWDMKWAKDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGYICNFEDLEIKSVLLDEILKDPEHPSKDYIMNFEIRSLRDSRALIEKVGIEDASQFIEDNPHPRLWRLLAEAALQKLDLYTAQQAFVRCKDYQGIKFVKLLGNLQSESMKQAEVIAYFGRFEDAERMYQDMDRRDLAIGLRMKLGDWFRVLQLLKTGSGDADDSLLEQANNAIGEYFADRQKWQNAVQYYVKGRNQERLAECYYMLEDYEGLETLANSLPENHKLLPEIAQMFVRVGMCEQAVSAFLKCNQPKAAVDTCVHLNQWNKAVELAKSHSMKEIGSLLARYASHLLEKNKTLDAIELYRKASYFFDAAKLMYKIADEEAKKRTKPLRVKKLYVLSALLIEQYHEQMKNAQRGKVKG-KNSEATSALAGLLEEEVLSTT-SRFTDNAWRGAEAYHFFILAQRQLYEGYVDTALKTALHLRDYEDIIPSVEIYSLLALCACASRAFGTCSKAFIKLESLETLSAEQKQQYEDLALEIFTKHTPKDNRKSELNSLLEG---GEGKLPTCIATGSPIIEYQFWVCKVCKHYVLAQEISNYNFCPLCHS 1167          
BLAST of WD repeat-containing protein 35 vs. Ensembl Mouse
Match: Wdr35 (WD repeat domain 35 [Source:MGI Symbol;Acc:MGI:1921932])

HSP 1 Score: 1097.8 bits (2838), Expect = 0.000e+0
Identity = 559/1190 (46.97%), Postives = 799/1190 (67.14%), Query Frame = 2
Query:  131 MFVYLSKKISIPNDVQLTTLSWNTNKGYIACXXXXXXXXXXXXDPQVN-GNTRGIAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTIPD-KLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTD-ENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGLAVGQVTNKDFNLIQFYNPFGYHLRTLKVISTKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIYAFTKPEQCHYCVIFWNSKLDSFQTKYFYNLKAIISNGILCTIIYQADADSKQK----------YTLLVCNSIGTPIDTKELPFEPLYQVMTESHVIVASQNIIYAWQFKKPENLLSIESQT---KRKSTMDNFIHVDDISIQKDGPSSTENNLHSLMKKL--SNDPICAICSARRTLIVATESGKMKQYSMPLMEYETTHKLRSKPFKLEINCTGNRVASIDFGGILSFFDLDKKYTDENGASGQGQIVENFEYKDVWDMKFSEDNSQLFVMMEKTKLRIIQDVESEEPVVFSGYICQFKELEVKAVLLDEIMNDLDKPNKNNVVTLEAKILRDCRKLLEEGQIEKAKEFIEDRPHNKMWKMLAEHALEKLDLETADQAFVRYTYYPGVKFVXXXXXXXXXXXXXAEISIYFGRYEEAEHRFMAIDRPDLVIAMLKSIGDWSRVLQLMKSGNS-ASDAEMNEAWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLERXXXXXXXXXXXXXXIAEIFVNAGMCEQAVFTYVKSDQLKSAIDCCIQLNHWQTAIDLAKNRDMTNINEMLTRYAKQLLDNKCYVQAVELYRRAGCFLEAAKIVQKLTEQEAKTSKNYSKLKKMSVLIGLLIEQHHDQNKIQAKARLKDIKGQDAASALNGMLHEEFHGVTESRLLDRPWHWAEAYHFYLLAQRQLFQKFFDAAMRTAKLLVDYEDVIAPRDIYSLIAICAIHNRAFGTSSKAFTKLETLNSFSEKEKENLISLTFKIFTKYSPIDPPRAREYDELENTFDGDSKIPICIVSGQPITQGQFWMCPICKHSAHEDEMNKHQNCPLCHS 3643
            MF YLSKKI++PN+V+L  +SWN ++G+IACGG +GLLKVL+L+ Q +    RG+AAP+NL+MN+ LE H   +  +TWNE++ K+T++D++G+IIVW+L+K SW++EMINN N   V  + WN DG+KICI YEDG++I+GSVDGNRIWGK +   +L HV WS DS++L+FG+ +G+IHIYD  GN I  +K  C  +    I I GI WY G +GY+  +CPCLA+C+ +G CQIMR+END+ PVLI+T +    + WN  G+VLA+ G       +KD N++QFY PFG HL TLKV   ++ S SW+   L++A+AVDS IYFANIRP YKW YC++T++YA+T+P++  YCV+FW++K      KY  +L +I + G  C +  +AD +  Q+          + L++CNSIGTP+D K +   PL+  MT++HVI AS+   Y WQ++  + L ++E       RK   +   HVDD+      PS + + +    K +  + DPICAI ++ +TLIV  ESG +++YS P +     + L  +  +L +NC  +R+A ID  G+L+FFDLD + TD  G    G++++  E KDVWDMK+++DN  LF MMEKT++ + ++++ EEP+  SGYIC F++LE+K+VLLDEI+ D + P+K+ ++  E + LRD R L+E+  IE A +FIED PH ++W++LAE AL+KLDL TA QAFVR   Y G+KFVK L  LQ+ ++K AE+  YFGR+E+AE  +  +DR DL I +   +GDW RVLQL+K+G+  A D+ + +A NAIG  + D+  W  AV Y+ +GR  E L ECYY LEDY GLE LA  LPEN  LL EIA++FV  GMCEQAV  ++K +Q K+A+D C+ LN W  A++LAK+  M  I  +L RYA  LL+    + A+ELYR+A  F +AAK++ K+ ++EAK      ++KK+ VL  LLIEQ+H+Q K   + ++K  K  +A SAL G+L EE    T SR  D  W  AEAYHF++LAQRQL++ + D A++TA  L DYED+I   +IYSL+A+CA  +RAFGT SKAF KLE+L + S ++K+    L  +IFTK++P D  ++     LE    G+ K+P CI +G PI + QFW+C +CKH     E++ +  CPLCHS
Sbjct:    1 MFFYLSKKIAVPNNVKLKCISWNKDQGFIACGGEDGLLKVLRLETQTDDSKLRGLAAPSNLSMNQNLEGHSGAVQVVTWNEQYQKLTTSDQNGLIIVWMLYKGSWYEEMINNRNKSVVRSMSWNADGQKICIVYEDGAVIVGSVDGNRIWGKDLKGIQLCHVTWSADSKILLFGMANGEIHIYDNQGNFIMKMKLNCLVNVTGAISIAGIHWYHGTEGYVEPDCPCLAICFDNGRCQIMRHENDQNPVLIDTGMYVVGIQWNHIGSVLAVAGSQKVVTQDKDINIVQFYTPFGEHLGTLKVPGKQMCSLSWEGGGLKIALAVDSFIYFANIRPDYKWGYCSNTVVYAYTRPDRPEYCVVFWDTKNSEKYVKYVKSLISITTCGDFCILATKADENHPQEENEMETFGATFVLVLCNSIGTPLDPKYIDLVPLFVAMTKTHVIAASKEAFYTWQYRVAKKLTALEINQITRSRKEGRERIYHVDDV------PSGSVDGVFDYSKAIQGTRDPICAITASDKTLIVGRESGVIQRYSFPNVALIQKYSLDCRACQLSLNCNSSRLAIIDIAGVLTFFDLDTRVTDSTGQQVVGELLK-LERKDVWDMKWAKDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGYICNFEDLEIKSVLLDEILKDPEHPSKDYIMNFEIRSLRDSRALIEKVGIEDASQFIEDNPHPRLWRLLAEAALQKLDLYTAQQAFVRCKDYQGIKFVKLLGNLQSESMKQAEVIAYFGRFEDAERMYQDMDRRDLAIGLRMKLGDWFRVLQLLKTGSGDADDSLLEQANNAIGEYFADRQKWQNAVQYYVKGRNQERLAECYYMLEDYEGLETLANSLPENHKLLPEIAQMFVRVGMCEQAVSAFLKCNQPKAAVDTCVHLNQWNKAVELAKSHSMKEIGSLLARYASHLLEKNKTLDAIELYRKASYFFDAAKLMYKIADEEAKKRTKPLRVKKLYVLSALLIEQYHEQMKNAQRGKVKG-KNSEATSALAGLLEEEVLSTT-SRFTDNAWRGAEAYHFFILAQRQLYEGYVDTALKTALHLRDYEDIIPSVEIYSLLALCACASRAFGTCSKAFIKLESLETLSAEQKQQYEDLALEIFTKHTPKDNRKSELNSLLEG---GEGKLPTCIATGSPIIEYQFWVCKVCKHYVLAQEISNYNFCPLCHS 1178          
BLAST of WD repeat-containing protein 35 vs. Ensembl Mouse
Match: Wdr35 (WD repeat domain 35 [Source:MGI Symbol;Acc:MGI:1921932])

HSP 1 Score: 162.925 bits (411), Expect = 2.434e-45
Identity = 81/145 (55.86%), Postives = 117/145 (80.69%), Query Frame = 2
Query:  131 MFVYLSKKISIPNDVQLTTLSWNTNKGYIACXXXXXXXXXXXXDPQVNGNT-RGIAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVD 562
            MF YLSKKI++PN+V+L  +SWN ++G+IACGG +GLLKVL+L+ Q + +  RG+AAP+NL+MN+ LE H   +  +TWNE++ K+T++D++G+IIVW+L+K SW++EMINN N   V  + WN DG+KICI YEDG++I+GSVD
Sbjct:    1 MFFYLSKKIAVPNNVKLKCISWNKDQGFIACGGEDGLLKVLRLETQTDDSKLRGLAAPSNLSMNQNLEGHSGAVQVVTWNEQYQKLTTSDQNGLIIVWMLYKGSWYEEMINNRNKSVVRSMSWNADGQKICIVYEDGAVIVGSVD 145          
BLAST of WD repeat-containing protein 35 vs. Ensembl Mouse
Match: Tulp4 (tubby like protein 4 [Source:MGI Symbol;Acc:MGI:1916092])

HSP 1 Score: 115.546 bits (288), Expect = 2.350e-25
Identity = 81/328 (24.70%), Postives = 144/328 (43.90%), Query Frame = 2
Query:  275 GNTRGIAAPTNLT------------MNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTI--PDKLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTDENPIKIVGIEW-----------------------YKGDKGY---MCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGL----AVGQVTNKDF---NLIQFYNPFGYHLRTLKVISTK-LHSCSWDNESLRLAIAVDSSIYFANI 1114
            GN RG+   T  +            +N  L  H S +  + WNE + K+ + D  G I VWI ++  W  E++N+  + +V+   W+ DG +  I+Y DG +++GSV G R W   I    +++   W+PD + ++FG  DGQ+ + D  G  +  +  + +       I+ + W                         G   Y   +    P L V ++SG   +M N +D  P +I + L+     W   G +LA+ G+     + ++ N       +++FYN  G H+ TL  +  + + S  W +   RL +A   ++Y   +
Sbjct:   49 GNGRGVVGVTFTSSHCRRDRSTPQRINFNLRGHNSEVVLVRWNEPYQKLATCDADGGIFVWIQYEGRWSVELVNDRGA-QVSDFTWSHDGTQALISYRDGFVLVGSVSGQRHWSSEINLESQITCGIWTPDDQQVLFGTADGQVIVMDCHGRMLAHVLLHESDG-----ILSMSWNYPIFLVEDSSESDTDSDDYSPPQDGPAAYPIPVQNTKPLLTVSFTSGDISLMNNYDDLSPTVIRSGLKEVVAQWCTQGDLLAVAGMEQQAQLSELPNGPLLKSAMVKFYNVRGEHIFTLDTLVQRPIISICWGHRDSRLLMASGPALYVVRV 370          
BLAST of WD repeat-containing protein 35 vs. UniProt/SwissProt
Match: sp|Q9P2L0|WDR35_HUMAN (WD repeat-containing protein 35 OS=Homo sapiens OX=9606 GN=WDR35 PE=1 SV=3)

HSP 1 Score: 1112.83 bits (2877), Expect = 0.000e+0
Identity = 567/1191 (47.61%), Postives = 805/1191 (67.59%), Query Frame = 2
Query:  131 MFVYLSKKISIPNDVQLTTLSWNTNKGYIACXXXXXXXXXXXXDPQVN-GNTRGIAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTIPD-KLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTD-ENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGLAVGQVTNKDFNLIQFYNPFGYHLRTLKVISTKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIYAFTKPEQCHYCVIFWNSKLDSFQTKYFYNLKAIISNGILCTIIYQADADSKQK----------YTLLVCNSIGTPIDTKELPFEPLYQVMTESHVIVASQNIIYAWQFKKPENLLSIESQT---KRKSTMDNFIHVDDISIQKDGPSSTENNLHSLMKKL--SNDPICAICSARRTLIVATESGKMKQYSMPLMEYETTHKLRSKPFKLEINCTGNRVASIDFGGILSFFDLDKKYTDENGASGQGQIVENFEYKDVWDMKFSEDNSQLFVMMEKTKLRIIQDVESEEPVVFSGYICQFKELEVKAVLLDEIMNDLDKPNKNNVVTLEAKILRDCRKLLEEGQIEKAKEFIEDRPHNKMWKMLAEHALEKLDLETADQAFVRYTYYPGVKFVXXXXXXXXXXXXXAEISIYFGRYEEAEHRFMAIDRPDLVIAMLKSIGDWSRVLQLMKSGNS-ASDAEMNEAWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLERXXXXXXXXXXXXXXIAEIFVNAGMCEQAVFTYVKSDQLKSAIDCCIQLNHWQTAIDLAKNRDMTNINEMLTRYAKQLLDNKCYVQAVELYRRAGCFLEAAKIVQKLTEQEAKTSKNYSKLKKMSVLIGLLIEQHHDQNKIQAKARLKDIKGQDAASALNGMLHEEFHGVTESRLLDRPWHWAEAYHFYLLAQRQLFQKFFDAAMRTAKLLVDYEDVIAPRDIYSLIAICAIHNRAFGTSSKAFTKLETLNSFSEKEKENLISLTFKIFTKYSPIDPPRAREYDELENTFDGDSKIPICIVSGQPITQGQFWMCPICKHSAHEDEMNKHQNCPLCHSP 3646
            MF YLSKKISIPN+V+L  +SWN  +G+IACGG +GLLKVLKL+ Q +    RG+AAP+NL+MN+TLE H  ++  +TWNE++ K+T++DE+G+IIVW+L+K SW +EMINN N   V  + WN DG+KICI YEDG++I+GSVDGNRIWGK +   +LSHV WS DS++L+FG+ +G+IHIYD  GN +  +K  C  +    I I GI WY G +GY+  +CPCLAVC+ +G CQIMR+END+ PVLI+T +    + WN  G+VLA+ G     + +KD N++QFY PFG HL TLKV   ++ + SW+   L++A+AVDS IYFANIRP+YKW YC++T++YA+T+P++  YCV+FW++K +    KY   L +I + G  C +  +AD +  Q+          + L++CNSIGTP+D K +   PL+  MT++HVI AS+   Y WQ++  + L ++E       RK   +   HVDD       PS + + +    K +  + DPICAI ++ + LIV  ESG +++YS+P +     + L  + ++L +NC  +R+A ID  G+L+FFDLD + TD  G    G++++  E +DVWDMK+++DN  LF MMEKT++ + ++++ EEP+  SGYIC F++LE+K+VLLDEI+ D + PNK+ ++  E + LRD R L+E+  I+ A +FIED PH ++W++LAE AL+KLDL TA+QAFVR   Y G+KFVK+L KL + ++K AE+  YFGR+EEAE  ++ +DR DL I +   +GDW RVLQL+K+G+  A D+ + +A NAIG  + D+  W  AV Y+ QGR  E L ECYY LEDY GLE LA  LPEN  LL EIA++FV  GMCEQAV  ++K  Q K+A+D C+ LN W  A++LAKN  M  I  +L RYA  LL+    + A+ELYR+A  F +AAK++ K+ ++EAK      ++KK+ VL  LLIEQ+H+Q K   + ++K  K  +A SAL G+L EE    T+ R  D  W  AEAYHF++LAQRQL++   D A++TA  L DYED+I P +IYSL+A+CA  +RAFGT SKAF KL++L + S ++K+    L  +IFTK++  D  R  E D L     G+ K+P C+ +G PIT+ QFWMC +CKH     E++ +  CPLCHSP
Sbjct:    1 MFFYLSKKISIPNNVKLQCVSWNKEQGFIACGGEDGLLKVLKLETQTDDAKLRGLAAPSNLSMNQTLEGHSGSVQVVTWNEQYQKLTTSDENGLIIVWMLYKGSWIEEMINNRNKSVVRSMSWNADGQKICIVYEDGAVIVGSVDGNRIWGKDLKGIQLSHVTWSADSKVLLFGMANGEIHIYDNQGNFMIKMKLSCLVNVTGAISIAGIHWYHGTEGYVEPDCPCLAVCFDNGRCQIMRHENDQNPVLIDTGMYVVGIQWNHMGSVLAVAGFQKAAMQDKDVNIVQFYTPFGEHLGTLKVPGKEISALSWEGGGLKIALAVDSFIYFANIRPNYKWGYCSNTVVYAYTRPDRPEYCVVFWDTKNNEKYVKYVKGLISITTCGDFCILATKADENHPQEENEMETFGATFVLVLCNSIGTPLDPKYIDIVPLFVAMTKTHVIAASKEAFYTWQYRVAKKLTALEINQITRSRKEGRERIYHVDDT------PSGSMDGVLDYSKTIQGTRDPICAITASDKILIVGRESGTIQRYSLPNVGLIQKYSLNCRAYQLSLNCNSSRLAIIDISGVLTFFDLDARVTDSTGQQVVGELLK-LERRDVWDMKWAKDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGYICNFEDLEIKSVLLDEILKDPEHPNKDYLINFEIRSLRDSRALIEKVGIKDASQFIEDNPHPRLWRLLAEAALQKLDLYTAEQAFVRCKDYQGIKFVKRLGKLLSESMKQAEVVGYFGRFEEAERTYLEMDRRDLAIGLRLKLGDWFRVLQLLKTGSGDADDSLLEQANNAIGDYFADRQKWLNAVQYYVQGRNQERLAECYYMLEDYEGLENLAISLPENHKLLPEIAQMFVRVGMCEQAVTAFLKCSQPKAAVDTCVHLNQWNKAVELAKNHSMKEIGSLLARYASHLLEKNKTLDAIELYRKANYFFDAAKLMFKIADEEAKKGSKPLRVKKLYVLSALLIEQYHEQMKNAQRGKVKG-KSSEATSALAGLLEEEVLSTTD-RFTDNAWRGAEAYHFFILAQRQLYEGCVDTALKTALHLKDYEDIIPPVEIYSLLALCACASRAFGTCSKAFIKLKSLETLSSEQKQQYEDLALEIFTKHTSKD-NRKPELDSLME--GGEGKLPTCVATGSPITEYQFWMCSVCKHGVLAQEISHYSFCPLCHSP 1179          
BLAST of WD repeat-containing protein 35 vs. UniProt/SwissProt
Match: sp|A6N6J5|WDR35_RAT (WD repeat-containing protein 35 OS=Rattus norvegicus OX=10116 GN=Wdr35 PE=1 SV=1)

HSP 1 Score: 1101.27 bits (2847), Expect = 0.000e+0
Identity = 559/1180 (47.37%), Postives = 802/1180 (67.97%), Query Frame = 2
Query:  131 MFVYLSKKISIPNDVQLTTLSWNTNKGYIACXXXXXXXXXXXXDPQVN-GNTRGIAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTIPD-KLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTD-ENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGLAVGQVTNKDFNLIQFYNPFGYHLRTLKVISTKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIYAFTKPEQCHYCVIFWNSKLDSFQTKYFYNLKAIISNGILCTIIYQADADSKQKYTLLVCNSIGTPIDTKELPFEPLYQVMTESHVIVASQNIIYAWQFKKPENLLSIESQT---KRKSTMDNFIHVDDISIQKDGPSSTENNLHSLMKKL--SNDPICAICSARRTLIVATESGKMKQYSMPLMEYETTHKLRSKPFKLEINCTGNRVASIDFGGILSFFDLDKKYTDENGASGQGQIVENFEYKDVWDMKFSEDNSQLFVMMEKTKLRIIQDVESEEPVVFSGYICQFKELEVKAVLLDEIMNDLDKPNKNNVVTLEAKILRDCRKLLEEGQIEKAKEFIEDRPHNKMWKMLAEHALEKLDLETADQAFVRYTYYPGVKFVXXXXXXXXXXXXXAEISIYFGRYEEAEHRFMAIDRPDLVIAMLKSIGDWSRVLQLMKSGNS-ASDAEMNEAWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLERXXXXXXXXXXXXXXIAEIFVNAGMCEQAVFTYVKSDQLKSAIDCCIQLNHWQTAIDLAKNRDMTNINEMLTRYAKQLLDNKCYVQAVELYRRAGCFLEAAKIVQKLTEQEAKTSKNYSKLKKMSVLIGLLIEQHHDQNKIQAKARLKDIKGQDAASALNGMLHEEFHGVTESRLLDRPWHWAEAYHFYLLAQRQLFQKFFDAAMRTAKLLVDYEDVIAPRDIYSLIAICAIHNRAFGTSSKAFTKLETLNSFSEKEKENLISLTFKIFTKYSPIDPPRAREYDELENTFDGDSKIPICIVSGQPITQGQFWMCPICKHSAHEDEMNKHQNCPLCHS 3643
            MF YLSKKI++PN+V+L  +SWN ++G+IACGG +GLLKVL+L+ Q +    RG+AAP+NL+MN+ LE H   +  +TWNE++ K+T++D++G+IIVW+L+K SW++EMINN N   V  + WN DG+KICI YEDG++I+GSVDGNRIWGK +   +L HV WS DS++L+FG+ +G+IHIYD  GN I  +K  C  +    I I GI WY G +GY+  +CPCLA+C+ +G CQIMR+END+ PVLI+T +    + WN  G+VLA+ G       +KD N++QFY PFG HL TLKV   ++ S SW+   L++A+AVDS IYFANIRP YKW YC++T++YA+T+P++  YCV+FW++K +    KY  +L +I + G  C +  +AD +  Q + L++CNSIGTP+D K +   PL+  MT++HVI AS+  +Y WQ++  + L ++E       RK   +   HVDD+      PS + + +    K +  + DPICAI ++ +TLIV  ESG +++YS P +     + L  +  +L +NC  +R+A ID  G+L+FFDLD + TD  G    G++++  E KDVWDMK+++DN  LF MMEKT++ + ++++ EEP+  SGYIC F++LE+K+VLLDEI+ + + P+K+ ++  E + LRD R L+E+  IE A +FIED PH ++W++LAE AL+KLDL TA QAFVR   Y G+KFVK+L  LQ+ ++K AE+  YFGR+EEAE  ++ +DR DL I +   +GDW RVLQL+K+G+  A D+ + +A NAIG  + D+  W  AV Y+ +GR  E L ECYY LEDY GLE LA  LPEN  LL EIA++FV  GMCEQAV  ++K +Q K+A+D C+ LN W  A++LAK+  M  I  +L RYA  LL+    + A+ELYR+A  F +AAK++ K+ ++EAK      ++KK+ VL  LLIEQ+H+Q K   + ++K  K  +A SAL G+L EE    T SR  D  W  AEAYHF++LAQRQL++ + D A++TA  L DYED+I   +IYSL+A+CA  +RAFGT SKAF KLE+L + S ++K+    L  +IFTK++P D  ++     LE    G+ K+P CI +G PI + QFW+C +CKH     E++ +  CPLCHS
Sbjct:    1 MFFYLSKKIAVPNNVKLKCISWNKDQGFIACGGEDGLLKVLRLETQTDDSKLRGLAAPSNLSMNQNLEGHSGAVQVVTWNEQYQKLTTSDQNGLIIVWMLYKGSWYEEMINNRNKSVVRSMSWNADGQKICIVYEDGAVIVGSVDGNRIWGKDLKGIQLCHVTWSADSKILLFGMANGEIHIYDNQGNFIMKMKLNCLVNVTGAISIAGIHWYHGTEGYVEPDCPCLAICFDNGRCQIMRHENDQNPVLIDTGMYVVGIQWNHIGSVLAVAGSQKVVTQDKDVNIVQFYTPFGEHLGTLKVPGKQMCSLSWEGGGLKIALAVDSFIYFANIRPDYKWGYCSNTVVYAYTRPDRPEYCVVFWDTKNNEKYVKYVKSLISITTCGDFCILATKADENHPQ-FVLVLCNSIGTPLDPKYIDLVPLFVAMTKTHVIAASKEALYTWQYRVAKKLTALEINQITRSRKEGRERIYHVDDV------PSGSVDGVFDYSKAIQGTRDPICAITASDKTLIVGRESGVIQRYSFPNVALIQKYSLDCRACQLSLNCNSSRLAIIDIAGVLTFFDLDTRVTDSTGQQVVGELLK-LERKDVWDMKWAKDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGYICNFEDLEIKSVLLDEILKNPEHPSKDYIMNFEIRSLRDSRALIEKVGIEDASQFIEDNPHPRLWRLLAEAALQKLDLYTAQQAFVRCKDYQGIKFVKRLGNLQSESMKQAEVIAYFGRFEEAERMYLDMDRRDLAIGLRLKLGDWFRVLQLLKTGSGDADDSLLEQAHNAIGDYFADRQKWMNAVQYYVKGRNQERLAECYYMLEDYEGLENLANSLPENHKLLPEIAQMFVRVGMCEQAVSAFLKCNQPKAAVDTCVHLNQWNKAVELAKSHSMKEIGSLLARYASHLLEKNKTLDAIELYRKASYFFDAAKLMYKIADEEAKKRTKPLRVKKLYVLSALLIEQYHEQMKNAQRGKVKG-KNSEATSALAGLLEEEVLSTT-SRFTDNAWRGAEAYHFFILAQRQLYEGYVDTALKTALHLRDYEDIIPSVEIYSLLALCACASRAFGTCSKAFIKLESLETLSAEQKQQYEDLALEIFTKHTPKDNRKSELNSLLEG---GEGKLPTCIATGSPIIEYQFWVCKVCKHYVLAQEISNYNFCPLCHS 1167          
BLAST of WD repeat-containing protein 35 vs. UniProt/SwissProt
Match: sp|Q8BND3|WDR35_MOUSE (WD repeat-containing protein 35 OS=Mus musculus OX=10090 GN=Wdr35 PE=1 SV=3)

HSP 1 Score: 1097.8 bits (2838), Expect = 0.000e+0
Identity = 559/1190 (46.97%), Postives = 799/1190 (67.14%), Query Frame = 2
Query:  131 MFVYLSKKISIPNDVQLTTLSWNTNKGYIACXXXXXXXXXXXXDPQVN-GNTRGIAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTIPD-KLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTD-ENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGLAVGQVTNKDFNLIQFYNPFGYHLRTLKVISTKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIYAFTKPEQCHYCVIFWNSKLDSFQTKYFYNLKAIISNGILCTIIYQADADSKQK----------YTLLVCNSIGTPIDTKELPFEPLYQVMTESHVIVASQNIIYAWQFKKPENLLSIESQT---KRKSTMDNFIHVDDISIQKDGPSSTENNLHSLMKKL--SNDPICAICSARRTLIVATESGKMKQYSMPLMEYETTHKLRSKPFKLEINCTGNRVASIDFGGILSFFDLDKKYTDENGASGQGQIVENFEYKDVWDMKFSEDNSQLFVMMEKTKLRIIQDVESEEPVVFSGYICQFKELEVKAVLLDEIMNDLDKPNKNNVVTLEAKILRDCRKLLEEGQIEKAKEFIEDRPHNKMWKMLAEHALEKLDLETADQAFVRYTYYPGVKFVXXXXXXXXXXXXXAEISIYFGRYEEAEHRFMAIDRPDLVIAMLKSIGDWSRVLQLMKSGNS-ASDAEMNEAWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLERXXXXXXXXXXXXXXIAEIFVNAGMCEQAVFTYVKSDQLKSAIDCCIQLNHWQTAIDLAKNRDMTNINEMLTRYAKQLLDNKCYVQAVELYRRAGCFLEAAKIVQKLTEQEAKTSKNYSKLKKMSVLIGLLIEQHHDQNKIQAKARLKDIKGQDAASALNGMLHEEFHGVTESRLLDRPWHWAEAYHFYLLAQRQLFQKFFDAAMRTAKLLVDYEDVIAPRDIYSLIAICAIHNRAFGTSSKAFTKLETLNSFSEKEKENLISLTFKIFTKYSPIDPPRAREYDELENTFDGDSKIPICIVSGQPITQGQFWMCPICKHSAHEDEMNKHQNCPLCHS 3643
            MF YLSKKI++PN+V+L  +SWN ++G+IACGG +GLLKVL+L+ Q +    RG+AAP+NL+MN+ LE H   +  +TWNE++ K+T++D++G+IIVW+L+K SW++EMINN N   V  + WN DG+KICI YEDG++I+GSVDGNRIWGK +   +L HV WS DS++L+FG+ +G+IHIYD  GN I  +K  C  +    I I GI WY G +GY+  +CPCLA+C+ +G CQIMR+END+ PVLI+T +    + WN  G+VLA+ G       +KD N++QFY PFG HL TLKV   ++ S SW+   L++A+AVDS IYFANIRP YKW YC++T++YA+T+P++  YCV+FW++K      KY  +L +I + G  C +  +AD +  Q+          + L++CNSIGTP+D K +   PL+  MT++HVI AS+   Y WQ++  + L ++E       RK   +   HVDD+      PS + + +    K +  + DPICAI ++ +TLIV  ESG +++YS P +     + L  +  +L +NC  +R+A ID  G+L+FFDLD + TD  G    G++++  E KDVWDMK+++DN  LF MMEKT++ + ++++ EEP+  SGYIC F++LE+K+VLLDEI+ D + P+K+ ++  E + LRD R L+E+  IE A +FIED PH ++W++LAE AL+KLDL TA QAFVR   Y G+KFVK L  LQ+ ++K AE+  YFGR+E+AE  +  +DR DL I +   +GDW RVLQL+K+G+  A D+ + +A NAIG  + D+  W  AV Y+ +GR  E L ECYY LEDY GLE LA  LPEN  LL EIA++FV  GMCEQAV  ++K +Q K+A+D C+ LN W  A++LAK+  M  I  +L RYA  LL+    + A+ELYR+A  F +AAK++ K+ ++EAK      ++KK+ VL  LLIEQ+H+Q K   + ++K  K  +A SAL G+L EE    T SR  D  W  AEAYHF++LAQRQL++ + D A++TA  L DYED+I   +IYSL+A+CA  +RAFGT SKAF KLE+L + S ++K+    L  +IFTK++P D  ++     LE    G+ K+P CI +G PI + QFW+C +CKH     E++ +  CPLCHS
Sbjct:    1 MFFYLSKKIAVPNNVKLKCISWNKDQGFIACGGEDGLLKVLRLETQTDDSKLRGLAAPSNLSMNQNLEGHSGAVQVVTWNEQYQKLTTSDQNGLIIVWMLYKGSWYEEMINNRNKSVVRSMSWNADGQKICIVYEDGAVIVGSVDGNRIWGKDLKGIQLCHVTWSADSKILLFGMANGEIHIYDNQGNFIMKMKLNCLVNVTGAISIAGIHWYHGTEGYVEPDCPCLAICFDNGRCQIMRHENDQNPVLIDTGMYVVGIQWNHIGSVLAVAGSQKVVTQDKDINIVQFYTPFGEHLGTLKVPGKQMCSLSWEGGGLKIALAVDSFIYFANIRPDYKWGYCSNTVVYAYTRPDRPEYCVVFWDTKNSEKYVKYVKSLISITTCGDFCILATKADENHPQEENEMETFGATFVLVLCNSIGTPLDPKYIDLVPLFVAMTKTHVIAASKEAFYTWQYRVAKKLTALEINQITRSRKEGRERIYHVDDV------PSGSVDGVFDYSKAIQGTRDPICAITASDKTLIVGRESGVIQRYSFPNVALIQKYSLDCRACQLSLNCNSSRLAIIDIAGVLTFFDLDTRVTDSTGQQVVGELLK-LERKDVWDMKWAKDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGYICNFEDLEIKSVLLDEILKDPEHPSKDYIMNFEIRSLRDSRALIEKVGIEDASQFIEDNPHPRLWRLLAEAALQKLDLYTAQQAFVRCKDYQGIKFVKLLGNLQSESMKQAEVIAYFGRFEDAERMYQDMDRRDLAIGLRMKLGDWFRVLQLLKTGSGDADDSLLEQANNAIGEYFADRQKWQNAVQYYVKGRNQERLAECYYMLEDYEGLETLANSLPENHKLLPEIAQMFVRVGMCEQAVSAFLKCNQPKAAVDTCVHLNQWNKAVELAKSHSMKEIGSLLARYASHLLEKNKTLDAIELYRKASYFFDAAKLMYKIADEEAKKRTKPLRVKKLYVLSALLIEQYHEQMKNAQRGKVKG-KNSEATSALAGLLEEEVLSTT-SRFTDNAWRGAEAYHFFILAQRQLYEGYVDTALKTALHLRDYEDIIPSVEIYSLLALCACASRAFGTCSKAFIKLESLETLSAEQKQQYEDLALEIFTKHTPKDNRKSELNSLLEG---GEGKLPTCIATGSPIIEYQFWVCKVCKHYVLAQEISNYNFCPLCHS 1178          
BLAST of WD repeat-containing protein 35 vs. UniProt/SwissProt
Match: sp|Q9NRJ4|TULP4_HUMAN (Tubby-related protein 4 OS=Homo sapiens OX=9606 GN=TULP4 PE=1 SV=2)

HSP 1 Score: 119.013 bits (297), Expect = 1.528e-25
Identity = 83/328 (25.30%), Postives = 147/328 (44.82%), Query Frame = 2
Query:  275 GNTRGIAAPTNLT------------MNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTI--PDKLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTDENPIKIVGIEW-----------------------YKGDKGY--MCKNC-PCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGL----AVGQVTNKDF---NLIQFYNPFGYHLRTLKVISTK-LHSCSWDNESLRLAIAVDSSIYFANI 1114
            GN RG+   T  +            +N  L  H S +  + WNE + K+ + D  G I VWI ++  W  E++N+  + +V+   W+ DG +  I+Y DG +++GSV G R W   I    +++   W+PD + ++FG  DGQ+ + D  G  +  +  + +       ++G+ W                         G   Y    +N  P L V ++SG   +M N +D  P +I + L+     W   G +LA+ G+     +G++ N       +++FYN  G H+ TL  +  + + S  W +   RL +A   ++Y   +
Sbjct:   49 GNGRGVVGVTFTSSHCRRDRSTPQRINFNLRGHNSEVVLVRWNEPYQKLATCDADGGIFVWIQYEGRWSVELVNDRGA-QVSDFTWSHDGTQALISYRDGFVLVGSVSGQRHWSSEINLESQITCGIWTPDDQQVLFGTADGQVIVMDCHGRMLAHVLLHESDG-----VLGMSWNYPIFLVEDSSESDTDSDDYAPPQDGPAAYPIPVQNIKPLLTVSFTSGDISLMNNYDDLSPTVIRSGLKEVVAQWCTQGDLLAVAGMERQTQLGELPNGPLLKSAMVKFYNVRGEHIFTLDTLVQRPIISICWGHRDSRLLMASGPALYVVRV 370          
BLAST of WD repeat-containing protein 35 vs. UniProt/SwissProt
Match: sp|Q9JIL5|TULP4_MOUSE (Tubby-related protein 4 OS=Mus musculus OX=10090 GN=Tulp4 PE=1 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.644e-24
Identity = 81/328 (24.70%), Postives = 144/328 (43.90%), Query Frame = 2
Query:  275 GNTRGIAAPTNLT------------MNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTI--PDKLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTDENPIKIVGIEW-----------------------YKGDKGY---MCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGL----AVGQVTNKDF---NLIQFYNPFGYHLRTLKVISTK-LHSCSWDNESLRLAIAVDSSIYFANI 1114
            GN RG+   T  +            +N  L  H S +  + WNE + K+ + D  G I VWI ++  W  E++N+  + +V+   W+ DG +  I+Y DG +++GSV G R W   I    +++   W+PD + ++FG  DGQ+ + D  G  +  +  + +       I+ + W                         G   Y   +    P L V ++SG   +M N +D  P +I + L+     W   G +LA+ G+     + ++ N       +++FYN  G H+ TL  +  + + S  W +   RL +A   ++Y   +
Sbjct:   49 GNGRGVVGVTFTSSHCRRDRSTPQRINFNLRGHNSEVVLVRWNEPYQKLATCDADGGIFVWIQYEGRWSVELVNDRGA-QVSDFTWSHDGTQALISYRDGFVLVGSVSGQRHWSSEINLESQITCGIWTPDDQQVLFGTADGQVIVMDCHGRMLAHVLLHESDG-----ILSMSWNYPIFLVEDSSESDTDSDDYSPPQDGPAAYPIPVQNTKPLLTVSFTSGDISLMNNYDDLSPTVIRSGLKEVVAQWCTQGDLLAVAGMEQQAQLSELPNGPLLKSAMVKFYNVRGEHIFTLDTLVQRPIISICWGHRDSRLLMASGPALYVVRV 370          
BLAST of WD repeat-containing protein 35 vs. TrEMBL
Match: A0A210QYN3 (WD repeat-containing protein 35 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT24060 PE=4 SV=1)

HSP 1 Score: 1191.41 bits (3081), Expect = 0.000e+0
Identity = 584/1191 (49.03%), Postives = 838/1191 (70.36%), Query Frame = 2
Query:  131 MFVYLSKKISIPNDVQLTTLSWNTNKGYIACXXXXXXXXXXXXDPQVNGNTR--GIAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTIPDK-LSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTD-ENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGG--LAVGQVTNKDFNLIQFYNPFGYHLRTLKVISTKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIYAFTKPEQCHYCVIFWNSKLDSFQTKYFYNLKAIISNGILCTIIYQADADSKQKYTLLVCNSIGTPIDTKELPFEPLYQVMTESHVIVASQNIIYAWQFKKPENLLSIESQTKRKSTMDNFIHVDDISIQKDGPSSTENNLHSLMKKLSNDPICAICSARRTLIVATESGKMKQYSMPLMEYETTHKLRSKPFKLEINCTGNRVASIDFGGILSFFDLDKKYTDENGASGQGQIVENFEYKDVWDMKFSEDNSQLFVMMEKTKLRIIQDVESEEPVVFSGYICQFKELEVKAVLLDEIMNDLDKPNKNNVVTLEAKILRDCRKLLEEGQIEKAKEFIEDRPHNKMWKMLAEHALEKLDLETADQAFVRYTYYPGVKFVXXXXXXXXXXXXXAEISIYFGRYEEAEHRFMAIDRPDLVIAMLKSIGDWSRVLQLMKSGNSASDAEMNEAWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLERXXXXXXXXXXXXXXIAEIFVNAGMCEQAVFTYVKSDQLKSAIDCCIQLNHWQTAIDLAKNRDMTNINEMLTRYAKQLLDNKCYVQAVELYRRAGCFLEAAKIVQKLTEQEAKTSKNYSKLKKMSVLIGLLIEQHHDQNKIQAKARLKDIKGQDAASALNGMLHEEFHGVTESRLLDRPWHWAEAYHFYLLAQRQLFQKFFDAAMRTAKLLVDYEDVIAPRDIYSLIAICAIHNRAFGTSSKAFTKLETLNSFSEKEKENLISLTFKIFTKYSPIDPPRAREYDELENTF-------------DGDSKIPICIVSGQPITQGQFWMCPICKHSAHEDEMNKHQNCPLCHSP 3646
            MFVYLSKKI+IPN+ +L  +SWN  +GYIACGG EGLLKVLKL+ Q   + +  G+AAP+NL+MN+TLE H   +  +TWNE + K+T++D+ G+IIVW+L+K SW++EMINN N   V  + WN DG+KICI Y+DG++I+GSVDGNRIWGK +  + L+HVEWSPD + ++FG+ +G++H+YD  GN I  ++ YC +     + I G++WY G+ GY+  NCP LA+C+ SG CQIMR+E DE PVLI+T +    + WN  G+V+A+ G    VGQ  +KD N++QFY+PFG HLRTLKV    ++SCSW+  SLR+A+AVDS IYFANIRP YKW YC++T++Y+F+KPE+  +CVIFW++K      KY  NL AI + G  C +  +AD ++  +Y L++CNSIGTP+D+K +  +P+Y  MT++H++ AS+  IY WQFK P+ L ++E   +R++  +   H+DD   Q  G ++ E    S     ++DPICAIC++ +TLIV  ESG + +YSMP++     + L  +P++  +NCT +R+A+ID  G+L+FFDLD + TD +G    G+ ++ FE KDVWDMK++EDN +LF MMEKT++ I ++++ EEP++ SGYICQF +L +K+VLLDEIM D + P K+++  +E K LRD R LLE+  I  A++FIED PH ++W++LAE ALE+L+L+ A+ AFVR   Y G++FVK+L  LQN N+K AE++ YF R+EEAE +++ +DR DL +++ K +GDW RV+QL+K+G+   D ++ EAWNAIG  Y D+  W QAV Y+ QGR  E L ECYY LEDY+GLE++ + LPEN  LL +IA +FV  GMCEQAV  Y K + +K AIDCC+ LN W  AI+LAK+ ++  I+ +L +YA+ LL+    V A+ELYR+AG +LEAAK++ ++ +++AK  +    +KKM VL GLLIEQ+H+Q K+ ++A++KD KG  AASAL G L E+   +T+S+L+D  W  AEAYHFY+ AQRQL + + DAAMRT   L +Y+D+I   DIY+L+A+ +  N+AFGT SKAF KLETL++  + +++    L  +IFTK SP D       +++E T              + D+K P CIV+G+P+ + QFWMC  CKH A+E E+   Q CPLCH+P
Sbjct:    1 MFVYLSKKIAIPNNTKLRCVSWNREQGYIACGGEEGLLKVLKLEIQTGKDVKVKGLAAPSNLSMNQTLEGHSGAVQVVTWNEHYQKLTTSDQYGLIIVWMLYKGSWYEEMINNRNKSVVRSMGWNADGQKICIVYQDGAVIVGSVDGNRIWGKELKSQELNHVEWSPDGKFILFGMANGEVHVYDNTGNFISKVQIYCLSGVSGALHIAGLQWYNGNHGYIEPNCPSLAICFDSGRCQIMRSEADESPVLIDTGMTVAQIGWNHTGSVMAVAGSQRTVGQ--DKDINVVQFYSPFGEHLRTLKVPGKTMYSCSWEGGSLRIALAVDSFIYFANIRPDYKWGYCSNTVVYSFSKPERIEHCVIFWDTKNGEKYVKYVRNLIAITACGDYCCLATKAD-EAVGQYVLVLCNSIGTPLDSKYVEIDPVYLTMTKTHIVAASKEAIYTWQFKNPKKLSTLEVAGRRRTGTERLYHIDD---QPTGSAAQEEVDFSKAYNSTDDPICAICASDKTLIVGRESGTVNRYSMPMLSLTHKYALNYRPYQFALNCTSSRLATIDISGVLTFFDLDTRITDTDGKESIGEQLK-FERKDVWDMKWAEDNPELFSMMEKTRMYIFRNLDPEEPILSSGYICQFNDLTIKSVLLDEIMKDPENPTKDSMAEMEIKSLRDTRDLLEKVGIADAQQFIEDNPHPRLWRLLAESALEQLNLKVAETAFVRCRDYQGIEFVKRLGNLQNENMKQAEVAAYFRRFEEAERKYLDMDRRDLAVSLRKKLGDWFRVVQLLKTGSGGDDVQLEEAWNAIGDYYADRQKWQQAVTYYVQGRNQERLAECYYMLEDYTGLEKMVQALPENQKLLPDIAAMFVTVGMCEQAVSAYSKCNHIKKAIDCCVHLNQWNMAIELAKSNNVREIDSLLAKYAQHLLEKNKTVNAIELYRKAGHYLEAAKLLFQMAQEQAKKREKPLHIKKMFVLGGLLIEQYHEQMKMTSRAKVKDKKGAMAASALAGFLEEDTTAITDSKLIDSAWRGAEAYHFYIRAQRQLLEGYVDAAMRTTLFLREYDDIIDAVDIYALLALTSSANKAFGTCSKAFIKLETLDTLPQDQRQAYEELALEIFTKKSPKDS----RTNKVECTSCATSIPDWSTVCPNCDTKFPTCIVTGRPLMEYQFWMCSACKHRAYESEITNRQTCPLCHTP 1180          
BLAST of WD repeat-containing protein 35 vs. TrEMBL
Match: K1R2H9 (WD repeat-containing protein 35 OS=Crassostrea gigas OX=29159 GN=CGI_10009328 PE=4 SV=1)

HSP 1 Score: 1166.37 bits (3016), Expect = 0.000e+0
Identity = 583/1187 (49.12%), Postives = 823/1187 (69.33%), Query Frame = 2
Query:  131 MFVYLSKKISIPNDVQLTTLSWNTNKGYIACXXXXXXXXXXXXDPQVNGNTR--GIAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTI-PDKLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTD-ENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGG--LAVGQVTNKDFNLIQFYNPFGYHLRTLKVISTKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIYAFTKPEQCHYCVIFWNSKLDSFQTKYFYNLKAIISNGILCTIIYQADADSKQKYTLLVCNSIGTPIDTKELPFEPLYQVMTESHVIVASQNIIYAWQFKKPENLLSIESQTKRKSTMDNFIHVDDISIQKDGPSSTENNLHSLMKKLSNDPICAICSARRTLIVATESGKMKQYSMPLMEYETTHKLRSKPFKLEINCTGNRVASIDFGGILSFFDLDKKYTDENGASGQGQIVENFEYKDVWDMKFSEDNSQLFVMMEKTKLRIIQDVESEEPVVFSGYICQFKELEVKAVLLDEIMNDLDKPNKNNVVTLEAKILRDCRKLLEEGQIEKAKEFIEDRPHNKMWKMLAEHALEKLDLETADQAFVRYTYYPGVKFVXXXXXXXXXXXXXAEISIYFGRYEEAEHRFMAIDRPDLVIAMLKSIGDWSRVLQLMKSGNSASDAEMNEAWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLERXXXXXXXXXXXXXXIAEIFVNAGMCEQAVFTYVKSDQLKSAIDCCIQLNHWQTAIDLAKNRDMTNINEMLTRYAKQLLDNKCYVQAVELYRRAGCFLEAAKIVQKLTEQEAKTSKNYSKLKKMSVLIGLLIEQHHDQNKIQAKARLKDIKGQDAASALNGMLHEEFHGVTESRLLDRPWHWAEAYHFYLLAQRQLFQKFFDAAMRTAKLLVDYEDVIAPRDIYSLIAICAIHNRAFGTSSKAFTKLETLNSFSEKEKENLISLTFKIFTKYSPIDPPRAREY---------DELENTFDGDSKIPICIVSGQPITQGQFWMCPICKHSAHEDEMNKHQNCPLCHSP 3646
            MFVYLSKKI+IPN+ +L  +SWN  +GYIACGG EGLLKVL+L+ Q   + +  G+AAP+NL+MN+TLE H   +  +TWNE + K+T++D+ G+IIVW+L+K SW++EMINN N   V  + WN DG+KICI YEDG +I+GSVDGNRIWGK +   +L+HV WSPD ++++FG+ +G++H YD  GN I  L  YC +     I I GI WY G  GY+  NCP LA+C+ SG CQIM+NE DE P+LI+T +    + WN +G+VLA+ G   A+GQ   K+ N++QFYNPFG HLRTLKV   +++SCSW+  SLR+A+AVDS IYFANIRP YKW +C++T++Y+FTKPE+  +CVIFW++K      KY  NL AI + G  C +  +AD  + Q + L++CNSIGTP+D+K +  +P+Y  MT++H++ AS+  +Y WQFK P+ L +++   +R++  +   H+DD   Q  G ++TE    S     + DP+CAIC++ + LIV  ESG + +YSMP++     + +  +P +L +NCT +R+A ID  G+L+FFDLD + TD++G    G+ ++ FE KDVWDM+++EDN +LF M EKT++ I ++++ EEP++ SGYICQF +L++K+VLLDEIM D + P K+N+  +E K LRD R LLE+  I  A++FIED PH ++W++LAE ALE+L+L+ A+QAFVR   Y G++FVK+L  LQN N+K AE+  YF R+EEAE +++ +DR DL +++ K +GDW RV+QL+K+G+   D ++ EAWNAIG  Y D+  W QAV Y+ QGR  E L ECYY LEDY GLE++ + LPEN  LL EI   FV  GMCEQAV  + + + +K AID C+ LN W TAI+LAK  ++  I+ +L +YA  LL+    V A+ELYR+AG FL AAK++ KL  ++AK       +KKM VL GLLIEQ+H+Q K+ +++++KD +   AASAL G L E+   +++S+LLD  W  AEAYHFYLLAQRQL + + +A+MRT   L DYED+I P DIYSL+A+ A   +AFGT SKAF KLETL S + +++ +   L  +IFTK+ P D    +           D   +  + D+K P CIV+G+P+ + QFWMC  CKH A E E++  Q CPLCH+P
Sbjct:    1 MFVYLSKKIAIPNNTKLRYVSWNREQGYIACGGEEGLLKVLRLETQTGKDVKVKGLAAPSNLSMNQTLEGHSGAVQVVTWNEHYQKLTTSDQYGLIIVWMLYKGSWYEEMINNRNKSVVRSMAWNADGQKICIVYEDGCVIVGSVDGNRIWGKELRGQQLAHVVWSPDGKIILFGMTNGEVHSYDNMGNFISKLNIYCLSGVSGAIHIAGIAWYNGLNGYLEPNCPSLAICFESGRCQIMKNEIDENPILIDTGMMVAQIQWNHSGSVLAVAGSQRALGQ--EKEVNVVQFYNPFGEHLRTLKVPGKQMYSCSWEGGSLRIALAVDSFIYFANIRPDYKWGFCSNTVVYSFTKPERVEHCVIFWDTKNGEKYVKYVRNLIAITACGDYCCLATKADETTGQ-FVLVLCNSIGTPLDSKYVEIDPVYLTMTKTHIMCASKEALYTWQFKNPKKLATLDMPGRRRAGTERLYHIDD---QPTGATATEEVDFSKAFNGTEDPVCAICASDKVLIVGRESGTINRYSMPMLSLTHKYAIGCRPHQLSLNCTSSRLAIIDISGVLTFFDLDTRITDQDGKEIVGEQLK-FERKDVWDMRWAEDNPELFAMTEKTRMYIFRNLDPEEPILSSGYICQFNDLQIKSVLLDEIMKDPENPTKDNMAEMEIKSLRDTRDLLEKVGINDAQQFIEDNPHPRLWRLLAESALEQLNLKVAEQAFVRCKDYQGIEFVKRLGNLQNENMKKAEVCAYFRRFEEAERKYLDMDRRDLAVSLRKKLGDWFRVVQLLKTGSGGDDVQLEEAWNAIGDYYADRQKWQQAVTYYVQGRNQERLAECYYTLEDYGGLEKMVQALPENHKLLPEIGHKFVTVGMCEQAVAAFTRCNHIKKAIDSCVDLNQWNTAIELAKTHNVREIDSLLAKYASHLLEKNKIVSAIELYRKAGHFLNAAKLLFKLANEQAKKKARPVLIKKMFVLGGLLIEQYHEQMKMTSRSKVKDKRM--AASALAGFLEEDATAISDSKLLDNAWRGAEAYHFYLLAQRQLNEGYVEASMRTCLFLRDYEDIIDPCDIYSLLALAASACKAFGTCSKAFIKLETLESLTPEQRLSYEELALEIFTKHGPRDSRNNKVECSSCATSIPDSSFSCPNCDTKFPACIVTGRPLMEYQFWMCSACKHRAFESEISHRQTCPLCHTP 1178          
BLAST of WD repeat-containing protein 35 vs. TrEMBL
Match: R7U1T8 (WD_REPEATS_REGION domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_160931 PE=4 SV=1)

HSP 1 Score: 1133.24 bits (2930), Expect = 0.000e+0
Identity = 562/1184 (47.47%), Postives = 805/1184 (67.99%), Query Frame = 2
Query:  131 MFVYLSKKISIPNDVQLTTLSWNTNKGYIACXXXXXXXXXXXXDPQVNGN--TRGIAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTIPD-KLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTD-ENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGLAVGQVTNKDFNLIQFYNPFGYHLRTLKVISTKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIYAFTKPEQCHYCVIFWNSKLDSFQTKYFYNLKAIISNGILCTIIYQADADSKQKYTLLVCNSIGTPIDTKELPFEPLYQVMTESHVIVASQNIIYAWQFKKPENLLSIESQTKRKSTMDNFIHVDDISIQKDGPSSTENNLHSLMKKLSNDPICAICSARRTLIVATESGKMKQYSMPLMEYETTHKLRSKPFKLEINCTGNRVASIDFGGILSFFDLDKKYTDENGASGQGQIVENFEYKDVWDMKFSEDNSQLFVMMEKTKLRIIQDVESEEPVVFSGYICQFKELEVKAVLLDEIMNDLDKPNKNNVVTLEAKILRDCRKLLEEGQIEKAKEFIEDRPHNKMWKMLAEHALEKLDLETADQAFVRYTYYPGVKFVXXXXXXXXXXXXXAEISIYFGRYEEAEHRFMAIDRPDLVIAMLKSIGDWSRVLQLMKSGNSASDAEMNEAWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLERXXXXXXXXXXXXXXIAEIFVNAGMCEQAVFTYVKSDQLKSAIDCCIQLNHWQTAIDLAKNRDMTNINEMLTRYAKQLLDNKCYVQAVELYRRAGCFLEAAKIVQKLTEQEAKTSKNYSKLKKMSVLIGLLIEQHHDQNKIQAKARLKDIKGQDAASALNGMLHEEFHGVTESRLLDRPWHWAEAYHFYLLAQRQLFQKFFDAAMRTAKLLVDYEDVIAPRDIYSLIAICAIHNRAFGTSSKAFTKLETLNSFSEKEKENLISLTFKIFTKYSPIDPPRAR-EYDELENTFDG--------DSKIPICIVSGQPITQGQFWMCPICKHSAHEDEMNKHQNCPLCHS 3643
            MF+YLSKKI+IPN+  L ++SWN  +GYIACGG +GLLKVLKL+ Q   +   +G+AAP+NL+MN+TLE H   +  +TWNE   K+T++D+ G+IIVW+L+K +W++EMINN N   V G+KWN +G+KICI YEDG++I+GSVDGNRIWGK +    L+ VEWSPD ++L+F + +G I IYD  GN I  L  YC T     ++I  ++WY G+ GY+  NCPCLAVC+ +G CQIMR E+DE PVL+++ ++  C  W+  G VLAI G    +  +KD N+IQFYNPFG HLRTLKV   ++HSCSW+  SLR+A+AVDS IYFANIRP YKW Y ++T++YA+T+PE+  + VIFW++K      KY  NL +I + G  C +  +AD D   ++ L++CNSIGTP+D+K +  EP+Y  MT +H+I AS+   Y WQF+  ++L S+E   KRK+  +   H+DD+     G +   N  +S     + DP+C + +  + LIV  ESG + +Y+MP +     H L  +P ++ +N T  R++ ID  G+L+F+DLD + TD NG    G+ ++ FE KDVWDMK++EDNS+LF MMEKT++ I + ++ EEP++ SGYIC FK+L++K+VLLD+IM   D P  ++++ +E K LRD R++LE+  +E+A+ F ED PH ++WK++AE ALE+ +L  A+ AFVR   Y G++FVK+L  LQN+ +K AE++ YF R++EAE  ++ +DR DL +++ K +GDW RV+QL+K+G+   D ++ EAWNAIG  Y D+  W QAV Y+ QGR    L ECYY LEDY+ L+ + E LPEN  LL +IA +F   GMC+++V  + K  ++K+AIDCC+QLN W TAIDLAK  ++  I+ +L +YAK LL+    + AVELYR+A  +LEAAK++ K+ E+E +      ++KK+ VL  LL+EQ+H+Q K+ ++ ++K  +  +A SAL G+L E+   +++++L+D  W  AEAYHFYLLAQ QL+  + DA+M+T   L +YEDVI P DIYSL+ + A   RAFGT SKAF KLE+L S + ++K     L   IFTKYSP D    + E    E             D+K P CIV+G+P+   QFWMC  CKH A+E E++  Q CPLCHS
Sbjct:    1 MFIYLSKKIAIPNNTHLKSVSWNREQGYIACGGEDGLLKVLKLETQSGKDPKVKGLAAPSNLSMNQTLEGHSGAVQCLTWNEHHQKLTTSDQYGLIIVWMLYKGAWYEEMINNRNKSVVRGMKWNAEGQKICIVYEDGAVIVGSVDGNRIWGKELKGVHLAGVEWSPDGKILLFAMTNGDIQIYDNTGNLISKLMIYCLTGVTTSLRIAAVQWYNGNHGYLEPNCPCLAVCFDNGRCQIMRTESDEDPVLVDSGMQIVCAQWDHCGAVLAIAG--SQRAADKDINVIQFYNPFGEHLRTLKVPGKQMHSCSWEGGSLRIALAVDSFIYFANIRPDYKWGYFSNTVVYAYTRPERLEHHVIFWDTKNSEKYVKYVRNLISIRACGDYCCLATRAD-DQAGQFVLVLCNSIGTPLDSKYIDIEPMYVTMTRTHIIAASREAFYTWQFRNMKSLASLEVSGKRKAGSEKLYHIDDVPSGAGGETIDFNKAYSS----TEDPLCCVAATDKVLIVGRESGTLNRYAMPQLSLTHKHTLNCRPHQIALNSTSTRLSIIDIAGVLTFYDLDVRVTDPNGQEVIGEHLK-FERKDVWDMKWAEDNSELFAMMEKTRMYIFRKLDPEEPILSSGYICHFKDLQIKSVLLDDIMVKTDTPTNDSIMEMEVKSLRDTREILEKVGLEEAQSFTEDNPHPRLWKLIAESALEQQNLRIAEHAFVRCKDYQGIEFVKRLGNLQNDTMKQAEVAAYFMRFDEAERLYLDMDRRDLAVSLRKKLGDWFRVVQLLKTGSGGDDQQLEEAWNAIGDYYADRQKWQQAVTYYVQGRNQVRLAECYYVLEDYTRLKEMMENLPENHKLLPDIAGMFATVGMCQESVEAFTKCQRVKAAIDCCVQLNQWNTAIDLAKTHNVREIDSLLAKYAKHLLEKNKIINAVELYRKANHYLEAAKLLYKVAEEEVQKKAKPLRIKKLYVLAALLVEQYHEQMKVTSRTKIK--RATEATSALAGLLEEDSASISDTKLVDNAWRGAEAYHFYLLAQSQLYNNYVDASMKTCLHLREYEDVINPVDIYSLLGLAASATRAFGTCSKAFIKLESLESLTTEQKAQYEELALDIFTKYSPKDQRTGKTECTSCETAIPDWCSVCPSCDTKFPTCIVTGRPLMDYQFWMCQTCKHRAYESEISSRQTCPLCHS 1174          
BLAST of WD repeat-containing protein 35 vs. TrEMBL
Match: W5NKT8 (WD repeat-containing protein 35 OS=Lepisosteus oculatus OX=7918 PE=4 SV=1)

HSP 1 Score: 1127.85 bits (2916), Expect = 0.000e+0
Identity = 570/1198 (47.58%), Postives = 815/1198 (68.03%), Query Frame = 2
Query:  131 MFVYLSKKISIPNDVQLTTLSWNTNKGYIACXXXXXXXXXXXXDPQVN-GNTRGIAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTIPD-KLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTD-ENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGLAVGQVTNKDFNLIQFYNPFGYHLRTLKVISTKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIYAFTKPEQCHYCVIFWNSKLDSFQTKYFYNLKAIISNGILCTIIYQAD------------------ADSKQKYTLLVCNSIGTPIDTKELPFEPLYQVMTESHVIVASQNIIYAWQFKKPENLLSIE---SQTKRKSTMDNFIHVDDISIQKDGPSSTENNLHSLMKKLSN--DPICAICSARRTLIVATESGKMKQYSMPLMEYETTHKLRSKPFKLEINCTGNRVASIDFGGILSFFDLDKKYTDENGASGQGQIVENFEYKDVWDMKFSEDNSQLFVMMEKTKLRIIQDVESEEPVVFSGYICQFKELEVKAVLLDEIMNDLDKPNKNNVVTLEAKILRDCRKLLEEGQIEKAKEFIEDRPHNKMWKMLAEHALEKLDLETADQAFVRYTYYPGVKFVXXXXXXXXXXXXXAEISIYFGRYEEAEHRFMAIDRPDLVIAMLKSIGDWSRVLQLMKSGNS-ASDAEMNEAWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLERXXXXXXXXXXXXXXIAEIFVNAGMCEQAVFTYVKSDQLKSAIDCCIQLNHWQTAIDLAKNRDMTNINEMLTRYAKQLLDNKCYVQAVELYRRAGCFLEAAKIVQKLTEQEAKTSKNYSKLKKMSVLIGLLIEQHHDQNKIQAKARLKDIKGQDAASALNGMLHEEFHGVTESRLLDRPWHWAEAYHFYLLAQRQLFQKFFDAAMRTAKLLVDYEDVIAPRDIYSLIAICAIHNRAFGTSSKAFTKLETLNSFSEKEKENLISLTFKIFTKYSPIDPPRAREYDELENTFDGDSKIPICIVSGQPITQGQFWMCPICKHSAHEDEMNKHQNCPLCHS 3643
            MF+YLSKKI+IPN+++L  +SWN ++G+IACGG EGLLKVLKL+ Q +    +G+AAP+NL+MN+TLE H   +  +TWNE++ K+T++D++G+IIVW+L+K SW++EMINN N   V  + WN DG+KICI YEDG++I+GSVDGNRIWGK +   +L+HV WSPDS++L+FG+ +G+IHIYD  GN I  +   C  +    I I GI WY G +G++  +CPCLA+C+ +G CQIMR+E+DE PVLI+T +    + WN  G+VLA+ G       +KD N++QFY PFG HLRTLKV   ++ + SW+   LR+ +AVDS IYFANIRP YKW YC++T++YA+T+P++  YCV+FW++K +    KY  +L +I + G  C +  ++D                  +++ +KY L++CNSIGTP+D+K +  +PL+  MT++HVI AS+   Y WQ++  + L ++E       RK   +   H+DD       PS T        K  +   DPIC I +  +TLIV  ESG +++YS+P +     + L  + ++L +NC  +R+A ID  G+L+FFD++ + ++ +G    G  ++ FE KDVWDMK++ DN  LF MMEKT++ + ++++ EEP+  SGYIC F++LE+K+VLLDEI+ D + PNK+ ++  E + LRD R L+E+  IE A +FIED PH ++W++LAE AL+KLDL+TA+QAFVR   Y G++FVK+L  LQ+ ++K AE++ YFGR+EEAE  ++ +DR DL I++   +GDW RVLQL+KSG+  A DA + +A+NAIG  + D+  W  AV Y+ QGR  E L ECYY LEDY GLERLA  LPEN  LL +I ++FV  GMCEQAV  Y+K +Q K+A+D C+ LN W  A++LAKN +M  I  +L++YA  LLD    + A+ELYR+A  FL+AA ++ K+ ++EAK      ++KK+ VL  LL+E +H Q K   K + K  K  +A SAL G+L E+    +++R++D  W  AEAYHF+LLAQRQL++ + DAAMRTA  L DYED+I   +IYSL+AICA  NRAFGT SKAF KLE+L S S + +++   L  +IFTKYSP D  R  E D +     G+  +P CIV+G+PI++ QFWMC +CKH A E E+  H  CPLCHS
Sbjct:    1 MFIYLSKKIAIPNNIRLKCVSWNKDQGFIACGGDEGLLKVLKLETQTDDAKLKGLAAPSNLSMNQTLEGHSGAVQVVTWNEQYQKLTTSDQNGLIIVWMLYKGSWYEEMINNRNKSVVRSMSWNADGQKICIVYEDGAVIVGSVDGNRIWGKDLKGIQLAHVAWSPDSKILLFGMANGEIHIYDNQGNFIVKMTLNCLVNVTGAISIAGIHWYHGTEGFIEPDCPCLAICFDNGRCQIMRHESDENPVLIDTGMNVVSIQWNHCGSVLAVAGSQKAIALDKDVNVVQFYTPFGEHLRTLKVPGKQMMAVSWEGGGLRIGLAVDSFIYFANIRPDYKWGYCSNTVVYAYTRPDRLEYCVVFWDTKNNEKYVKYVKSLMSITTCGDFCILATKSDDTHPQEDTEAESVSAMVASENIRKYVLVLCNSIGTPLDSKYIDIDPLFVTMTKTHVIAASKEAFYTWQYRVAKKLTAMEINQVARTRKEGRERVYHIDDT------PSGTAEGALDFSKAFTTTRDPICCITATDKTLIVGRESGTIQRYSLPNVGLVQKYVLNYRAYQLSLNCNSSRLAIIDITGVLTFFDIEVRTSESSGHQSAGDPLK-FERKDVWDMKWATDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGYICNFEDLEIKSVLLDEILKDPEHPNKDYLINFEIRSLRDSRALIEKVGIEDASQFIEDNPHPRLWRLLAEAALQKLDLKTAEQAFVRCKDYQGIEFVKRLGNLQSESMKQAEVAAYFGRFEEAERMYLDMDRRDLAISLRIKLGDWFRVLQLLKSGSGDADDALLEQAYNAIGDYFADRQKWVNAVQYYLQGRNQERLAECYYMLEDYDGLERLANSLPENHKLLPDIGQMFVTVGMCEQAVSAYLKCNQPKAAVDACVHLNQWNKAVELAKNHNMKEIGSLLSKYASHLLDKNKILDAIELYRKAHHFLDAATLMYKIADEEAKKRTKPLRVKKLYVLAALLVENYHGQMKSTQKGKAKG-KKSEATSALAGLLEEDATS-SDNRIIDSAWRGAEAYHFFLLAQRQLYEGYVDAAMRTALHLRDYEDIIPAVEIYSLLAICASANRAFGTCSKAFIKLESLESLSAEHRQHYEDLALEIFTKYSPKD-NRKSELDSIPE--GGEGMLPTCIVTGRPISEYQFWMCSVCKHCALEQEITNHSFCPLCHS 1186          
BLAST of WD repeat-containing protein 35 vs. TrEMBL
Match: A0A2Y9E5U9 (WD repeat-containing protein 35 OS=Trichechus manatus latirostris OX=127582 GN=LOC101346176 PE=4 SV=1)

HSP 1 Score: 1126.69 bits (2913), Expect = 0.000e+0
Identity = 568/1181 (48.09%), Postives = 809/1181 (68.50%), Query Frame = 2
Query:  131 MFVYLSKKISIPNDVQLTTLSWNTNKGYIACXXXXXXXXXXXXDPQVN-GNTRGIAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTIPD-KLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTD-ENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGLAVGQVTNKDFNLIQFYNPFGYHLRTLKVISTKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIYAFTKPEQCHYCVIFWNSKLDSFQTKYFYNLKAIISNGILCTIIYQADADSKQKYTLLVCNSIGTPIDTKELPFEPLYQVMTESHVIVASQNIIYAWQFKKPENLLSIESQT---KRKSTMDNFIHVDDISIQKDGPSSTENNLHSLMKKL--SNDPICAICSARRTLIVATESGKMKQYSMPLMEYETTHKLRSKPFKLEINCTGNRVASIDFGGILSFFDLDKKYTDENGASGQGQIVENFEYKDVWDMKFSEDNSQLFVMMEKTKLRIIQDVESEEPVVFSGYICQFKELEVKAVLLDEIMNDLDKPNKNNVVTLEAKILRDCRKLLEEGQIEKAKEFIEDRPHNKMWKMLAEHALEKLDLETADQAFVRYTYYPGVKFVXXXXXXXXXXXXXAEISIYFGRYEEAEHRFMAIDRPDLVIAMLKSIGDWSRVLQLMKSGNS-ASDAEMNEAWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLERXXXXXXXXXXXXXXIAEIFVNAGMCEQAVFTYVKSDQLKSAIDCCIQLNHWQTAIDLAKNRDMTNINEMLTRYAKQLLDNKCYVQAVELYRRAGCFLEAAKIVQKLTEQEAKTSKNYSKLKKMSVLIGLLIEQHHDQNKIQAKARLKDIKGQDAASALNGMLHEEFHGVTESRLLDRPWHWAEAYHFYLLAQRQLFQKFFDAAMRTAKLLVDYEDVIAPRDIYSLIAICAIHNRAFGTSSKAFTKLETLNSFSEKEKENLISLTFKIFTKYSPIDPPRAREYDELENTFDGDSKIPICIVSGQPITQGQFWMCPICKHSAHEDEMNKHQNCPLCHSP 3646
            MF YLSKKI+IPN+V+L  +SWN ++G+IACGG +GLLKVLKL+ Q +    RG+AAP+NL+MN+TLE H  ++  +TWNE++ K+T++D++G+IIVW+L+K SW++EMINN N   V  + WN DG+KICI YEDG++I+GSVDGNRIWGK +   +L HV WS DS++L+FG+ +G+IHIYD  GN I  +K  C  +    I I GI WY G +GY+  +CPCLA+C+ +G CQIMR+END+ PVLI+T +    + WN  G+VLA+ G       +KD N +QFY PFG HL TLKV   ++ + SW+   L++A+AVDS IYFANIRP YKW YC++T++YA+T+P++  YCV+FW++K +    KY  +L ++ + G  C +  +AD +  Q + L++CNSIGTP+D K +   PL+  MT++HVI AS+   Y WQ++  + L ++E       RK   +   HVDD       PS + + +    K +  + DPICAI ++ +TLIV  ESG +++YS+P       + L  + ++L +NC  +R+A ID  G+L+FFDLD + TD  G    G++++  E KDVWDMK+++DN  LF MMEKT++ + ++++ EEP+  SGYIC F+ LE+K+VLLDEI+ + + PNK+ ++  E + LRD R L+E+  IE A +FIED PH ++W++LAE AL+KLDL+TA+QAFVR   Y G+KFVK+L  LQ+ ++K AE++ YFGR+EEAE  ++ +DR DL I +   +GDW RVLQL+K+G+  A D+ + +A NAIG  + D+  W  AV Y+ +GR  E L ECYY LEDY GLE LA  LPEN+ LL EIA++FV  GMCEQAV  ++K DQ K+A+D C+ LN W  A++LAKN +M  I  +L RYA  LL+    + A+ELYR+A  F +AAK++ K+ ++EAK      ++KK+ VL  LLIEQ+H+Q K   + ++K  K  +A SAL G+L EE    T SR  D  W  AEAYHF++LAQRQL++ + D A++TA  L DYED+I   +IYSL+A+CA  +RAFGT SKAF KLE+L+S S ++K+    L  +IFTK++P D  R  E D L     G+ K+P C+ +G PIT+ QFWMC +CKH     E++ +  CPLCHSP
Sbjct:    1 MFFYLSKKIAIPNNVKLKCISWNKDQGFIACGGEDGLLKVLKLETQTDDAKLRGLAAPSNLSMNQTLEGHSGSVQVVTWNEQYQKLTTSDQNGLIIVWMLYKGSWYEEMINNRNKSVVRSMSWNADGQKICIVYEDGAVIVGSVDGNRIWGKDLKGIQLCHVAWSADSKVLLFGMANGEIHIYDNQGNFIMKMKLNCLVNVTGAISIAGIHWYHGTEGYVEPDCPCLAICFDNGRCQIMRHENDQNPVLIDTGMYVVSIQWNHTGSVLAVAGSQKAVTQDKDVNTVQFYTPFGEHLGTLKVPGKQMSALSWEGGGLKIALAVDSFIYFANIRPDYKWGYCSNTVVYAYTRPDRPEYCVVFWDTKNNEKYVKYVKSLISVTTCGDFCILATKADENHPQ-FVLVLCNSIGTPLDPKYIDIVPLFVAMTKTHVIAASKEAFYTWQYRVAKKLTALEINQIMRSRKEGRERIYHVDDT------PSGSVDGVLDYSKAIQGTRDPICAITASDKTLIVGRESGTIQRYSLPNAGLIQKYSLNCRAYQLSLNCNSSRLAIIDISGVLTFFDLDARVTDSTGQQVTGELLK-LERKDVWDMKWAKDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGYICNFEVLEIKSVLLDEILKNPEHPNKDYIINFEIRSLRDSRALIEKVGIEDASQFIEDNPHPRLWRLLAEAALQKLDLQTAEQAFVRCKDYQGIKFVKRLGNLQSESMKQAEVAAYFGRFEEAERMYLDLDRRDLAIGLRLKLGDWFRVLQLLKTGSGDADDSLLEQAHNAIGDYFADRQKWLNAVQYYVRGRNQERLAECYYMLEDYEGLENLANSLPENNKLLPEIAQMFVRVGMCEQAVMAFLKCDQPKAAVDTCVHLNQWNKAVELAKNHNMKEIGSLLARYASHLLEKNKTLDAIELYRKANYFFDAAKLMFKIADEEAKKRTKPLRVKKLYVLSALLIEQYHEQMKNAQRGKVKG-KSSEATSALAGLLEEEVLSTT-SRFTDNAWRGAEAYHFFILAQRQLYEGYVDTALKTALHLRDYEDIIPAVEIYSLLALCACASRAFGTCSKAFIKLESLDSLSSEQKQQYEDLALEIFTKHTPKD-NRKSELDSLLE--GGEGKLPTCVATGSPITEYQFWMCSVCKHCVLAQEISNYTFCPLCHSP 1168          
BLAST of WD repeat-containing protein 35 vs. Ensembl Cavefish
Match: wdr35 (WD repeat domain 35 [Source:ZFIN;Acc:ZDB-GENE-060810-148])

HSP 1 Score: 1009.98 bits (2610), Expect = 0.000e+0
Identity = 540/1179 (45.80%), Postives = 779/1179 (66.07%), Query Frame = 2
Query:  131 MFVYLSKKISIPNDVQLTTLSWNTNKGYIACXXXXXXXXXXXXDPQVN-GNTRGIAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTIPD-KLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTD-ENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGLAVGQVTNKDFNLIQFYNPFGYHLRTLKVISTKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIYAFTKPEQCHYCVIFWNSKLDSFQTKYFYNLKAIISNGILCTIIYQADADSKQKYTLLVCNSIGTPIDTKELPF-EPLYQVMTESHVIVASQNIIYAWQFKKPENLLSIESQTKRKSTMDNFIHVDDISIQKDGPSSTENNLHSLMKKLSNDPICAICSARRTLIVATESGKMKQYSMPLMEYETTHKLRSKPFKLEINCTGNRVASIDFGGILSFFDLDKKYT---DENGASGQGQIVENFEYKDVWDMKFSEDNSQLFVMMEKTKLRIIQDVESEEPVVFSGYICQFKELEVKAVLLDEIMNDLDKPNKNNVVTLEAKILRDCRKLLEEGQIEKAKEFIEDRPHNKMWKMLAEHALEKLDLETADQAFVRYTYYPGVKFVXXXXXXXXXXXXXAEISIYFGRYEEAEHRFMAIDRPDLVIAMLKSIGDWSRVLQLMKSGNSASDAEMNE-AWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLERXXXXXXXXXXXXXXIAEIFVNAGMCEQAVFTYVKSDQLKSAIDCCIQLNHWQTAIDLAKNRDMTNINEMLTRYAKQLLDNKCYVQAVELYRRAGCFLEAAKIVQKLTEQEAKTSKNYSKLKKMSVLIGLLIEQHHDQNKIQAKARLKDIKGQDAASALNGMLHEEFHGVTESRLLDRPWHWAEAYHFYLLAQRQLFQKFFDAAMRTAKLLVDYEDVIAPRDIYSLIAICAIHNRAFGTSSKAFTKLETLNSFSEKEKENLISLTFKIFTKYSPIDPPRAREYDELENTFDGDSKIPICIVSGQPITQGQFWMCPICKHSAHEDEMNKHQNCPLCHS 3643
            M +    +I+IPN ++L  +SWN N+G+IACGG EGLLKVLKL+ Q +    +G+AAP+NL+MN+TLE H          +K  ++      GVI+   +F  +   EMINN N   V  + WN DGEKICI YEDG++I+GSVDGNRIWGK +   +L+HV WSPDS++L+FG+ +G+IHIYD  GN I  +  +C  +   P+ I GI WY G +GY+  +CPCLA+CY +G CQ+MR END+ P++I T +    + WN  G+VLAI G       +KD N++ FY PFG HLRTLKV   ++ + SW+   LR+ +AVDS IYFANIRP YKW YC++T++YA+T+P++  Y V+FW++K +    KY  +L ++ + G  C +  +AD DS  +Y L++CNSIGTP     L    PL+  MT++HVI AS+   YAWQ++  + L ++E     K+             +K+G       L S + + + DPIC I ++ +TLIV  ESG +++YS+P       + L  + ++L +NC  +R+A ID  G+L+FFD++ + +    E GAS        FE KDVWDMK++ DN  LF MMEKT++ + ++++ EEP+  SG+IC F++LE+K+VLLDEIM D ++PNK+ ++  E + LRD R L+E+  IE A +FIED PH ++W++LAE AL+KL+L+TA+QAFVR   Y G++FVK+L  LQ+  +K AE++ YF R+EEAE  ++ +DR DL I++   +GDW RVLQL+++G+  SD  + E A+NAIG  + D+  W  AV Y+ QGR  E L ECYY LEDY GLERLA  LPEN  LL +I ++FV  GMC+QAV +Y++  Q K+A+D C+ LN W  A++LAKN +M  I  +L++YA  LL+    ++AVELYR+A  FL+AAK++ K+++ EAK      ++KK+ VL  LL+E +H Q K   ++R K  K  +A SAL G+L EE    ++SR++D+ W  AEAYHF+LLAQRQL++   +A+M T   L DY+D+I   +IYSL+AIC+  NRAFGT S+AF KLE+L S S ++++    L  +IFTK+SP D  R    D  +++ +G  K+P CIV+G+ I+  QFWMC +CKH AHE E+  +  CPLCHS
Sbjct:    1 MLLCFHLQIAIPNSIRLKCVSWNKNQGFIACGGDEGLLKVLKLETQTDDAKLKGLAAPSNLSMNQTLEGHSG--------KKHMRV------GVILCLSVFVTALC-EMINNRNKSVVRSMSWNADGEKICIVYEDGAVIVGSVDGNRIWGKELKGIQLAHVAWSPDSKILLFGMANGEIHIYDNQGNFIMKMTLHCLMNVTGPLSIAGIHWYAGTEGYIEPDCPCLAICYDNGRCQVMRFENDDNPIVIETGMNVASIQWNHCGSVLAIAGSLRSSGGDKDMNVLNFYTPFGEHLRTLKVPGKQITAVSWEGGGLRIGLAVDSFIYFANIRPDYKWGYCSNTVVYAYTRPDRMEYSVVFWDTKNNEKFVKYVKSLISVTTCGDFCMLAAKAD-DSHPQYVLVLCNSIGTPWTPNTLTLVNPLFITMTKTHVIAASKEAFYAWQYRVAKKLTALEINQVAKT-------------RKEG-------LVSYLLQATRDPICCITASDKTLIVGRESGVLQKYSLPSFTLLQKYSLSYRAYQLSLNCNSSRLAIIDMTGVLTFFDIETRGSLGDAEEGASAGDP--SKFERKDVWDMKWANDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGFICNFEDLEIKSVLLDEIMKDPERPNKDYLLNFEIRSLRDSRALIEKVGIEDASQFIEDNPHPRLWRLLAEAALQKLELKTAEQAFVRCKDYQGIEFVKRLGNLQSEAMKQAEVAAYFSRFEEAERMYLDMDRRDLAISLRIKLGDWFRVLQLLRTGSGDSDDALQEQAYNAIGDYFADRQKWLNAVQYYLQGRNQERLTECYYMLEDYEGLERLASSLPENHKLLPDIGQMFVTVGMCDQAVSSYLRCTQPKAAVDACVHLNQWNKAVELAKNHNMKEIGPLLSKYASHLLEKNKTLEAVELYRKAHHFLDAAKLMFKISDDEAKKRTRPLRVKKLFVLAALLVEDYHAQVKNTQQSRAKG-KKSEATSALAGLL-EEDASTSDSRIVDKAWRGAEAYHFFLLAQRQLYEGKVEASMNTVLHLRDYDDIIPAEEIYSLLAICSSANRAFGTCSRAFVKLESLESLSSEQRQLYEDLALEIFTKHSPKD-NRKSHMDSTDDSTEG--KLPTCIVTGRSISDYQFWMCSVCKHCAHEQEITNYNFCPLCHS 1136          
BLAST of WD repeat-containing protein 35 vs. Ensembl Cavefish
Match: tulp4b (TUB like protein 4b [Source:ZFIN;Acc:ZDB-GENE-130530-708])

HSP 1 Score: 120.939 bits (302), Expect = 4.276e-27
Identity = 85/323 (26.32%), Postives = 146/323 (45.20%), Query Frame = 2
Query:  269 VNGNTRGIAAPTNLT------------MNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTI--PDKLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTDENPIKIVGIEWYKGD-------------------KGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGLAVGQVTNKDF-------NLIQFYNPFGYHLRTLKVISTK-LHSCSWDNESLRLAIAVDSSIYFANI 1114
              GN RG+   T  +            +N  L  H S +  + WNE F K+ + D  G I VWI ++  W  E++N+  + +V+   W+ DG +  IAY DG +++GSV G R W   I    +++   W+PD + ++FG  DGQ+ + D  G  +  +  + +       IVG+ W   D                   +G   K  P L V + SG   +M N +D  P +I + L+   + W   G +LA+ G+    + ++          L++FYN  G H+ TL+  + + + +  W +   RL +A   ++Y   +
Sbjct:   47 ATGNARGVVGVTFTSSHCRRDRNTPQRINFNLRGHNSEVVLVRWNEPFQKLATCDMEGGIFVWIQYEGRWSVELVNDRGA-QVSDFTWSHDGTQALIAYRDGFVLVGSVSGQRHWSSEINLESQITCGIWTPDDQQVLFGTADGQVIVMDCHGRMLAHVLLHESDG-----IVGMSWNCPDFLVEDSTESDTDTDENAQSQGRNVK--PLLTVSFISGDISLMNNYDDLSPHVIRSGLKDVEVQWCSQGDLLAVAGMERHGLPSESACASIMRNALVKFYNVQGEHIYTLETPAQRPITTICWGHRDSRLFLACGPALYVVRV 361          
BLAST of WD repeat-containing protein 35 vs. Ensembl Sea Lamprey
Match: wdr35 (WD repeat domain 35 [Source:ZFIN;Acc:ZDB-GENE-060810-148])

HSP 1 Score: 464.151 bits (1193), Expect = 3.411e-152
Identity = 219/454 (48.24%), Postives = 313/454 (68.94%), Query Frame = 2
Query:  131 MFVYLSKKISIPNDVQLTTLSWNTNKGYIACXXXXXXXXXXXXDPQV--NGNTRGIAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTIPD-KLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTDENPI-KIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGLAVGQVTNKDFNLIQFYNPFGYHLRTLKVISTKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIYAFTKPEQCHYCVIFWNSKLDSFQTKYFYNLKAIISNGILCTIIYQADADSKQKYTLLVCNSIGTPIDTKELPFEPLYQVMTESHVIVASQNIIYAWQFKKPENLLSI 1480
            MFVYLSKKISIPN  +L  ++WN   GYIACGG +GLLK+LKL+ Q   +   +G+AAP+NL++N+T+E H   +  + WNE + K+TS+D++G+IIVW+L+K  W++EMINN N   V  + WN DG+KICI YEDG++I+GSVDGNRIWGK +   +L H  WSPD R L+FG+ +G++HIYD  GN +  +   C  +   +  I G+ WY G +G++   CPCLA+C+ +G  QIMR+ENDE PVLI+  +    + WN  G+VLA+ G        K+FNL+QFY PFG HLR+LK+    L + +W+   LR+A+ VDS +YFANIRP YKW YC++T++YA+TKPE+  YCV+FW++K      KY  +L ++ + G  C +  +A+ D++ +Y L++CNSIGTP D+K +  EPLY  MT SHVI AS+N  Y WQ++  + +  +
Sbjct:    1 MFVYLSKKISIPNSTKLRCVAWNKELGYIACGGEDGLLKILKLESQTGEDAKLKGLAAPSNLSLNQTMEGHSGAVQVLAWNEHYQKLTSSDQNGLIIVWMLYKGLWYEEMINNRNKSMVRSMCWNLDGQKICIVYEDGAVIVGSVDGNRIWGKELKGIQLCHAAWSPDGRTLLFGMANGEVHIYDNTGNFVAKMSLQCLAEATGVVSIAGLHWYDGREGFVDPGCPCLAICFDNGRFQIMRHENDEKPVLIDAGMTVMSIQWNHCGSVLAVAGSQRAYGQEKEFNLVQFYTPFGEHLRSLKMPGKHLSALAWEGGGLRIALGVDSFLYFANIRPDYKWGYCSNTVVYAYTKPERTEYCVVFWDTKHSEKTMKYVRSLLSVTACGDYCVLATRAE-DTQAQYVLVLCNSIGTPQDSKYIDIEPLYVAMTHSHVIAASKNAFYVWQYRVAKKITGL 453          
BLAST of WD repeat-containing protein 35 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006604.1 (pep scaffold:Pmarinus_7.0:GL480314:40:7316:-1 gene:ENSPMAG00000005966.1 transcript:ENSPMAT00000006604.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.0485 bits (227), Expect = 1.604e-20
Identity = 64/219 (29.22%), Postives = 100/219 (45.66%), Query Frame = 2
Query:  299 PTNLTMNETLEEHKSTLTKI--TWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTIPDKLSHV---EWSPDSRLLIFGLLDGQIHIYDGGGNKIGPL---------------KNYCTTDENPIKIVGIEWYKGDKGYMCKNCP------CLAVCYSSGCCQIMRNENDEYPVLINT 877
            PT   +N  L  H S   KI   WNE + K+ + D  G I VWIL++  W  E++N+  + +V+   W+ DG +  I+Y DG +++GSV G R W   I    SH+    W+PD + ++FG  DGQ+ I D  G  +  +                ++   D +  +  G E  + D      + P       L V + SG   +M   +D  P L+ T
Sbjct:   70 PTPQRVNFNLRGHNSEELKILVVWNEPYQKLATCDADGGIFVWILYEGRWSVELVNDRGA-QVSDFTWSHDGTQALISYRDGFVLVGSVSGQRHWSSEISLDDSHILCGVWTPDDQQVLFGTSDGQV-IMDCHGRMLAQVVLHEFDSVQALTWNCPDFLVEDSSESESDGDERIQPDGPSGEWSAPLQGPRTLLTVMFGSGDVGLMNKYDDMTPTLVKT 286          
BLAST of WD repeat-containing protein 35 vs. Ensembl Nematostella
Match: EDO46375 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQI9])

HSP 1 Score: 973.385 bits (2515), Expect = 0.000e+0
Identity = 519/1133 (45.81%), Postives = 738/1133 (65.14%), Query Frame = 2
Query:  131 MFVYLSKKISIPNDVQLTTLSWNTNKGYIACXXXXXXXXXXXXDPQVNGNTR--GIAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTIPD-KLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTD-ENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGLAVGQVTNKDFNLIQFYNPFGYHLRTLKVISTKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIYAFTKPEQCHYCVIFWNSKLDSFQTKYFYNLKAIISNGILCTIIYQADADSKQKYTLLVCNSIGTPIDTKELPFEPLYQVMTESHVIVASQNIIYAWQFKKPENLLSIESQ--TKRKSTMDNFIHVDDISIQKDGPSSTENNLHSLMKKL--SNDPICAICSARRTLIVATESGKMKQYSMPLMEYETTHKLRSKPFKLEINCTGNRVASIDFGGILSFFDLDKKYTDENGASGQGQIVENFEYKDVWDMKFSEDNSQLFVMMEKTKLRIIQDVESEEPVVFSGYICQFKELEVKAVLLDEIMNDLDKPNKNNVVTLEAKILRDCRKLLEEGQIEKAKEFIEDRPHNKMWKMLAEHALEKLDLETADQAFVRYTYYPGVKFVXXXXXXXXXXXXXAEISIYFGRYEEAEHRFMAIDRPDLVIAMLKSIGDWSRVLQLMKSGNSASDAEMNE-AWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLERXXXXXXXXXXXXXXIAEIFVNAGMCEQAVFTYVKSDQLKSAIDCCIQLNHWQTAIDLAKNRDMTNINEMLTRYAKQLLDNKCYVQAVELYRRAGCFLEAAKIVQKLTEQEAKTSKNYSKLKKMSVLIGLLIEQHHDQNKIQAKARLKDIKGQD------AASALNGMLHEEFHGVTESRLLDRPWHWAEAYHFYLLAQRQLFQKFFDAAMRTAKLLVDYEDVIAPRDIYSLIAICAIHNRAFGTSSKAFTKLETLNSFSEKEKENLISLTFKIFTKYSPIDPPRAREYD 3484
            MF+YLSKKI+IPN+ +L  L+WN  +GYIACGG EGLLKVLKL+ Q   +++  G+AAP+NL+MN+TLE H   +  +TWNE+F K+T++D+ G+IIVWIL+K SW++EMINN N   V  +KWN DG+KICI YEDG++I+GSVDGNRIWGK +   +LS+VEWSPD + +IFG+ +G++ I+D  GN    L  +C T+    ++I GI WY G  GY   + PCLA+C+ +G  QIMR+E DE PVLI+T +    + WN NG+VLA+ G       +KD N++QFY PFG HLRTLKV   ++ +  W+  SLR+A+AVDS IYFANIRP+YKW Y ++T++YAF KP++  +CV+FW++K      KY  NL +I + G  C +  +AD D+  +Y L++CN+IGTP+D+K +  EPL+  MT SHV+ AS+   Y WQ++ P+ L ++E Q  ++RK   +   H+DD+      PS     +  + K L  + DPIC  C++ + LIV  ESG + +YS+P +  +  H L  +P +L +NC+ +R+A ID  G+L+FFDL                   FE KDVWDMK+++DNS+LF MMEKT++ I ++++ EEP++ SGYICQF +LEVKAVLLDEIM    K   ++V                                    ++LAE +LE+LDLE AD+AFVR   Y G++FVK+L KL N N K AE++ YF R+EEAE  ++ +DR DL + +   +GDW RV+QL+K+G +  D +M E AWNAIG  Y D+  W  AV Y+ QGR  E L ECYY LEDY+GLE ++  LPEN PL +EIAE+F   GMCEQAV +Y K++++K AIDCC+QLN W  AI LAK  D+  I+++L +YA  LL+    + A+ELYR+A  F++AAK++ KL ++      N  + KK+ VL  LL+E++H+  K   ++ +K   G+D      A SAL G+L E+     + +     W W  AYHF+LLAQRQL++   DA+M+TA  L +YEDV+    IYSL+A+ +  N+ FG+ SKAF KLE L++ +E++++    L  +IFTK+SP D   +RE D
Sbjct:    1 MFIYLSKKIAIPNNTRLKCLAWNREQGYIACGGEEGLLKVLKLETQQGKDSKLKGLAAPSNLSMNQTLEGHTGAVQVVTWNEQFQKLTTSDQYGLIIVWILYKGSWYEEMINNRNRSVVRDMKWNADGQKICIVYEDGAVIVGSVDGNRIWGKELKGVQLSNVEWSPDGKNIIFGMANGEVQIFDNQGNFCTKLTLFCLTNVTGAVRIAGINWYSGADGYSDADIPCLAICFDNGRMQIMRHELDESPVLIDTSMMVVRIQWNSNGSVLAVAGTQRALAQDKDINVVQFYTPFGEHLRTLKVPGKQITAACWEGGSLRIALAVDSFIYFANIRPNYKWGYFSNTVVYAFNKPDRVEHCVVFWDTKNGEKFVKYVRNLLSITACGEHCILATKAD-DATGQYVLVLCNAIGTPLDSKYIELEPLFVAMTRSHVVAASKEAFYTWQYRSPKKLTALEMQVPSRRKDVRERMFHIDDV------PSGAGEGIKDVRKALAPTQDPICCACASEKMLIVGRESGTVHRYSLPKLALDMKHVLNCRPHQLSLNCSSSRLAIIDISGVLTFFDL-------------------FERKDVWDMKWADDNSELFAMMEKTRMYIFRNLDPEEPILSSGYICQFNDLEVKAVLLDEIM----KVRSSSV------------------------------------RLLAESSLERLDLEVADKAFVRCQDYQGIRFVKRLIKLDNENKKKAEVAAYFKRFEEAERLYLEMDRRDLAVDLRLKLGDWFRVVQLLKTGGAGGDDQMLEQAWNAIGDYYADRQKWQNAVTYYVQGRNQERLAECYYMLEDYAGLETMSSNLPENHPLHAEIAEMFKTVGMCEQAVASYSKTNKIKEAIDCCVQLNEWDLAIQLAKAHDVKEIDKLLAKYASHLLEKNKTLNAIELYRKANHFIDAAKLLFKLAKETCDPRTNPMRGKKLYVLAALLVEEYHEHVK---QSSMKTAGGKDKRNKREAISALAGLLEEDSWQRRKVK-----W-WIRAYHFFLLAQRQLYEGAIDASMKTALHLREYEDVMDASCIYSLLALVSCANKCFGSCSKAFIKLELLDNVTEEQRKGYEELALEIFTKHSPKD---SREPD 1055          
BLAST of WD repeat-containing protein 35 vs. Ensembl Nematostella
Match: EDO26872 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAU5])

HSP 1 Score: 119.783 bits (299), Expect = 1.827e-31
Identity = 58/120 (48.33%), Postives = 84/120 (70.00%), Query Frame = 2
Query: 3101 SALNGMLHEEFHGVTESRLLDRPWHWAEAYHFYLLAQRQLFQKFFDAAMRTAKLLVDYEDVIAPRDIYSLIAICAIHNRAFGTSSKAFTKLETLNSFSEKEKENLISLTFKIFTKYSPID 3460
            SAL G+L E+     ES+++D  W  AEAYHF+LLAQRQL++   DA+M+TA  L +YEDV+    IYSL+A+ +  N+ FG+ SKAF KLE L++ +E++++    L  +IFTK+SP D
Sbjct:    3 SALAGLLEEDSMATEESKVVDNAWRGAEAYHFFLLAQRQLYEGAIDASMKTALHLREYEDVMDASCIYSLLALVSCANKCFGSCSKAFIKLELLDNVTEEQRKGYEELALEIFTKHSPKD 122          
BLAST of WD repeat-containing protein 35 vs. Ensembl Nematostella
Match: EDO30415 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0U7])

HSP 1 Score: 124.02 bits (310), Expect = 2.274e-31
Identity = 98/276 (35.51%), Postives = 141/276 (51.09%), Query Frame = 2
Query: 2489 MNEAWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLERXXXXXXXXXXXXXXIAEIFVNAGMCEQAVFTYVK--------------SDQLKSAIDCCIQLNHW---QTAIDLAKNRDMTNINEMLTRYAKQLLDNKCY----VQAVELYRRAGCFLEAAKIVQKLTEQEAKTSKNYSKLKKMSVLIGLLIEQHHDQNKIQAKARLKDIKGQDAASALNGMLHEEFHGVTESRLLDRPWHWAEAYHFYLLAQRQLFQKFFDAAMRT 3253
            + +AWNAIG  Y D+  W  AV Y+ QGR  E L ECYY LEDY+GLE ++  LPEN PL +EIAE+F   GMCEQAV +Y K                +L       ++  H    Q+++  A  +D  N      R A+Q +  + Y    +   +LY   G    + K V++  E   ++S   +  K               +NK +A+  +     Q+A SAL G+L E+     ES+++D  W  AEAYHF+LLAQRQL++   DA+M+T
Sbjct:    2 LEQAWNAIGDYYADRQKWQNAVTYYVQGRNQERLAECYYMLEDYAGLETMSSNLPENHPLHAEIAEMFKTVGMCEQAVASYSKLAKETCDPRTNPMRGKKLYVLAALLVEEYHEHVKQSSMKTAGGKDKRN-----KREAEQCIYQEAYHFFLLAQRQLYE--GAIDASMKTVEEYHEHVKQSSMKTAGGKD-------------KRNKREAEQCIY----QEAISALAGLLEEDSMATEESKVVDNAWRGAEAYHFFLLAQRQLYEGAIDASMKT 253          
BLAST of WD repeat-containing protein 35 vs. Ensembl Medaka
Match: wdr35 (WD repeat domain 35 [Source:NCBI gene;Acc:101161686])

HSP 1 Score: 1079.7 bits (2791), Expect = 0.000e+0
Identity = 544/1190 (45.71%), Postives = 792/1190 (66.55%), Query Frame = 2
Query:  131 MFVYLSKKISIPNDVQLTTLSWNTNKGYIACXXXXXXXXXXXXDPQVNG-NTRGIAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTIP-DKLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTDENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGLAVGQVTNKDFNLIQFYNPFGYHLRTLKVISTKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIYAFTKPEQCHYCVIFWNSKLDSFQTKYFYNLKAIISNGILCTIIYQAD-----------ADSKQKYTLLVCNSIGTPIDTKELPFEPLYQVMTESHVIVASQNIIYAWQFKKPENLLSI---ESQTKRKSTMDNFIHVDDISIQKDGPSSTENNLHSLMKKLSN--DPICAICSARRTLIVATESGKMKQYSMPLMEYETTHKLRSKPFKLEINCTGNRVASIDFGGILSFFDLDKKYTDENGASGQGQIVENFEYKDVWDMKFSEDNSQLFVMMEKTKLRIIQDVESEEPVVFSGYICQFKELEVKAVLLDEIMNDLDKPNKNNVVTLEAKILRDCRKLLEEGQIEKAKEFIEDRPHNKMWKMLAEHALEKLDLETADQAFVRYTYYPGVKFVXXXXXXXXXXXXXAEISIYFGRYEEAEHRFMAIDRPDLVIAMLKSIGDWSRVLQLMKSGNSA-SDAEMNEAWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLERXXXXXXXXXXXXXXIAEIFVNAGMCEQAVFTYVKSDQLKSAIDCCIQLNHWQTAIDLAKNRDMTNINEMLTRYAKQLLDNKCYVQAVELYRRAGCFLEAAKIVQKLTEQEAKTSKNYSKLKKMSVLIGLLIEQHHDQNKIQAKARLKDIKGQDAASALNGMLHEEFHGVTESRLLDRPWHWAEAYHFYLLAQRQLFQKFFDAAMRTAKLLVDYEDVIAPRDIYSLIAICAIHNRAFGTSSKAFTKLETLNSFSEKEKENLISLTFKIFTKYSPIDPPRAREYDELENTFDGDSKIPICIVSGQPITQGQFWMCPICKHSAHEDEMNKHQNCPLCHS 3643
            MF+YLSKKI+IPN++ L  +SWN ++G IACGG +GLLKVLKL+ Q +    +G+AAP+NL+MN+TLE H+  +  +TWNE+++K+T++D++G+IIVW+L+K +W++EMINN N   V  + WN DG+KICI YEDG++I+GSVDGNRIWGK +   +L+HV WSPDS++L+FG+  G++HIYD  GN I  +   C      + I GI+WY G +GY+  +CPCLA+C+ +G CQIMR END+ PV I+T +    + WN  G+VLA+ G       +K+FN++QFY PFG HLRTLKV   ++   +W+   LR+A+AVDS IYFANIRP YKW YC  T++YA+TKPE+  YCV+FW +K +    KY  +L ++ ++G  C +  +AD             S  +Y L++CNSIGTP+D+K +  EPL+  MT++HVI AS+   Y WQ++  + L ++   +    +K   +N  H+D        PS T + +    K  ++  DPIC I +  +TLIV  ESG + +YS+P +     +   ++ + L +NC  +R+A ID  G+++  DLD     + G +        FE KDVWDMK++ DN  LF MMEKT++ + ++++ EEP+  SGYIC F++LE+K+VLLDEIM + +KPNK+N++  E + LRD R L+E   IE A +FIED PH ++W++LAE AL+KLDL+TA+QAFV      G++FVK+L  L +  +K AE++ YFGR+EEA+  ++ +DR DL I +   +GDW +V+QL+KSG+ A  DA + +A+NAIG  + D+  W  AV Y+ QG   E L ECYY LEDY GLERLA  LPEN  LLS+I E++   GMCEQAV  Y+  +Q ++AID C+ LN W  A++LA+  +M  I  +L++YA  LL+    ++AVELYR+A  FL+AAK++ K+ E EAK   N  ++KK+ VL   L+E + +Q K   +++ K  K +  +SAL G+L  +    +E+ ++D  W  AEAYHF+LLAQRQL+    + AMRTA  L +YED+I   +IYSL+A+CA  +RAFGT S+AF KLE+L   S ++++    L  +IFTK++P D  R    D  +++ D   K+P CIV+G PI + QFWMC +CKH A E E++K+  CPLCH+
Sbjct:    1 MFIYLSKKIAIPNNIHLKCVSWNKDQGCIACGGDDGLLKVLKLETQSDDVRFKGLAAPSNLSMNQTLEGHRGAVQVVTWNEQYEKLTTSDQNGLIIVWMLYKGAWYEEMINNRNKSVVRSMSWNADGQKICIVYEDGAVIVGSVDGNRIWGKELKGSQLAHVAWSPDSKILLFGMASGEVHIYDNQGNFIMKMAIGCLVAAGSVSIAGIQWYAGTRGYVRPDCPCLAICFDNGRCQIMRYENDDNPVCIDTLMNVVSIQWNQCGSVLAVAGFLRASTKDKEFNVVQFYTPFGEHLRTLKVPGKQMSGVAWEGGGLRIALAVDSYIYFANIRPDYKWGYCCSTVVYAYTKPERQEYCVVFWETKNNEKFVKYVKSLLSVTTSGDFCILASKADETQLQEDAGLETGSSARYVLILCNSIGTPLDSKYIDIEPLFVTMTKTHVIAASKEAFYLWQYRVAKKLTAMGINQVARTKKGGKENVYHIDI------HPSGTGDAISDFSKAFTSTQDPICCITATDKTLIVGRESGSIHRYSLPTVALLQKYTSSNRAYYLSLNCNSSRLAIIDIAGVMTLLDLDVSAASDGGTNRGSADSSKFERKDVWDMKWANDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGYICNFEDLEIKSVLLDEIMKNPEKPNKDNLINFEIRSLRDSRALIENVGIEDASQFIEDNPHPRLWRLLAEAALQKLDLKTAEQAFVHCRDNQGIEFVKRLGNLHSEPMKKAEVAAYFGRFEEADSMYLEMDRSDLAINLRIKLGDWFKVMQLLKSGSGACDDALLQQAYNAIGDYFADRQKWVNAVQYYQQGLNQERLAECYYMLEDYPGLERLATELPENHRLLSDIGEMYATVGMCEQAVNAYLNCNQTRAAIDTCVHLNQWNKAVELARTHNMKEIKSLLSKYASHLLEKNKVLEAVELYRKAHHFLDAAKLMFKIAEDEAKRKSNPLRVKKLYVLAAQLVENYQEQVKTSQQSKTKGRKSE-VSSALAGLLEVDACS-SETGIVDSAWRGAEAYHFFLLAQRQLYAGLMENAMRTALHLREYEDIIPAVEIYSLLAVCAASSRAFGTCSRAFIKLESLEGQSPEQQQLYKDLALEIFTKHAPKD-SRMVGADLSDSSED---KLPTCIVTGLPIQEYQFWMCGVCKHCALEQEISKYNTCPLCHT 1178          
BLAST of WD repeat-containing protein 35 vs. Ensembl Medaka
Match: wdr35 (WD repeat domain 35 [Source:NCBI gene;Acc:101161686])

HSP 1 Score: 1056.97 bits (2732), Expect = 0.000e+0
Identity = 530/1169 (45.34%), Postives = 774/1169 (66.21%), Query Frame = 2
Query:  146 SKKISIPNDVQLTTLSWNTNKGYIACXXXXXXXXXXXXDPQVNG-NTRGIAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTIP-DKLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTDENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGLAVGQVTNKDFNLIQFYNPFGYHLRTLKVISTKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIYAFTKPEQCHYCVIFWNSKLDSFQTKYFYNLKAIISNGILCTIIYQADADSKQKYTLLVCNSIGTPIDTKELPFEPLYQVMTESHVIVASQNIIYAWQFKKPENLLSIESQTKRKSTMDNFIHVDDISIQKDGPSSTENNLHSLMKKLSNDPICAICSARRTLIVATESGKMKQYSMPLMEYETTHKLRSKPFKLEINCTGNRVASIDFGGILSFFDLDKKYTDENGASGQGQIVENFEYKDVWDMKFSEDNSQLFVMMEKTKLRIIQDVESEEPVVFSGYICQFKELEVKAVLLDEIMNDLDKPNKNNVVTLEAKILRDCRKLLEEGQIEKAKEFIEDRPHNKMWKMLAEHALEKLDLETADQAFVRYTYYPGVKFVXXXXXXXXXXXXXAEISIYFGRYEEAEHRFMAIDRPDLVIAMLKSIGDWSRVLQLMKSGNSA-SDAEMNEAWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLERXXXXXXXXXXXXXXIAEIFVNAGMCEQAVFTYVKSDQLKSAIDCCIQLNHWQTAIDLAKNRDMTNINEMLTRYAKQLLDNKCYVQAVELYRRAGCFLEAAKIVQKLTEQEAKTSKNYSKLKKMSVLIGLLIEQHHDQNKIQAKARLKDIKGQDAASALNGMLHEEFHGVTESRLLDRPWHWAEAYHFYLLAQRQLFQKFFDAAMRTAKLLVDYEDVIAPRDIYSLIAICAIHNRAFGTSSKAFTKLETLNSFSEKEKENLISLTFKIFTKYSPIDPPRAREYDELENTFDGDSKIPICIVSGQPITQGQFWMCPICKHSAHEDEMNKHQNCPLCHS 3643
            S +I+IPN++ L  +SWN ++G IACGG +GLLKVLKL+ Q +    +G+AAP+NL+MN+TLE H+  +  +TWNE+++K+T++D++G+IIVW+L+K +W++EMINN N   V  + WN DG+KICI YEDG++I+GSVDGNRIWGK +   +L+HV WSPDS++L+FG+  G++HIYD  GN I  +   C      + I GI+WY G +GY+  +CPCLA+C+ +G CQIMR END+ PV I+T +    + WN  G+VLA+ G       +K+FN++QFY PFG HLRTLKV   ++   +W+   LR+A+AVDS IYFANIRP YKW YC  T++YA+TKPE+  YCV+FW +K +    KY  +L ++ ++G  C +  +AD +++ +Y L++CNSIGTP+D+K +  EPL+  MT++HVI AS+   Y WQ++  + L ++               ++ +S Q                    DPIC I +  +TLIV  ESG + +YS+P +     +   ++ + L +NC  +R+A ID  G+++  DLD     + G +        FE KDVWDMK++ DN  LF MMEKT++ + ++++ EEP+  SGYIC F++LE+K+VLLDEIM + +KPNK+N++  E + LRD R L+E   IE A +FIED PH ++W++LAE AL+KLDL+TA+QAFV      G++FVK+L  L +  +K AE++ YFGR+EEA+  ++ +DR DL I +   +GDW +V+QL+KSG+ A  DA + +A+NAIG  + D+  W  AV Y+ QG   E L ECYY LEDY GLERLA  LPEN  LLS+I E++   GMCEQAV  Y+  +Q ++AID C+ LN W  A++LA+  +M  I  +L++YA  LL+    ++AVELYR+A  FL+AAK++ K+ E EAK   N  ++KK+ VL   L+E + +Q K   +++ K  K +  +SAL G+L  +    +E+ ++D  W  AEAYHF+LLAQRQL+    + AMRTA  L +YED+I   +IYSL+A+CA  +RAFGT S+AF KLE+L   S ++++    L  +IFTK++P D           N F  + K+P CIV+G PI + QFWMC +CKH A E E++K+  CPLCH+
Sbjct:   26 SVQIAIPNNIHLKCVSWNKDQGCIACGGDDGLLKVLKLETQSDDVRFKGLAAPSNLSMNQTLEGHRGAVQVVTWNEQYEKLTTSDQNGLIIVWMLYKGAWYEEMINNRNKSVVRSMSWNADGQKICIVYEDGAVIVGSVDGNRIWGKELKGSQLAHVAWSPDSKILLFGMASGEVHIYDNQGNFIMKMAIGCLVAAGSVSIAGIQWYAGTRGYVRPDCPCLAICFDNGRCQIMRYENDDNPVCIDTLMNVVSIQWNQCGSVLAVAGFLRASTKDKEFNVVQFYTPFGEHLRTLKVPGKQMSGVAWEGGGLRIALAVDSYIYFANIRPDYKWGYCCSTVVYAYTKPERQEYCVVFWETKNNEKFVKYVKSLLSVTTSGDFCILASKAD-ETQLQYVLILCNSIGTPLDSKYIDIEPLFVTMTKTHVIAASKEAFYLWQYRVAKKLTAM--------------GINQVSTQ--------------------DPICCITATDKTLIVGRESGSIHRYSLPTVALLQKYTSSNRAYYLSLNCNSSRLAIIDIAGVMTLLDLDVSAASDGGTNRGSADSSKFERKDVWDMKWANDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGYICNFEDLEIKSVLLDEIMKNPEKPNKDNLINFEIRSLRDSRALIENVGIEDASQFIEDNPHPRLWRLLAEAALQKLDLKTAEQAFVHCRDNQGIEFVKRLGNLHSEPMKKAEVAAYFGRFEEADSMYLEMDRSDLAINLRIKLGDWFKVMQLLKSGSGACDDALLQQAYNAIGDYFADRQKWVNAVQYYQQGLNQERLAECYYMLEDYPGLERLATELPENHRLLSDIGEMYATVGMCEQAVNAYLNCNQTRAAIDTCVHLNQWNKAVELARTHNMKEIKSLLSKYASHLLEKNKVLEAVELYRKAHHFLDAAKLMFKIAEDEAKRKSNPLRVKKLYVLAAQLVENYQEQVKTSQQSKTKGRKSE-VSSALAGLLEVDACS-SETGIVDSAWRGAEAYHFFLLAQRQLYAGLMENAMRTALHLREYEDIIPAVEIYSLLAVCAASSRAFGTCSRAFIKLESLEGQSPEQQQLYKDLALEIFTKHAPKDSL-------CFNLFSSEDKLPTCIVTGLPIQEYQFWMCGVCKHCALEQEISKYNTCPLCHT 1150          
BLAST of WD repeat-containing protein 35 vs. Ensembl Medaka
Match: wdr35 (WD repeat domain 35 [Source:NCBI gene;Acc:101161686])

HSP 1 Score: 1007.67 bits (2604), Expect = 0.000e+0
Identity = 519/1190 (43.61%), Postives = 762/1190 (64.03%), Query Frame = 2
Query:  131 MFVYLSKKISIPNDVQLTTLSWNTNKGYIACXXXXXXXXXXXXDPQVNG-NTRGIAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTIP-DKLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTDENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGLAVGQVTNKDFNLIQFYNPFGYHLRTLKVISTKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIYAFTKPEQCHYCVIFWNSKLDSFQTKYFYNLKAIISNGILCTIIYQAD-----------ADSKQKYTLLVCNSIGTPIDTKELPFEPLYQVMTESHVIVASQNIIYAWQFKKPENLLSI---ESQTKRKSTMDNFIHVDDISIQKDGPSSTENNLHSLMKKLSN--DPICAICSARRTLIVATESGKMKQYSMPLMEYETTHKLRSKPFKLEINCTGNRVASIDFGGILSFFDLDKKYTDENGASGQGQIVENFEYKDVWDMKFSEDNSQLFVMMEKTKLRIIQDVESEEPVVFSGYICQFKELEVKAVLLDEIMNDLDKPNKNNVVTLEAKILRDCRKLLEEGQIEKAKEFIEDRPHNKMWKMLAEHALEKLDLETADQAFVRYTYYPGVKFVXXXXXXXXXXXXXAEISIYFGRYEEAEHRFMAIDRPDLVIAMLKSIGDWSRVLQLMKSGNSA-SDAEMNEAWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLERXXXXXXXXXXXXXXIAEIFVNAGMCEQAVFTYVKSDQLKSAIDCCIQLNHWQTAIDLAKNRDMTNINEMLTRYAKQLLDNKCYVQAVELYRRAGCFLEAAKIVQKLTEQEAKTSKNYSKLKKMSVLIGLLIEQHHDQNKIQAKARLKDIKGQDAASALNGMLHEEFHGVTESRLLDRPWHWAEAYHFYLLAQRQLFQKFFDAAMRTAKLLVDYEDVIAPRDIYSLIAICAIHNRAFGTSSKAFTKLETLNSFSEKEKENLISLTFKIFTKYSPIDPPRAREYDELENTFDGDSKIPICIVSGQPITQGQFWMCPICKHSAHEDEMNKHQNCPLCHS 3643
            MF+YLSKKI+IPN++ L  +SWN ++G IACGG +GLLKVLKL+ Q +    +G+AAP+NL+MN+TLE H+  +  +TWNE+++K+T++D++G+IIVW+L+K +W++EMINN N   V  + WN DG+KICI YEDG++I+GSVDGNRIWGK +   +L+HV WSPDS++L+FG+  G++HIYD  GN I  +   C      + I GI+WY G +GY+  +CPCLA+C+ +G CQIMR END+ PV I+T +    + WN  G+VLA+ G       +K+FN++QFY PFG                                          +W YC  T++YA+TKPE+  YCV+FW +K +    KY  +L ++ ++G  C +  +AD             S  +Y L++CNSIGTP+D+K +  EPL+  MT++HVI AS+   Y WQ++  + L ++   +    +K   +N  H+D        PS T + +    K  ++  DPIC I +  +TLIV  ESG + +YS+P +     +   ++ + L +NC  +R+A ID  G+++  DLD     + G +        FE KDVWDMK++ DN  LF MMEKT++ + ++++ EEP+  SGYIC F++LE+K+VLLDEIM + +KPNK+N++  E + LRD R L+E   IE A +FIED PH ++W++LAE AL+KLDL+TA+QAFV      G++FVK+L  L +  +K AE++ YFGR+EEA+  ++ +DR DL I +   +GDW +V+QL+KSG+ A  DA + +A+NAIG  + D+  W  AV Y+ QG   E L ECYY LEDY GLERLA  LPEN  LLS+I E++   GMCEQAV  Y+  +Q ++AID C+ LN W  A++LA+  +M  I  +L++YA  LL+    ++AVELYR+A  FL+AAK++ K+ E EAK   N  ++KK+ VL   L+E + +Q K   +++ K  K +  +SAL G+L  +    +E+ ++D  W  AEAYHF+LLAQRQL+    + AMRTA  L +YED+I   +IYSL+A+CA  +RAFGT S+AF KLE+L   S ++++    L  +IFTK++P D  R    D  +++ D   K+P CIV+G PI + QFWMC +CKH A E E++K+  CPLCH+
Sbjct:    1 MFIYLSKKIAIPNNIHLKCVSWNKDQGCIACGGDDGLLKVLKLETQSDDVRFKGLAAPSNLSMNQTLEGHRGAVQVVTWNEQYEKLTTSDQNGLIIVWMLYKGAWYEEMINNRNKSVVRSMSWNADGQKICIVYEDGAVIVGSVDGNRIWGKELKGSQLAHVAWSPDSKILLFGMASGEVHIYDNQGNFIMKMAIGCLVAAGSVSIAGIQWYAGTRGYVRPDCPCLAICFDNGRCQIMRYENDDNPVCIDTLMNVVSIQWNQCGSVLAVAGFLRASTKDKEFNVVQFYTPFG------------------------------------------EWGYCCSTVVYAYTKPERQEYCVVFWETKNNEKFVKYVKSLLSVTTSGDFCILASKADETQLQEDAGLETGSSARYVLILCNSIGTPLDSKYIDIEPLFVTMTKTHVIAASKEAFYLWQYRVAKKLTAMGINQVARTKKGGKENVYHIDI------HPSGTGDAISDFSKAFTSTQDPICCITATDKTLIVGRESGSIHRYSLPTVALLQKYTSSNRAYYLSLNCNSSRLAIIDIAGVMTLLDLDVSAASDGGTNRGSADSSKFERKDVWDMKWANDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGYICNFEDLEIKSVLLDEIMKNPEKPNKDNLINFEIRSLRDSRALIENVGIEDASQFIEDNPHPRLWRLLAEAALQKLDLKTAEQAFVHCRDNQGIEFVKRLGNLHSEPMKKAEVAAYFGRFEEADSMYLEMDRSDLAINLRIKLGDWFKVMQLLKSGSGACDDALLQQAYNAIGDYFADRQKWVNAVQYYQQGLNQERLAECYYMLEDYPGLERLATELPENHRLLSDIGEMYATVGMCEQAVNAYLNCNQTRAAIDTCVHLNQWNKAVELARTHNMKEIKSLLSKYASHLLEKNKVLEAVELYRKAHHFLDAAKLMFKIAEDEAKRKSNPLRVKKLYVLAAQLVENYQEQVKTSQQSKTKGRKSE-VSSALAGLLEVDACS-SETGIVDSAWRGAEAYHFFLLAQRQLYAGLMENAMRTALHLREYEDIIPAVEIYSLLAVCAASSRAFGTCSRAFIKLESLEGQSPEQQQLYKDLALEIFTKHAPKD-SRMVGADLSDSSED---KLPTCIVTGLPIQEYQFWMCGVCKHCALEQEISKYNTCPLCHT 1136          
BLAST of WD repeat-containing protein 35 vs. Ensembl Medaka
Match: tulp4a (TUB like protein 4 [Source:NCBI gene;Acc:101163129])

HSP 1 Score: 121.324 bits (303), Expect = 3.542e-27
Identity = 83/316 (26.27%), Postives = 145/316 (45.89%), Query Frame = 2
Query:  275 GNTRGIAA------------PTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTI--PDKLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLK------------NYCT--TDENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGLAVGQVTNKDF-------NLIQFYNPFGYHLRTLKVISTK-LHSCSWDNESLRLAIAVDSSIYFANI 1114
            GN+RG+              P    +N  L  H S +  + WNE F K+ + D  G I VWI ++  W  E++N+  + +V+   W+ DG +  I+Y DG +++GSV G R W   I    +++   W+PD + ++FG  DGQ+ + D  G  +  +             NY +   +++       E Y   + +  K  P L V ++SG   +M N +D  P LI T L+   + W   G +LA+ G+    ++ +           ++FYN  G H+ TL   + + + +  W +   RL +A   ++Y   +
Sbjct:   49 GNSRGVVGVTFTSSHCRRDRPPLQRVNFNLRGHNSEVVLVRWNEPFQKLATCDTDGGIFVWIQYEGRWSVELVNDRGA-QVSDFTWSHDGTQALISYRDGFVLVGSVSGQRHWSSEINLESQITCGIWTPDDQQVLFGTADGQVIVMDCHGRMLAHILLHESDGIVNMSWNYPSFLVEDSSESDTDTEDYSPPQVHTHK--PLLTVSFTSGDLSLMNNYDDLSPTLIRTGLKDVVVQWCSQGDLLAVAGMERTPLSPEAACSLPVRNATVKFYNVQGEHIYTLDTPAQRPITTLCWGHRDSRLFLASGPALYVVRV 361          
BLAST of WD repeat-containing protein 35 vs. Ensembl Medaka
Match: tulp4a (TUB like protein 4 [Source:NCBI gene;Acc:101163129])

HSP 1 Score: 121.324 bits (303), Expect = 3.542e-27
Identity = 83/316 (26.27%), Postives = 145/316 (45.89%), Query Frame = 2
Query:  275 GNTRGIAA------------PTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTI--PDKLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLK------------NYCT--TDENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGLAVGQVTNKDF-------NLIQFYNPFGYHLRTLKVISTK-LHSCSWDNESLRLAIAVDSSIYFANI 1114
            GN+RG+              P    +N  L  H S +  + WNE F K+ + D  G I VWI ++  W  E++N+  + +V+   W+ DG +  I+Y DG +++GSV G R W   I    +++   W+PD + ++FG  DGQ+ + D  G  +  +             NY +   +++       E Y   + +  K  P L V ++SG   +M N +D  P LI T L+   + W   G +LA+ G+    ++ +           ++FYN  G H+ TL   + + + +  W +   RL +A   ++Y   +
Sbjct:   49 GNSRGVVGVTFTSSHCRRDRPPLQRVNFNLRGHNSEVVLVRWNEPFQKLATCDTDGGIFVWIQYEGRWSVELVNDRGA-QVSDFTWSHDGTQALISYRDGFVLVGSVSGQRHWSSEINLESQITCGIWTPDDQQVLFGTADGQVIVMDCHGRMLAHILLHESDGIVNMSWNYPSFLVEDSSESDTDTEDYSPPQVHTHK--PLLTVSFTSGDLSLMNNYDDLSPTLIRTGLKDVVVQWCSQGDLLAVAGMERTPLSPEAACSLPVRNATVKFYNVQGEHIYTLDTPAQRPITTLCWGHRDSRLFLASGPALYVVRV 361          
BLAST of WD repeat-containing protein 35 vs. Planmine SMEST
Match: SMESG000066519.1 (SMESG000066519.1)

HSP 1 Score: 2355.87 bits (6104), Expect = 0.000e+0
Identity = 1169/1173 (99.66%), Postives = 1172/1173 (99.91%), Query Frame = 2
Query:  131 MFVYLSKKISIPNDVQLTTLSWNTNKGYIACXXXXXXXXXXXXDPQVNGNTRGIAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTIPDKLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTDENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGLAVGQVTNKDFNLIQFYNPFGYHLRTLKVISTKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIYAFTKPEQCHYCVIFWNSKLDSFQTKYFYNLKAIISNGILCTIIYQADADSKQKYTLLVCNSIGTPIDTKELPFEPLYQVMTESHVIVASQNIIYAWQFKKPENLLSIESQTKRKSTMDNFIHVDDISIQKDGPSSTENNLHSLMKKLSNDPICAICSARRTLIVATESGKMKQYSMPLMEYETTHKLRSKPFKLEINCTGNRVASIDFGGILSFFDLDKKYTDENGASGQGQIVENFEYKDVWDMKFSEDNSQLFVMMEKTKLRIIQDVESEEPVVFSGYICQFKELEVKAVLLDEIMNDLDKPNKNNVVTLEAKILRDCRKLLEEGQIEKAKEFIEDRPHNKMWKMLAEHALEKLDLETADQAFVRYTYYPGVKFVXXXXXXXXXXXXXAEISIYFGRYEEAEHRFMAIDRPDLVIAMLKSIGDWSRVLQLMKSGNSASDAEMNEAWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLERXXXXXXXXXXXXXXIAEIFVNAGMCEQAVFTYVKSDQLKSAIDCCIQLNHWQTAIDLAKNRDMTNINEMLTRYAKQLLDNKCYVQAVELYRRAGCFLEAAKIVQKLTEQEAKTSKNYSKLKKMSVLIGLLIEQHHDQNKIQAKARLKDIKGQDAASALNGMLHEEFHGVTESRLLDRPWHWAEAYHFYLLAQRQLFQKFFDAAMRTAKLLVDYEDVIAPRDIYSLIAICAIHNRAFGTSSKAFTKLETLNSFSEKEKENLISLTFKIFTKYSPIDPPRAREYDELENTFDGDSKIPICIVSGQPITQGQFWMCPICKHSAHEDEMNKHQNCPLCHSPA 3649
            MFVYLSKKISIPNDVQLTTLSWNTNKGYIACGGVEGLLKVLKLDPQVNGNTRGIAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSN+HRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTIPDKLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTDENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGL VGQVTNKDFNLIQFYNPFGYHLRTLKVISTKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIYAFTKPEQCHYCVIFWNSKLDSFQTKYFYNLKAIISNGILCTIIYQADADSKQKYTLLVCNSIGTPIDTKELPFEPLYQVMTESHVIVASQNIIYAWQFKKPENLLSIESQTKRKSTMDNFIHVDDISIQKDGPSSTENNLHSLMKKLSNDPICAICS+RRTLIVATESGKMKQYSMPLMEYETTHKLRSKPFKLEINCTGNRVASIDFGGILSFFDLDKKYTDENGASGQGQIVENFEYKDVWDMKFSEDNSQLFVMMEKTKLRIIQDVESEEPVVFSGYICQFKELEVKAVLLDEIMNDLDKPNKNNVVTLEAKILRDCRKLLEEGQIEKAKEFIEDRPHNKMWKMLAEHALEKLDLETADQAFVRYTYYPGVKFVKKLQKLQNNNLKLAEISIYFGRYEEAEHRFMAIDRPDLVIAMLKSIGDWSRVLQLMKSGNSASDAEMNEAWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLERLAELLPENSPLLSEIAEIFVNAGMCEQAVFTYVKSDQLKSAIDCCIQLNHWQTAIDLAKNRDMTNINEMLTRYAKQLLDNKCYVQAVELYRRAGCFLEAAKIVQKLTEQEAKTSKNYSKLKKMSVLIGLLIEQHHDQNKIQAKARLKDIKGQDAASALNGMLHEEFHGVTESRLLDRPWHWAEAYHFYLLAQRQLFQKFFDAAMRTAKLLVDYEDVIAPRDIYSLIAICAIHNRAFGTSSKAFTKLETLNSFS+KEKENLISLTFKIFTKYSPIDPPRAREYDELENTFDGDSKIPICIVSGQPITQGQFWMCPICKHSAHEDEMNKHQNCPLCHSPA
Sbjct:    1 MFVYLSKKISIPNDVQLTTLSWNTNKGYIACGGVEGLLKVLKLDPQVNGNTRGIAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNAHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTIPDKLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTDENPIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTRLEAKCLAWNGNGTVLAIGGLPVGQVTNKDFNLIQFYNPFGYHLRTLKVISTKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIYAFTKPEQCHYCVIFWNSKLDSFQTKYFYNLKAIISNGILCTIIYQADADSKQKYTLLVCNSIGTPIDTKELPFEPLYQVMTESHVIVASQNIIYAWQFKKPENLLSIESQTKRKSTMDNFIHVDDISIQKDGPSSTENNLHSLMKKLSNDPICAICSSRRTLIVATESGKMKQYSMPLMEYETTHKLRSKPFKLEINCTGNRVASIDFGGILSFFDLDKKYTDENGASGQGQIVENFEYKDVWDMKFSEDNSQLFVMMEKTKLRIIQDVESEEPVVFSGYICQFKELEVKAVLLDEIMNDLDKPNKNNVVTLEAKILRDCRKLLEEGQIEKAKEFIEDRPHNKMWKMLAEHALEKLDLETADQAFVRYTYYPGVKFVKKLQKLQNNNLKLAEISIYFGRYEEAEHRFMAIDRPDLVIAMLKSIGDWSRVLQLMKSGNSASDAEMNEAWNAIGLQYFDKHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLERLAELLPENSPLLSEIAEIFVNAGMCEQAVFTYVKSDQLKSAIDCCIQLNHWQTAIDLAKNRDMTNINEMLTRYAKQLLDNKCYVQAVELYRRAGCFLEAAKIVQKLTEQEAKTSKNYSKLKKMSVLIGLLIEQHHDQNKIQAKARLKDIKGQDAASALNGMLHEEFHGVTESRLLDRPWHWAEAYHFYLLAQRQLFQKFFDAAMRTAKLLVDYEDVIAPRDIYSLIAICAIHNRAFGTSSKAFTKLETLNSFSDKEKENLISLTFKIFTKYSPIDPPRAREYDELENTFDGDSKIPICIVSGQPITQGQFWMCPICKHSAHEDEMNKHQNCPLCHSPA 1173          
BLAST of WD repeat-containing protein 35 vs. Planmine SMEST
Match: SMESG000001313.1 (SMESG000001313.1)

HSP 1 Score: 60.8474 bits (146), Expect = 6.156e-9
Identity = 37/131 (28.24%), Postives = 65/131 (49.62%), Query Frame = 2
Query:  197 NTNKGYIACXXXXXXXXXXXXDPQVNGNTRGIAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILFKNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWGKTI 589
            ++N G++ACG   G + + K   + + +T  I        N  L   K  +  + WN    K+ +   +G I+V+    N W  +++N   +H V   KW+    ++ I Y DG +IIGSV G+R+W + +
Sbjct:   28 HSNIGWLACGNKTGSVSITKTMIESDDSTESIPYELPARTNYNLRNSKVPINIVEWNPHHKKLATCSNTGSILVYHNVNNQWSIDLVN-ERAHAVEVFKWSRSTNQVMIGYTDGLLIIGSVSGHRLWHRMM 157          
The following BLAST results are available for this feature:
BLAST of WD repeat-containing protein 35 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WDR350.000e+048.01WD repeat domain 35 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR350.000e+047.61WD repeat domain 35 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR350.000e+047.71WD repeat domain 35 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR351.145e-10746.07WD repeat domain 35 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR353.367e-7547.15WD repeat domain 35 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of WD repeat-containing protein 35 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ifta-11.839e-13827.54IntraFlagellar Transport Associated [Source:UniPr... [more]
tub-22.689e-2027.48TUBby-related [Source:UniProtKB/TrEMBL;Acc:Q9BL53... [more]
back to top
BLAST of WD repeat-containing protein 35 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Oseg40.000e+039.13gene:FBgn0035264 transcript:FBtr0072797[more]
Oseg40.000e+039.13gene:FBgn0035264 transcript:FBtr0334077[more]
Tusp4.250e-2526.79gene:FBgn0039530 transcript:FBtr0335246[more]
Tusp4.365e-2526.79gene:FBgn0039530 transcript:FBtr0335245[more]
Tusp4.513e-2526.79gene:FBgn0039530 transcript:FBtr0302589[more]
back to top
BLAST of WD repeat-containing protein 35 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr350.000e+046.45WD repeat domain 35 [Source:ZFIN;Acc:ZDB-GENE-0608... [more]
wdr354.211e-5551.01WD repeat domain 35 [Source:ZFIN;Acc:ZDB-GENE-0608... [more]
tulp4a4.181e-2826.05TUB like protein 4a [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
tulp4a1.101e-2726.71TUB like protein 4a [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
tulp4b1.718e-2626.03TUB like protein 4b [Source:ZFIN;Acc:ZDB-GENE-1305... [more]
back to top
BLAST of WD repeat-containing protein 35 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WDR350.000e+047.65WD repeat domain 35 [Source:NCBI gene;Acc:10049637... [more]
WDR350.000e+047.91WD repeat domain 35 [Source:NCBI gene;Acc:10049637... [more]
WDR350.000e+047.32WD repeat domain 35 [Source:NCBI gene;Acc:10049637... [more]
WDR350.000e+047.79WD repeat domain 35 [Source:NCBI gene;Acc:10049637... [more]
tulp41.755e-2725.82B-cell receptor CD22-like [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of WD repeat-containing protein 35 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Wdr350.000e+047.37WD repeat domain 35 [Source:MGI Symbol;Acc:MGI:192... [more]
Wdr350.000e+046.97WD repeat domain 35 [Source:MGI Symbol;Acc:MGI:192... [more]
Wdr352.434e-4555.86WD repeat domain 35 [Source:MGI Symbol;Acc:MGI:192... [more]
Tulp42.350e-2524.70tubby like protein 4 [Source:MGI Symbol;Acc:MGI:19... [more]
back to top
BLAST of WD repeat-containing protein 35 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9P2L0|WDR35_HUMAN0.000e+047.61WD repeat-containing protein 35 OS=Homo sapiens OX... [more]
sp|A6N6J5|WDR35_RAT0.000e+047.37WD repeat-containing protein 35 OS=Rattus norvegic... [more]
sp|Q8BND3|WDR35_MOUSE0.000e+046.97WD repeat-containing protein 35 OS=Mus musculus OX... [more]
sp|Q9NRJ4|TULP4_HUMAN1.528e-2525.30Tubby-related protein 4 OS=Homo sapiens OX=9606 GN... [more]
sp|Q9JIL5|TULP4_MOUSE1.644e-2424.70Tubby-related protein 4 OS=Mus musculus OX=10090 G... [more]
back to top
BLAST of WD repeat-containing protein 35 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210QYN30.000e+049.03WD repeat-containing protein 35 OS=Mizuhopecten ye... [more]
K1R2H90.000e+049.12WD repeat-containing protein 35 OS=Crassostrea gig... [more]
R7U1T80.000e+047.47WD_REPEATS_REGION domain-containing protein OS=Cap... [more]
W5NKT80.000e+047.58WD repeat-containing protein 35 OS=Lepisosteus ocu... [more]
A0A2Y9E5U90.000e+048.09WD repeat-containing protein 35 OS=Trichechus mana... [more]
back to top
BLAST of WD repeat-containing protein 35 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
wdr350.000e+045.80WD repeat domain 35 [Source:ZFIN;Acc:ZDB-GENE-0608... [more]
tulp4b4.276e-2726.32TUB like protein 4b [Source:ZFIN;Acc:ZDB-GENE-1305... [more]
back to top
BLAST of WD repeat-containing protein 35 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
wdr353.411e-15248.24WD repeat domain 35 [Source:ZFIN;Acc:ZDB-GENE-0608... [more]
ENSPMAT00000006604.11.604e-2029.22pep scaffold:Pmarinus_7.0:GL480314:40:7316:-1 gene... [more]
back to top
BLAST of WD repeat-containing protein 35 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD repeat-containing protein 35 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO463750.000e+045.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO268721.827e-3148.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO304152.274e-3135.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WD repeat-containing protein 35 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr350.000e+045.71WD repeat domain 35 [Source:NCBI gene;Acc:10116168... [more]
wdr350.000e+045.34WD repeat domain 35 [Source:NCBI gene;Acc:10116168... [more]
wdr350.000e+043.61WD repeat domain 35 [Source:NCBI gene;Acc:10116168... [more]
tulp4a3.542e-2726.27TUB like protein 4 [Source:NCBI gene;Acc:101163129... [more]
tulp4a3.542e-2726.27TUB like protein 4 [Source:NCBI gene;Acc:101163129... [more]
back to top
BLAST of WD repeat-containing protein 35 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000066519.10.000e+099.66SMESG000066519.1[more]
SMESG000001313.16.156e-928.24SMESG000001313.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013955 ID=SMED30013955|Name=WD repeat-containing protein 35|organism=Schmidtea mediterranea sexual|type=transcript|length=3749bp
GTTTAATTAAATGTTTTAATAATTACTTCTTAGTTACTTAATTTGTATGC
AACTATCAATTTAAAATATTTTTGACAATATTTTTGACAATTTATATTAT
ATTTTTAATTAAAATTAGTTATTGCAAAATATGTTTGTCTATTTAAGTAA
AAAGATTTCAATTCCAAATGATGTTCAATTGACTACACTTTCATGGAACA
CGAACAAAGGCTATATTGCATGTGGAGGTGTTGAAGGACTTTTAAAAGTT
TTAAAGTTAGATCCTCAAGTTAATGGAAACACTAGAGGAATCGCTGCTCC
GACAAATTTGACAATGAATGAAACCTTAGAAGAACATAAAAGCACGTTAA
CGAAAATTACTTGGAATGAAAAATTCGATAAAATGACAAGTGCTGACGAA
TCTGGCGTTATCATAGTGTGGATTCTTTTTAAGAATAGTTGGCATCAAGA
AATGATCAATAACTCAAACTCACATAGAGTGAACGGAATTAAATGGAATC
CAGACGGAGAAAAAATATGCATTGCATATGAAGATGGTTCTATCATAATA
GGATCGGTTGATGGAAATAGGATTTGGGGCAAAACGATTCCAGATAAACT
ATCTCACGTAGAATGGTCTCCAGATAGTCGTTTGTTAATATTTGGCCTAT
TGGATGGTCAAATCCATATATATGATGGTGGCGGAAATAAAATTGGACCA
TTAAAAAATTATTGTACTACCGACGAAAACCCAATAAAAATAGTTGGAAT
CGAATGGTATAAAGGTGACAAGGGTTACATGTGTAAAAATTGCCCTTGTC
TTGCTGTCTGCTATAGCAGTGGTTGTTGTCAAATAATGCGCAACGAAAAT
GATGAATATCCTGTTCTCATTAATACCAGATTAGAAGCTAAATGCTTAGC
ATGGAATGGAAATGGAACAGTGTTAGCCATAGGAGGTCTAGCAGTTGGTC
AAGTTACGAATAAAGATTTCAATCTAATTCAATTTTATAATCCATTTGGT
TATCATTTGAGAACTCTAAAAGTTATTTCAACAAAACTTCATTCGTGTAG
TTGGGATAATGAATCTCTTCGGTTGGCCATAGCAGTTGATTCGTCCATAT
ATTTCGCAAATATCCGCCCATCCTATAAATGGGCATATTGCAATGACACA
ATAATTTATGCGTTTACTAAACCAGAACAATGCCATTATTGTGTGATTTT
TTGGAATTCTAAACTTGATTCATTTCAAACAAAATACTTCTATAACTTGA
AAGCTATAATTTCAAACGGAATATTATGCACTATAATTTATCAAGCCGAC
GCAGACAGTAAACAAAAGTACACGCTACTTGTTTGTAATTCAATTGGAAC
TCCAATAGATACCAAAGAATTGCCATTTGAACCATTATATCAAGTCATGA
CGGAATCCCATGTTATTGTTGCATCACAAAATATAATATATGCATGGCAG
TTTAAAAAACCCGAAAATCTTCTTTCTATTGAAAGCCAAACTAAGCGTAA
ATCTACAATGGATAATTTTATTCACGTGGACGATATTTCGATACAAAAAG
ATGGTCCTTCATCTACAGAAAATAATTTACATAGTCTTATGAAAAAATTG
TCTAATGATCCAATTTGTGCGATTTGTTCAGCAAGACGTACACTTATAGT
AGCAACAGAATCGGGAAAAATGAAACAATACTCAATGCCTTTAATGGAGT
ATGAAACTACTCACAAACTTCGAAGTAAACCTTTCAAACTTGAAATAAAT
TGCACTGGAAATCGTGTTGCCAGTATTGATTTTGGAGGAATTTTATCTTT
TTTTGATCTCGACAAAAAGTATACAGATGAAAACGGAGCGAGTGGACAAG
GCCAAATTGTTGAAAATTTTGAATATAAAGACGTTTGGGATATGAAATTT
TCAGAAGATAATTCTCAGTTATTTGTTATGATGGAAAAAACTAAATTAAG
AATTATTCAAGATGTCGAATCAGAGGAACCCGTTGTATTTTCTGGCTACA
TTTGTCAATTTAAAGAGTTAGAAGTTAAAGCCGTTTTATTGGACGAAATA
ATGAACGATCTTGATAAACCAAATAAAAATAATGTAGTCACCTTAGAAGC
CAAGATCCTTAGAGATTGTCGAAAACTGCTAGAAGAAGGACAAATAGAAA
AGGCAAAAGAATTTATTGAAGATCGGCCACATAACAAAATGTGGAAAATG
TTAGCAGAACATGCTTTGGAAAAGTTAGACTTAGAAACTGCTGATCAAGC
TTTTGTCCGGTATACGTATTATCCCGGGGTAAAGTTTGTGAAAAAGCTAC
AGAAACTTCAGAATAATAATTTGAAATTAGCGGAAATTTCCATTTATTTC
GGACGCTATGAAGAGGCTGAACATCGTTTTATGGCAATCGATCGTCCGGA
TTTGGTTATTGCAATGCTTAAATCGATCGGCGATTGGTCAAGAGTGCTAC
AACTGATGAAGTCGGGAAATAGCGCTTCTGATGCTGAAATGAATGAAGCG
TGGAATGCGATTGGTTTACAATATTTCGACAAACATAATTGGTCTCAGGC
GGTTAATTATTTTACCCAAGGAAGATGTTACGAGAATTTGGTGGAATGTT
ATTACTATTTGGAGGACTATTCAGGATTGGAAAGACTAGCAGAATTGCTT
CCTGAAAATTCACCGTTATTGTCTGAAATAGCTGAAATATTTGTCAATGC
GGGAATGTGTGAACAAGCAGTATTTACATATGTGAAATCTGATCAATTAA
AAAGTGCAATTGATTGCTGTATTCAACTCAATCATTGGCAAACTGCTATA
GACCTAGCTAAAAACCGCGATATGACAAATATAAATGAAATGTTGACAAG
ATATGCCAAGCAATTATTGGATAATAAGTGCTACGTTCAAGCCGTTGAGT
TGTACAGAAGAGCAGGTTGCTTTCTTGAAGCAGCTAAAATTGTTCAAAAA
TTGACTGAACAAGAAGCTAAAACTTCAAAAAATTATTCCAAATTGAAGAA
AATGTCGGTTTTAATTGGCCTTCTTATTGAACAACATCACGATCAAAATA
AAATACAGGCTAAAGCGCGACTGAAAGACATTAAAGGACAAGATGCAGCT
TCAGCTCTAAATGGAATGTTACACGAAGAATTCCACGGTGTAACTGAAAG
TCGCTTACTTGATCGACCTTGGCATTGGGCAGAAGCCTATCATTTCTACT
TACTTGCTCAAAGACAATTATTTCAGAAGTTCTTTGATGCGGCAATGAGA
ACCGCTAAATTATTAGTCGATTATGAAGATGTAATTGCTCCAAGAGATAT
ATATTCATTAATTGCTATTTGTGCTATTCACAATCGAGCTTTTGGCACTA
GTTCAAAAGCATTTACAAAACTTGAAACTCTGAATTCTTTTTCAGAAAAA
GAAAAGGAAAATTTAATATCATTAACGTTTAAAATATTTACAAAATATTC
TCCAATTGACCCCCCAAGGGCAAGAGAATACGATGAACTCGAAAATACAT
TCGATGGAGATTCAAAAATTCCAATTTGCATAGTTTCCGGGCAACCCATT
ACTCAAGGTCAGTTTTGGATGTGCCCTATTTGTAAGCATTCAGCACATGA
AGACGAAATGAACAAGCATCAAAATTGTCCTTTATGTCATTCACCGGCAT
AATAAAGCTAAATAATTATAATATTGGGTTATCTGGGATTGTTTAATTCA
TGTTATTAAAATGTTATTTTATAATATTATATATATTCTCCTATTAAAA
back to top

protein sequence of SMED30013955-orf-1

>SMED30013955-orf-1 ID=SMED30013955-orf-1|Name=SMED30013955-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1174bp
MFVYLSKKISIPNDVQLTTLSWNTNKGYIACGGVEGLLKVLKLDPQVNGN
TRGIAAPTNLTMNETLEEHKSTLTKITWNEKFDKMTSADESGVIIVWILF
KNSWHQEMINNSNSHRVNGIKWNPDGEKICIAYEDGSIIIGSVDGNRIWG
KTIPDKLSHVEWSPDSRLLIFGLLDGQIHIYDGGGNKIGPLKNYCTTDEN
PIKIVGIEWYKGDKGYMCKNCPCLAVCYSSGCCQIMRNENDEYPVLINTR
LEAKCLAWNGNGTVLAIGGLAVGQVTNKDFNLIQFYNPFGYHLRTLKVIS
TKLHSCSWDNESLRLAIAVDSSIYFANIRPSYKWAYCNDTIIYAFTKPEQ
CHYCVIFWNSKLDSFQTKYFYNLKAIISNGILCTIIYQADADSKQKYTLL
VCNSIGTPIDTKELPFEPLYQVMTESHVIVASQNIIYAWQFKKPENLLSI
ESQTKRKSTMDNFIHVDDISIQKDGPSSTENNLHSLMKKLSNDPICAICS
ARRTLIVATESGKMKQYSMPLMEYETTHKLRSKPFKLEINCTGNRVASID
FGGILSFFDLDKKYTDENGASGQGQIVENFEYKDVWDMKFSEDNSQLFVM
MEKTKLRIIQDVESEEPVVFSGYICQFKELEVKAVLLDEIMNDLDKPNKN
NVVTLEAKILRDCRKLLEEGQIEKAKEFIEDRPHNKMWKMLAEHALEKLD
LETADQAFVRYTYYPGVKFVKKLQKLQNNNLKLAEISIYFGRYEEAEHRF
MAIDRPDLVIAMLKSIGDWSRVLQLMKSGNSASDAEMNEAWNAIGLQYFD
KHNWSQAVNYFTQGRCYENLVECYYYLEDYSGLERLAELLPENSPLLSEI
AEIFVNAGMCEQAVFTYVKSDQLKSAIDCCIQLNHWQTAIDLAKNRDMTN
INEMLTRYAKQLLDNKCYVQAVELYRRAGCFLEAAKIVQKLTEQEAKTSK
NYSKLKKMSVLIGLLIEQHHDQNKIQAKARLKDIKGQDAASALNGMLHEE
FHGVTESRLLDRPWHWAEAYHFYLLAQRQLFQKFFDAAMRTAKLLVDYED
VIAPRDIYSLIAICAIHNRAFGTSSKAFTKLETLNSFSEKEKENLISLTF
KIFTKYSPIDPPRAREYDELENTFDGDSKIPICIVSGQPITQGQFWMCPI
CKHSAHEDEMNKHQNCPLCHSPA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR004170WWE-dom
IPR001680WD40_repeat
IPR011990TPR-like_helical_dom_sf
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017233WDR35
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0035091phosphatidylinositol binding
Vocabulary: biological process
TermDefinition
GO:0045019negative regulation of nitric oxide biosynthetic process
GO:0060271cilium morphogenesis
GO:0061512protein localization to cilium
GO:0071333cellular response to glucose stimulus
GO:0071356cellular response to tumor necrosis factor
GO:0090200positive regulation of release of cytochrome c from mitochondria
GO:0097421liver regeneration
GO:1901555response to paclitaxel
GO:1905705cellular response to paclitaxel
GO:0009636response to toxic substance
GO:0010629negative regulation of gene expression
GO:0030030cell projection organization
GO:0032496response to lipopolysaccharide
GO:0035721intraciliary retrograde transport
GO:0035735intraciliary transport involved in cilium assembly
GO:0043065positive regulation of apoptotic process
GO:0043280positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
Vocabulary: cellular component
TermDefinition
GO:0097542ciliary tip
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
GO:0005929cilium
GO:0005930axoneme
GO:0030991intraciliary transport particle A
GO:0036064ciliary basal body
GO:0042995cell projection
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 59..98
e-value: 20.0
score: 8.7
coord: 479..518
e-value: 270.0
score: 1.6
coord: 4..42
e-value: 100.0
score: 4.2
coord: 146..182
e-value: 3.5
score: 13.6
coord: 103..142
e-value: 1.9
score: 15.2
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 12..276
e-value: 2.8E-21
score: 77.9
IPR017233WD repeat protein 35PIRSFPIRSF037536WD35coord: 1..1173
e-value: 0.0
score: 1302.1
IPR017233WD repeat protein 35PANTHERPTHR16517:SF1WD REPEAT-CONTAINING PROTEIN 35coord: 8..1103
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 634..994
e-value: 1.6E-10
score: 42.4
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 763..946
NoneNo IPR availablePANTHERPTHR16517TUBBY-RELATEDcoord: 8..1103
NoneNo IPR availableSUPERFAMILYSSF69322Tricorn protease domain 2coord: 155..611
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 66..151
score: 9.309
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 14..270