Retrotransposable element

Overview
NameRetrotransposable element
Smed IDSMED30013953
Length (bp)4527
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Retrotransposable element (SMED30013953) t-SNE clustered cells

Violin plots show distribution of expression levels for Retrotransposable element (SMED30013953) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013953

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30013953h1SMcG0008042 SmedASXL_034803SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30013953h1SMcG0008042 dd_Smed_v4_7493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013953h1SMcG0008042 dd_Smed_v4_7493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013953h1SMcG0008042 dd_Smed_v4_7493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30013953h1SMcG0008042 dd_Smed_v4_7493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Retrotransposable element vs. Ensembl Zebrafish
Match: BX546500.1 (pep chromosome:GRCz11:23:12926092:12931693:-1 gene:ENSDARG00000086495.3 transcript:ENSDART00000122176.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX546500.1)

HSP 1 Score: 65.0846 bits (157), Expect = 6.879e-10
Identity = 42/142 (29.58%), Postives = 74/142 (52.11%), Query Frame = 1
Query: 2356 VLQKISEVKLKIN-QKNIKY*SELRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIKDYSKKVEGFSKFMVRIMIR*Y--GMKTVLEKMK----LGQILVFQDFKK*MILYTDASFVTFGTVLSQK 2760
            VLQ++ E  L +  +K + +   ++FLGHI++  G+++D  KI+A+  +  P   K L+ FLG  N+Y RFI+++S+     +      M   +    +    K+K       IL+  D  +  ++  DAS V  G +LSQ+
Sbjct:  671 VLQRLLENGLYVKAEKCVFHAQSVQFLGHIVSVEGMRMDPEKIQAVVDWPTPDSRKALQRFLGFANFYRRFIRNFSQLAAPLTSLTSSKMPFRWSSAAEAAFSKLKGCFVSAPILIAPDPSRQFVVEVDASEVGVGAILSQR 812          
BLAST of Retrotransposable element vs. Ensembl Zebrafish
Match: BX511082.1 (pep chromosome:GRCz11:9:14291932:14297132:1 gene:ENSDARG00000113678.1 transcript:ENSDART00000183119.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX511082.1)

HSP 1 Score: 62.3882 bits (150), Expect = 4.743e-9
Identity = 41/142 (28.87%), Postives = 75/142 (52.82%), Query Frame = 1
Query: 2356 VLQKISEVKLKIN-QKNIKY*SELRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIKDYSKKVEGFSKFM-VRIMIR*YGMKTV-LEKMK----LGQILVFQDFKK*MILYTDASFVTFGTVLSQK 2760
            VLQ++ E  L +  +K + +   + FLGHI++  G+++D  K++A+  +  P   K L+ FLG  N+Y RFI+++S+     +    ++   R      V  +++K       IL+  D  +  ++  DAS V  G +LSQ+
Sbjct:  697 VLQRLLENGLYVKAEKCVFHAQSVPFLGHIVSVEGMRMDPEKVQAVVDWPTPDSRKALQRFLGFANFYRRFIRNFSQLAAPLTALTSLKTPFRWSNAAQVAFDRLKSCFVSAPILIAPDPSRQFVVEVDASEVGVGAILSQR 838          
BLAST of Retrotransposable element vs. Ensembl Zebrafish
Match: BX511224.1 (pep chromosome:GRCz11:2:18017000:18022765:1 gene:ENSDARG00000113243.1 transcript:ENSDART00000186877.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX511224.1)

HSP 1 Score: 62.3882 bits (150), Expect = 5.429e-9
Identity = 41/142 (28.87%), Postives = 73/142 (51.41%), Query Frame = 1
Query: 2356 VLQKISEVKLKIN-QKNIKY*SELRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIKDYSKKVEGFSKFMVRIMIR*Y--GMKTVLEKMK----LGQILVFQDFKK*MILYTDASFVTFGTVLSQK 2760
            VLQ++ E  L +  +K + +   ++FLGHI++  G+++D  KI+A+ ++  P   K L+ FLG  N+Y RFI ++S+     +          +    +    K+K       IL+  D  +  ++  DAS V  G +LSQ+
Sbjct:  697 VLQRLLENGLYVKAEKCVFHAQSVQFLGHIVSVEGMRMDPEKIQAVVNWPTPDSRKALQRFLGFANFYRRFIHNFSQLAAPLTSLTSSKTPFRWSSAAEAAFSKLKGCFVSAPILIAPDPSRQFVVEVDASEVGVGAILSQR 838          
BLAST of Retrotransposable element vs. Ensembl Zebrafish
Match: CR855320.1 (pep chromosome:GRCz11:1:7956030:7961696:1 gene:ENSDARG00000099359.2 transcript:ENSDART00000159655.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR855320.1)

HSP 1 Score: 62.003 bits (149), Expect = 6.538e-9
Identity = 41/142 (28.87%), Postives = 73/142 (51.41%), Query Frame = 1
Query: 2356 VLQKISEVKLKIN-QKNIKY*SELRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIKDYSKKVEGFSKFMVRIMIR*Y--GMKTVLEKMK----LGQILVFQDFKK*MILYTDASFVTFGTVLSQK 2760
            VLQ++ E  L +  +K + +   + FLGHI++  G+++D  KI+A+ ++  P   K L+ FLG  N+Y RFI+++S+     +          +    +    K+K       IL+  D  +  ++  DAS V  G +LSQ+
Sbjct:  699 VLQRLLENGLYVKAEKCVFHAQSVPFLGHIVSVEGLRMDPEKIKAVVNWPTPDSRKALQRFLGFANFYRRFIRNFSQLAAPLTALTSSKTPFRWSSAAEAAFSKLKGCFVSAPILITPDPSRQFVVEVDASEVGVGAILSQR 840          
BLAST of Retrotransposable element vs. Ensembl Zebrafish
Match: FO704673.1 (pep chromosome:GRCz11:12:14545475:14551077:-1 gene:ENSDARG00000112601.1 transcript:ENSDART00000188717.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:FO704673.1)

HSP 1 Score: 61.6178 bits (148), Expect = 8.511e-9
Identity = 29/77 (37.66%), Postives = 52/77 (67.53%), Query Frame = 1
Query: 2353 TVLQKISEVKLKINQKNIKY*-SELRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIKDYS 2580
            TVL ++ E +L    +  ++  S+  FLG+II+  G++++ +K++A+  + +PK VK L+ FLG  N+Y RFI++YS
Sbjct:  675 TVLTRLQENQLYAKLEKCEFHMSKTSFLGYIISHHGVEMNNTKVQAVTGWPLPKTVKELQRFLGFANFYRRFIRNYS 751          
BLAST of Retrotransposable element vs. Ensembl Xenopus
Match: ENSXETT00000031144.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:8:63282574:63284044:1 gene:ENSXETG00000009810.1 transcript:ENSXETT00000031144.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.9366 bits (167), Expect = 3.376e-11
Identity = 37/135 (27.41%), Postives = 66/135 (48.89%), Query Frame = 1
Query: 2416 SELRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIKDYSKKVEGFSKFMVRIMIR*YGMK--------------------TVLEKMKLGQILVFQDFKK*MILYTDASFVTFGTVLSQK 2760
            S + ++GH+++  GI  D +KIEA+ ++  P+ V  LRSFLG C YY RF++ YS+     ++ +    +   G K                     + +++    +L + D  +  +L+ DAS+   G VL Q+
Sbjct:   10 SSVTYVGHVVSTEGIGTDPAKIEAVVTWPKPQNVTELRSFLGFCGYYRRFVEGYSRVAHPLNELLRLSNVHGEGTKRDAKAPFGDKWTSACEGAFVQLKKRLTEAPVLAYADAHRPYVLHVDASYEGLGGVLHQR 144          
BLAST of Retrotransposable element vs. Ensembl Xenopus
Match: ENSXETT00000035618.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:2:3692667:3694042:1 gene:ENSXETG00000010959.1 transcript:ENSXETT00000035618.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.5514 bits (166), Expect = 3.753e-11
Identity = 32/86 (37.21%), Postives = 53/86 (61.63%), Query Frame = 1
Query: 2356 VLQKISEVKLKINQKNIKY*-SELRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIKDYSKKVEGFSKFM 2610
            VL ++ +  LK++    K+  S + ++GH+++  GI  D SKIEA+ S+  P+ +  LRSFLG C YY RF++ +SK     S+ +
Sbjct:    3 VLDRLEKEGLKLSLDKCKFFQSSVTYVGHVVSAEGISTDPSKIEAVTSWPRPRTITELRSFLGFCGYYRRFVEGFSKTARPLSQLL 88          
BLAST of Retrotransposable element vs. Ensembl Xenopus
Match: anxa6 (annexin A6 [Source:Xenbase;Acc:XB-GENE-989741])

HSP 1 Score: 69.3218 bits (168), Expect = 4.018e-11
Identity = 49/156 (31.41%), Postives = 74/156 (47.44%), Query Frame = 1
Query: 2416 SELRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIKDYSKKVEGFSKFMVRIMIR--------*YGMKTVLEKMKLGQILVFQDFKK*MILYTDASFVTFGTVLSQ-KIYGIWIAKNDYERCDYIARKDLL*KEMFVRTI 2856
            +E+++LGH +    ++ D +K+EAI  + IPK  K + +FLG   YY +FI +YS   +  +    R   R           M  + + +    +L   DF +  IL TDAS    G VLSQ   YG      +     Y++RK LL +E    TI
Sbjct:  530 AEVQYLGHRVGGGQLRPDPAKVEAICQWPIPKTQKQVLAFLGTSGYYRKFIPNYSTVAKPLTDLTSRQRSRTIVWTPECESAMNALKQALASSPVLAAPDFSRRFILQTDASNFGLGAVLSQVNTYG------EEHPVAYLSRK-LLPREAAYATI 678          
BLAST of Retrotransposable element vs. Ensembl Xenopus
Match: ENSXETT00000006041.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:37317867:37322724:1 gene:ENSXETG00000003070.1 transcript:ENSXETT00000006041.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 3.165e-10
Identity = 47/162 (29.01%), Postives = 74/162 (45.68%), Query Frame = 1
Query: 2365 KISEVKLKINQKNIKY*SELRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIKDYSK-------------KVEGFSKFMVRIMIR*YG-MKTVLEK----------------MKLGQILVFQDFKK*MILYTDASFVTFGTVLSQK 2760
            K+S  K +  Q ++ Y      +GH+++  GI  D SKIEA+ S+  P+ +  LRSFLG C YY RF+K +SK             +VEG  + ++   +R  G  +  +E                 +    +L + D  K   L+ DAS    G +L Q+
Sbjct:  509 KLSPEKCQFCQPSVNY------VGHVVSAEGIATDPSKIEAVSSWPKPRTITELRSFLGFCGYYRRFVKGFSKVAQPLNQLLQSNTEVEGSDRDILAKRLRGQGWTRESIEDFWTEECDKAFDQLKYCLTHAPVLAYADATKPYTLHIDASREGLGGILYQE 664          
BLAST of Retrotransposable element vs. Ensembl Xenopus
Match: ENSXETT00000024810.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV464121.1:1437:3201:1 gene:ENSXETG00000014958.1 transcript:ENSXETT00000024810.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.6178 bits (148), Expect = 2.193e-9
Identity = 41/143 (28.67%), Postives = 69/143 (48.25%), Query Frame = 1
Query: 2356 VLQKISEVKLKINQKNIKY*-SELRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIKDYSKKVEGF----SKFMVRIMIR*YGMKTVLEKMKL----GQILVFQDFKK*MILYTDASFVTFGTVLSQ 2757
            VL++I +  L +      +  +E+++LGH +    +  + +K+E I ++  P   K + +FLG   YY RFI +YS   +      SK   R++       T +  +K       +L   DF +  I++TDAS    G VLSQ
Sbjct:   59 VLERIRQAGLTLKPGKCHFGMAEVQYLGHRVGSGRVMPEPAKVEVIVNWPTPTTQKQVLAFLGTAGYYRRFIPNYSAIAKPLTDLTSKRRPRVVTWTPECATAMSALKSALVNAPVLYAPDFSRGFIVHTDASTYGIGAVLSQ 201          

HSP 2 Score: 22.7126 bits (47), Expect = 2.193e-9
Identity = 8/24 (33.33%), Postives = 15/24 (62.50%), Query Frame = 2
Query: 2312 IFTNTMEKHYKLLERCCRKFQRLN 2383
            IF+NT E+H + L+R   + ++  
Sbjct:   44 IFSNTWEEHVQHLQRVLERIRQAG 67          
BLAST of Retrotransposable element vs. UniProt/SwissProt
Match: sp|P04323|POL3_DROME (Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.010e-11
Identity = 52/167 (31.14%), Postives = 89/167 (53.29%), Query Frame = 1
Query: 2329 GETL*TAGTVLQKISEVKLKINQKNIKY*-SELRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIKDYSKKVEGFSKFM---VRIMIR*YGMKTVLEKMKL----GQILVFQDFKK*MILYTDASFVTFGTVLSQKIYGI-WIAK--NDYE 2796
             E L + G V +K+++  LK+     ++   E  FLGH++   GI+ +  KIEAI+ + IP   K +++FLG+  YY +FI +++   +  +K +   ++I        +  +K+K       IL   DF K   L TDAS V  G VLSQ  + + +I++  N++E
Sbjct:  376 DEHLQSLGLVFEKLAKANLKLQLDKCEFLKQETTFLGHVLTPDGIKPNPEKIEAIQKYPIPTKPKEIKAFLGLTGYYRKFIPNFADIAKPMTKCLKKNMKIDTTNPEYDSAFKKLKYLISEDPILKVPDFTKKFTLTTDASDVALGAVLSQDGHPLSYISRTLNEHE 542          
BLAST of Retrotransposable element vs. UniProt/SwissProt
Match: sp|P20825|POL2_DROME (Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.679e-11
Identity = 57/169 (33.73%), Postives = 88/169 (52.07%), Query Frame = 1
Query: 2356 VLQKISEVKLKINQKNIKY*S-ELRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIKDY---SKKVEGFSKFMVRIMIR*YGMKTVLEKMKL----GQILVFQDFKK*MILYTDASFVTFGTVLSQKIYGI-WIAK--NDYERCDYIARKDLL 2829
            V  K+++  LK+     ++   E  FLGHI+   GI+ +  K++AI S+ IP   K +R+FLG+  YY +FI +Y   +K +    K   +I  +        EK+K       IL   DF+K  +L TDAS +  G VLSQ  + I +I++  ND+E       K+LL
Sbjct:  384 VFTKLADANLKLQLDKCEFLKKEANFLGHIVTPDGIKPNPIKVKAIVSYPIPTKDKEIRAFLGLTGYYRKFIPNYADIAKPMTSCLKKRTKIDTQKLEYIEAFEKLKALIIRDPILQLPDFEKKFVLTTDASNLALGAVLSQNGHPISFISRTLNDHELNYSAIEKELL 552          
BLAST of Retrotransposable element vs. UniProt/SwissProt
Match: sp|Q8I7P9|POL5_DROME (Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 6.068e-10
Identity = 48/156 (30.77%), Postives = 76/156 (48.72%), Query Frame = 1
Query: 2356 VLQKISEVKLKIN-QKNIKY*SELRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIKDYSKKVEGFSKFM--------------VRIMIR*YGMKTVLEKMKL---GQILVFQDFKK*MILYTDASFVTFGTVLSQKIYG 2769
            VL  +S+  L++N +K+    +++ FLG+I+   GI+ D  K+ AI     P  VK L+ FLG+ +YY +FI+DY+K  +  +                 V I +    +++  +   +    +IL F  F K   L TDAS    G VLSQ   G
Sbjct:  301 VLASLSKANLQVNLEKSHFLDTQVEFLGYIVTADGIKADPKKVRAISEMPPPTSVKELKRFLGMTSYYRKFIQDYAKVAKPLTNLTRGLYANIKSSQSSKVPITLDETALQSFNDLKSILCSSEILAFPCFTKPFHLTTDASNWAIGAVLSQDDQG 456          
BLAST of Retrotransposable element vs. UniProt/SwissProt
Match: sp|P10401|POLY_DROME (Retrovirus-related Pol polyprotein from transposon gypsy OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 6.141e-10
Identity = 50/168 (29.76%), Postives = 86/168 (51.19%), Query Frame = 1
Query: 2314 FYEYNGETL*TAGTVLQKISEVKLKINQKNIKY*SE-LRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIKDYSKKVE-----------GFSKFMVRIMIR*YG--MKTVLEKMK--LGQ---ILVFQDFKK*MILYTDASFVTFGTVLSQK 2760
            F E   + +    TVL+ + +  ++++Q+  ++  E + +LG I++K G + D  K++AI+ +  P CV  +RSFLG+ +YY  FIKD++                 SK M + +   +    +   ++++  L     IL + DFKK   L TDAS    G VLSQ+
Sbjct:  346 FSENESDHVRHIDTVLKCLIDANMRVSQEKTRFFKESVEYLGFIVSKDGTKSDPEKVKAIQEYPEPDCVYKVRSFLGLASYYRVFIKDFAAIARPITDILKGENGSVSKHMSKKIPVEFNETQRNAFQRLRNILASEDVILKYPDFKKPFDLTTDASASGIGAVLSQE 513          
BLAST of Retrotransposable element vs. UniProt/SwissProt
Match: sp|P10394|POL4_DROME (Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster OX=7227 GN=POL PE=4 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 1.065e-7
Identity = 47/145 (32.41%), Postives = 67/145 (46.21%), Query Frame = 1
Query: 2356 VLQKISEVKLKINQKNIKY*-SELRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIK---DYSKKVEGFSKFMVRIMIR*YGMKTVLE-KMKL--GQILVFQDFKK*MILYTDASFVTFGTVLSQKIYG 2769
            V  K  E  LK++ +   +   E+ FLGH     GI  D  K + I+++ +P    + R F+  CNYY RFIK   DYS+ +    K  V         K  +  K +L    +L + DF K   + TDAS    G VL+Q   G
Sbjct:  493 VFGKCREYNLKLHPEKCSFFMHEVTFLGHKCTDKGILPDDKKYDVIQNYPVPHDADSARRFVAFCNYYRRFIKNFADYSRHITRLCKKNVPFEWTDECQKAFIHLKSQLINPTLLQYPDFSKEFCITTDASKQACGAVLTQNHNG 637          
BLAST of Retrotransposable element vs. TrEMBL
Match: F1AGB5 (Pol polyprotein (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 2.548e-18
Identity = 48/81 (59.26%), Postives = 59/81 (72.84%), Query Frame = 1
Query: 2350 GTVLQKISEVKLKINQKNIKY*-SELRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIKDYSKKV 2589
            G VL+ I E  L+IN +  +    E+RFLGHII+K G+Q D SKI+AI++F  P CVK LRSFLGICNYY RFI DY+KK 
Sbjct:   51 GEVLKAIKEAGLRINPEKCQIIKEEIRFLGHIISKEGVQTDPSKIQAIQNFGKPNCVKKLRSFLGICNYYRRFISDYAKKA 131          
BLAST of Retrotransposable element vs. TrEMBL
Match: A0A1B6J823 (Reverse transcriptase domain-containing protein (Fragment) OS=Homalodisca liturata OX=320908 GN=g.54585 PE=4 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.873e-15
Identity = 53/145 (36.55%), Postives = 78/145 (53.79%), Query Frame = 1
Query: 2356 VLQKISEVKLKINQKNIKY*S-ELRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIKDYS---KKVEGFSKFMVRIMIR*YGMKTVLEKMKL---GQILVFQDFKK*MILYTDASFVTFGTVLSQKIYG 2769
            VL+K+ E  L +      + + E+ +LGH+I K G++ D +K+ A++ F +PK VKN+RSFLG+  YY RFI  ++   K +   +K     +      K   E   +     +LVF DF K  IL TDAS    G VLSQ + G
Sbjct:   48 VLEKLREANLSVQLSKCNFMAAEVNYLGHVITKRGVEPDPNKVSAVRDFPVPKTVKNVRSFLGLAGYYRRFIAGFATIGKPLFDLTKQGCEFIWTPECQKAFDELKHMLISAPVLVFPDFTKQFILSTDASTQALGAVLSQVVDG 192          
BLAST of Retrotransposable element vs. TrEMBL
Match: A0A3Q0JL77 (uncharacterized protein LOC108254503 OS=Diaphorina citri OX=121845 GN=LOC108254503 PE=4 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.967e-14
Identity = 63/173 (36.42%), Postives = 94/173 (54.34%), Query Frame = 1
Query: 2356 VLQKISEVKLKINQKNIKY*-SELRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIKDYSKKVEGFSKFM---VRIMIR*YGMKTVLEKMKL----GQILVFQDFKK*MILYTDASFVTFGTVLSQKIYG----IWIAK---NDYERCDYIARKDLL 2829
            VL ++ +  LKI     ++   E+ +LGH++ + G++ + +KI AIKS+ IP+ VK ++ FLG+  YY RFIKD+++  +  +K +    +I I     K   EK K+      +L + DF K  IL TDAS V  G VLSQ + G    I  A    ND ER      K+LL
Sbjct:  407 VLTRLRDSNLKIQLDKSEFLRKEVEYLGHVVTEEGVKPNPTKINAIKSYPIPRTVKQIKGFLGLLGYYRRFIKDFARLTKPLTKCLKKDAKIDITDVEYKDCFEKCKIILANEPVLQYPDFSKPFILTTDASNVALGAVLSQGVLGQDKPIAFASRTLNDSERNYSTIEKELL 579          
BLAST of Retrotransposable element vs. TrEMBL
Match: A0A3B5QL73 (Uncharacterized protein OS=Xiphophorus maculatus OX=8083 PE=4 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 3.080e-14
Identity = 64/190 (33.68%), Postives = 92/190 (48.42%), Query Frame = 1
Query: 2356 VLQKISEVKLKINQKNIK-Y*SELRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIKDYSKKVEGFSKFMVR-IMIR*YGMKTV---------------------------LEKMKLGQILVFQDFKK*MILYTDASFVTFGTVLSQKIYG----IWIAKNDYERCD--YIARK 2820
            VL ++ E  LK++ K  K Y + +R+LGHI+++ GI+ D  K+ A+K++  P  +K LR+FLG C YY RFIKDYSK V+  ++       +R +   TV                           +EK+    IL F D K   IL+TDAS    G  L Q+  G    I  A     +C+  Y A K
Sbjct:  397 VLNRLKEFGLKLSPKKCKFYQTSVRYLGHIVSEKGIETDPDKVAALKTWPKPNNLKELRTFLGFCGYYRRFIKDYSKIVKPLNELTAGYPPLRKHAKTTVNPEKYFNPKDGFGDRWTLACQTAFDTIIEKLTTAPILGFADPKLSYILHTDASTSGLGAALYQERQGQKRVIAYASRGLSKCESRYPAHK 586          
BLAST of Retrotransposable element vs. TrEMBL
Match: A0A3Q0JG65 (uncharacterized protein LOC103518485 OS=Diaphorina citri OX=121845 GN=LOC103518485 PE=4 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 3.403e-14
Identity = 63/173 (36.42%), Postives = 94/173 (54.34%), Query Frame = 1
Query: 2356 VLQKISEVKLKINQKNIKY*-SELRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIKDYSKKVEGFSKFM---VRIMIR*YGMKTVLEKMKL----GQILVFQDFKK*MILYTDASFVTFGTVLSQKIYG----IWIAK---NDYERCDYIARKDLL 2829
            VL ++ +  LKI     ++   E+ +LGH++ + G++ + +KI AIKS+ IP+ VK ++ FLG+  YY RFIKD+++  +  +K +    +I I     K   EK K+      +L + DF K  IL TDAS V  G VLSQ + G    I  A    ND ER      K+LL
Sbjct:   37 VLTRLRDSNLKIQLDKSEFLRKEVEYLGHVVTEEGVKPNPTKINAIKSYPIPRTVKQIKGFLGLLGYYRRFIKDFARLTKPLTKCLKKDAKIDITDVEYKDCFEKCKIILANEPVLQYPDFSKPFILTTDASNVALGAVLSQGVLGQDKPIAFASRTLNDSERNYSTIEKELL 209          

HSP 2 Score: 90.5077 bits (223), Expect = 3.403e-14
Identity = 63/173 (36.42%), Postives = 94/173 (54.34%), Query Frame = 1
Query: 2356 VLQKISEVKLKINQKNIKY*-SELRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIKDYSKKVEGFSKFM---VRIMIR*YGMKTVLEKMKL----GQILVFQDFKK*MILYTDASFVTFGTVLSQKIYG----IWIAK---NDYERCDYIARKDLL 2829
            VL ++ +  LKI     ++   E+ +LGH++ + G++ + +KI AIKS+ IP+ VK ++ FLG+  YY RFIKD+++  +  +K +    +I I     K   EK K+      +L + DF K  IL TDAS V  G VLSQ + G    I  A    ND ER      K+LL
Sbjct:  799 VLTRLRDSNLKIQLDKSEFLRKEVEYLGHVVTEEGVKPNPTKINAIKSYPIPRTVKQIKGFLGLLGYYRRFIKDFARLTKPLTKCLKKDAKIDITDVEYKDCFEKCKIILANEPVLQYPDFSKPFILTTDASNVALGAVLSQGVLGQDKPIAFASRTLNDSERNYSTIEKELL 971          

HSP 3 Score: 90.5077 bits (223), Expect = 3.403e-14
Identity = 63/173 (36.42%), Postives = 94/173 (54.34%), Query Frame = 1
Query: 2356 VLQKISEVKLKINQKNIKY*-SELRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIKDYSKKVEGFSKFM---VRIMIR*YGMKTVLEKMKL----GQILVFQDFKK*MILYTDASFVTFGTVLSQKIYG----IWIAK---NDYERCDYIARKDLL 2829
            VL ++ +  LKI     ++   E+ +LGH++ + G++ + +KI AIKS+ IP+ VK ++ FLG+  YY RFIKD+++  +  +K +    +I I     K   EK K+      +L + DF K  IL TDAS V  G VLSQ + G    I  A    ND ER      K+LL
Sbjct: 1561 VLTRLRDSNLKIQLDKSEFLRKEVEYLGHVVTEEGVKPNPTKINAIKSYPIPRTVKQIKGFLGLLGYYRRFIKDFARLTKPLTKCLKKDAKIDITDVEYKDCFEKCKIILANEPVLQYPDFSKPFILTTDASNVALGAVLSQGVLGQDKPIAFASRTLNDSERNYSTIEKELL 1733          
BLAST of Retrotransposable element vs. Ensembl Cavefish
Match: ENSAMXT00000039384.1 (pep primary_assembly:Astyanax_mexicanus-2.0:25:21146036:21149703:-1 gene:ENSAMXG00000035834.1 transcript:ENSAMXT00000039384.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.6557 bits (213), Expect = 1.459e-16
Identity = 55/198 (27.78%), Postives = 99/198 (50.00%), Query Frame = 1
Query: 2194 PKR*FIYLEE*INMTIKNLEYNDILRRFNSPWNIQLVCINFYEYNGETL*TAGTVLQKISEVKLKINQKNIKY*SELRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIKDYSKKVEGFSKFMVRIMIR*Y------GMKTVLEKMKLGQILVFQDFKK*MILYTDASFVTFGTVLSQKIYG 2769
            P+R  ++L+  + + ++++E N+I+ R  SPW   +V                        V+ K +Q        +++LGHII+  G+ +D +K EA++++  P  V+ +RSF+G+ +YY RF+  +++      K   + +   +        +T+ +K+    IL F D  +  IL TDAS V  G +LSQKI G
Sbjct:    3 PRRVPVHLQGEVAVHLQDMEKNNIISRSQSPWAAPVVL-----------------------VRKKDDQ--------VQYLGHIISAEGVAVDPAKTEAVQAWPEPVNVREVRSFVGLASYYRRFVSGFAELARPLHKLTEKGVSFKWTQECQTAFQTLKDKLVSAPILTFPDPGQTFILDTDASDVAIGAILSQKIDG 169          
BLAST of Retrotransposable element vs. Ensembl Cavefish
Match: ENSAMXT00000049799.1 (pep primary_assembly:Astyanax_mexicanus-2.0:13:11833844:11837206:1 gene:ENSAMXG00000039473.1 transcript:ENSAMXT00000049799.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.0333 bits (201), Expect = 4.487e-15
Identity = 52/167 (31.14%), Postives = 85/167 (50.90%), Query Frame = 1
Query: 2356 VLQKISEVKLKINQKNIKY*-SELRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIKDYSKKVEGFSKFMV------------RIMIR*YGMK----------------TVLEKMKLGQILVFQDFKK*MILYTDASFVTFGTVLSQKIYG 2769
            VLQ++ E  LK++ +  ++  + +R+LGHI+++ G++ D  KIEA+K++  PK +K LRSFLG   YY RFI+D+SK V+  +                 +  R +  K                T++ K+    +L + + K   IL+TDAS    G  L Q+  G
Sbjct:  510 VLQRLKEYGLKLSPEKCRFFQTSVRYLGHIVSRNGVETDPEKIEALKNWPNPKNLKELRSFLGFAGYYRRFIQDFSKIVKPLNDLTAGYGPTRKKCKAHDVKTRYFKPKEPFGSRWTESCQEAFDTIINKLTSAPVLAYANPKLPYILHTDASTTGLGAALYQEQNG 676          
BLAST of Retrotransposable element vs. Ensembl Cavefish
Match: ENSAMXT00000051531.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:23481988:23484356:-1 gene:ENSAMXG00000035923.1 transcript:ENSAMXT00000051531.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.2629 bits (199), Expect = 5.082e-15
Identity = 50/156 (32.05%), Postives = 77/156 (49.36%), Query Frame = 1
Query: 2356 VLQKISEVKLKINQKNIKY*-SELRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIKDYSKKVEGFSKFMVRIMIR*YGMK-------------TVLEKMKLG----QILVFQDFKK*MILYTDASFVTFGTVLSQKIYG 2769
            V  ++S+  LK+     K   S +++LGH+++  GI  D  K+ A++ + +PK +  LR+FLG+  YY RF+K +S+      + +    I+    K             T  E +K G     +L F DF    +LYTDAS    G VLSQK  G
Sbjct:   52 VFSRLSQQGLKLKPDKCKLLRSSVQYLGHVVSDAGIAPDPDKVTAVQQWRVPKFITELRAFLGLAGYYRRFVKGFSQTAAPLHRLLGGHSIKKSKAKALCPPWKWANECETAFESLKQGLVQAPVLAFADFTLPFLLYTDASHRGLGAVLSQKQDG 207          
BLAST of Retrotransposable element vs. Ensembl Cavefish
Match: ENSAMXT00000048059.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001896.1:45492:48938:1 gene:ENSAMXG00000034382.1 transcript:ENSAMXT00000048059.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.4925 bits (197), Expect = 1.232e-14
Identity = 49/156 (31.41%), Postives = 76/156 (48.72%), Query Frame = 1
Query: 2356 VLQKISEVKLKINQKNIKY*-SELRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIKDYSKKVEGFSKFMVRIMIR*YGMK-------------TVLEKMKLG----QILVFQDFKK*MILYTDASFVTFGTVLSQKIYG 2769
            V  ++S+  LK+     K   S +++LGH+++  GI  D  K+ A++ + +PK +  LR+FLG+  YY RF+K +S+      + +     +    K             T  E +K G     +L F DF    +LYTDAS    G VLSQK  G
Sbjct:  313 VFSRLSQQGLKLKPDKCKLLRSSVQYLGHVVSDAGIAPDPDKVMAVQQWRVPKSITELRAFLGLAGYYRRFVKGFSQIAAPLHRLLGGHPTKKSKAKALCPPWKWSNECETAFESLKQGLVQAPVLAFADFTLPFLLYTDASHRGLGAVLSQKQDG 468          
BLAST of Retrotransposable element vs. Ensembl Cavefish
Match: ENSAMXT00000048130.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000027.1:9314169:9318317:-1 gene:ENSAMXG00000039110.1 transcript:ENSAMXT00000048130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.7221 bits (195), Expect = 2.066e-14
Identity = 53/167 (31.74%), Postives = 82/167 (49.10%), Query Frame = 1
Query: 2356 VLQKISEVKLKINQKNIKY*SE-LRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIKDYSKKVEGFSKFMVRIMIR*YGMK----------------------------TVLEKMKLGQILVFQDFKK*MILYTDASFVTFGTVLSQKIYG 2769
            VLQ++ E  LK++ +  K+  + +R+LGHI++  G++ D  KI  +K++  PK +K LRSFLG   YY RFI+D+SK V+  ++       +  G K                            TV+ K+    +L F +     IL+TDAS V  G  L Q+  G
Sbjct:  362 VLQRLKEYGLKLSPEKCKFFQKSVRYLGHIVSSDGVKTDPEKIAVLKNWPSPKNLKELRSFLGFAGYYRRFIRDFSKIVKPLNELTAGYAPKRKGCKLTKSQNQYYKPKELFGDRWTENCQEAFDTVIAKLTSAPVLGFANPSLPYILHTDASTVGLGAALYQEQDG 528          
BLAST of Retrotransposable element vs. Ensembl Medaka
Match: ENSORLT00000033871.1 (pep primary_assembly:ASM223467v1:5:24767545:24770648:1 gene:ENSORLG00000024878.1 transcript:ENSORLT00000033871.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.5001 bits (210), Expect = 3.190e-16
Identity = 53/167 (31.74%), Postives = 86/167 (51.50%), Query Frame = 1
Query: 2356 VLQKISEVKLKINQKNIKY*-SELRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIKDYSKKVEGFSKFMVRIMI------------------R*YGMK----------TVLEKMKLGQILVFQDFKK*MILYTDASFVTFGTVLSQKIYG 2769
            VL ++    LK++ +  K+  + +R+LGHI+++ G++ D  K+EA+K++ +PK +K LRSFLG   YY RFI+DYSK V+  +   V                        +G +          T++EK+    IL F + K   +L+TDAS +  G  L Q+  G
Sbjct:  359 VLNRLRAYGLKLSLEKCKFFQTSVRYLGHIVSQHGVETDPEKVEALKTWPVPKNLKELRSFLGFAGYYRRFIRDYSKIVKPLNDLTVGYPPLRKSCSRGANKEQYFHVKEPFGARWTQSCQEAFETIIEKLTTAPILAFANPKLPYVLHTDASTIGLGAALYQEQEG 525          
BLAST of Retrotransposable element vs. Ensembl Medaka
Match: ENSORLT00000037716.1 (pep primary_assembly:ASM223467v1:20:9739400:9742664:-1 gene:ENSORLG00000027308.1 transcript:ENSORLT00000037716.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.337 bits (194), Expect = 2.118e-14
Identity = 39/127 (30.71%), Postives = 69/127 (54.33%), Query Frame = 1
Query: 2419 ELRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIKDYSKKVEGFSKFMVRI-MIR*YGMKTVL-------------EKMKLGQILVFQDFKK*MILYTDASFVTFGTVLSQ 2757
            E++FLGHI+++ G++ D  K++A++ + IP  +K +R+FLG+  YY RF+  ++      +  +V I   +  G + ++             E +    IL + DF K  ++YTDAS    G VL+Q
Sbjct:  314 EVKFLGHIVDRSGVRPDPEKVKAVQDWPIPSTIKGVRAFLGLAGYYRRFVAGFANIARPLNSLLVGIPATKRSGTQRIVWTPDCKASFDALKEALTQAPILAYADFNKPFVVYTDASHHGLGAVLAQ 440          
BLAST of Retrotransposable element vs. Ensembl Medaka
Match: ENSORLT00000034171.1 (pep primary_assembly:ASM223467v1:20:12459257:12462301:-1 gene:ENSORLG00000022683.1 transcript:ENSORLT00000034171.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 8.922e-14
Identity = 52/163 (31.90%), Postives = 81/163 (49.69%), Query Frame = 1
Query: 2353 TVLQKISEVKLKINQKNIKY*S-ELRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIKDYSKKVEGFSKFM---VRIMIR*YGMKTVLE---KMKLGQILVFQDFKK*MILYTDASFVTFGTVLSQKIYGIWIAKNDYERCDYIARK 2820
            TVLQ++ E +L    +  ++ + + RFLGH+++  G+Q+D +K++A+  + +P   K L+ FLG  N+Y RFI+ +S       K     VR +      KT  E   +     IL   D  K  I+  DAS    G VLSQ+      + N    C Y +RK
Sbjct:  278 TVLQRLLENQLYCKAEKCEFHTKQTRFLGHVVSPGGVQMDSAKVKAVLEWPVPSGRKQLQRFLGFANFYRRFIRGFSGVAAPLHKLTSAKVRFVWDEGADKTFTELKRRFSTAPILTQPDPSKQFIVEVDASESGVGAVLSQR-----ASDNKVHPCAYFSRK 435          
BLAST of Retrotransposable element vs. Ensembl Medaka
Match: ENSORLT00000040077.1 (pep primary_assembly:ASM223467v1:11:4916397:4919081:1 gene:ENSORLG00000025268.1 transcript:ENSORLT00000040077.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.6406 bits (187), Expect = 1.439e-13
Identity = 47/167 (28.14%), Postives = 79/167 (47.31%), Query Frame = 1
Query: 2356 VLQKISEVKLKIN-QKNIKY*SELRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIKDYSKKVEGFSKFMVRIMIR*YGMKT----------------------------VLEKMKLGQILVFQDFKK*MILYTDASFVTFGTVLSQKIYG 2769
            VL K+ E  LK++ +K + + +E+++LGH++++ G++ D  KI  + ++ +PK +K L+SFLG   YY RF++ +S   +               MK                             ++EK+    +L F D +K   L+TDAS    G VL QK  G
Sbjct:   74 VLNKLKEFGLKLSLEKCVFFQTEVKYLGHVVSQEGVKTDPDKISTLLTWPVPKTLKELKSFLGFVGYYRRFVQGFSTITKPLHDLTAGYPPTQKNMKPLVKPGAYLDPKEPFRERWTPICQQAFNKIIEKLTTAPVLAFADPQKPYTLHTDASSTGLGAVLDQKHDG 240          
BLAST of Retrotransposable element vs. Ensembl Medaka
Match: ENSORLT00000033726.1 (pep primary_assembly:ASM223467v1:14:24352555:24357012:-1 gene:ENSORLG00000024900.1 transcript:ENSORLT00000033726.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.8702 bits (185), Expect = 3.001e-13
Identity = 53/167 (31.74%), Postives = 86/167 (51.50%), Query Frame = 1
Query: 2356 VLQKISEVKLKIN-QKNIKY*SELRFLGHIINKVGIQIDQSKIEAIKSF*IPKCVKNLRSFLGICNYYWRFIKDYSKKVE-------GF--SKFMVRIMIR-------------------*YGMKTVLEKMKLGQILVFQDFKK*MILYTDASFVTFGTVLSQKIYG 2769
            VL K+ E  LK++  K I + + +++LGHI+++ G++ D  KI A+ S+ +PK +K LRSFLG   YY RF+K YS  V+       G+  S+   + +I+                        T+++K+    +L F D +K  +L+TDA     G VL Q+  G
Sbjct:  489 VLNKLKEYGLKLSIDKCIFFQTSVKYLGHIVSQDGVRTDPEKISALTSWPVPKTLKELRSFLGFAGYYRRFVKGYSFIVKPLHDLTAGYPPSQKKQKPLIKKQEYHNPKEPFGGRWTVECQQAFDTIIQKLTSAPVLAFADPQKPYLLHTDACSTGLGAVLYQEHEG 655          
BLAST of Retrotransposable element vs. Planmine SMEST
Match: SMESG000050587.1 (SMESG000050587.1)

HSP 1 Score: 176.407 bits (446), Expect = 1.438e-85
Identity = 93/128 (72.66%), Postives = 102/128 (79.69%), Query Frame = 1
Query:  565 KKQ*FNVQNKDNLCFINSVLDILKFDKI*KDRERPTKYLPYLTELVNDFNDMPMKLYDIPIFEKKNPGLAINVLIYNSANPVNNGSTVMKHPCLNIIHRKKVTGVDPIYLLLIKEVKKY-FTAVNNLQ 945
            KK   NVQN DNLCFI SVL +LKFDKI KDR RP KYLPY+ +LV D NDMPMKL DIP FEKKNPGLAINV+IYN+ N  +    +MKHP LNIIHR KVTGVDPIYLLLIKE +KY +TAV NLQ
Sbjct: 1506 KKAIVNVQNTDNLCFIYSVLGVLKFDKIKKDRNRPRKYLPYMNDLVYDPNDMPMKLCDIPTFEKKNPGLAINVMIYNNENFEDREELIMKHPYLNIIHRTKVTGVDPIYLLLIKEGEKYHYTAVTNLQ 1633          

HSP 2 Score: 69.3218 bits (168), Expect = 1.438e-85
Identity = 35/60 (58.33%), Postives = 45/60 (75.00%), Query Frame = 3
Query:    3 QTKTFNPYPKFYNDYRAHLTQFNDDKISLFKSGVKRKCTMSSEIFEKINIKDIIRAGV*L 182
            QT+T +PY KFYND++ HLTQF  DK S+FK  +KRK T+ SEI EKI IKD ++ G+ L
Sbjct: 1305 QTQTSDPYLKFYNDHKNHLTQFYTDKKSMFKHSLKRKSTIKSEILEKIFIKDELQIGLEL 1364          

HSP 3 Score: 69.3218 bits (168), Expect = 1.438e-85
Identity = 42/60 (70.00%), Postives = 47/60 (78.33%), Query Frame = 3
Query:  405 MVKIN*MEKIVEQTEL--RWELDRIIEVNFKITKVSNISR*S*HSYIFISKGLIVKKAIV 578
            M KIN  EKIVE+TEL   W+++RIIEVNFK+TKVSNISR S HSYI   K LI KKAIV
Sbjct: 1453 MKKIN--EKIVERTELGSSWKINRIIEVNFKVTKVSNISRLSGHSYIQTPKALIGKKAIV 1510          

HSP 4 Score: 48.521 bits (114), Expect = 1.438e-85
Identity = 29/63 (46.03%), Postives = 38/63 (60.32%), Query Frame = 2
Query:  245 VNIDRYNAKDIKLQ-----------QFMKQSKIEFGIQVEFEKD-ENKIICM*NRAVPMISTF 397
            VNI RYN K+I L              MK SK++FG+QVEFEKD E K++ + NRA  + +TF
Sbjct: 1386 VNIGRYNVKEIVLPFSLLEKLKITLNEMKHSKVQFGVQVEFEKDGELKVVSISNRAASVTTTF 1448          

HSP 5 Score: 37.7354 bits (86), Expect = 1.438e-85
Identity = 16/24 (66.67%), Postives = 19/24 (79.17%), Query Frame = 1
Query:  172 GFNYSIVIAEPEIDYDLLRSHQVI 243
            G   S VI EPEI+YDLLRSH++I
Sbjct: 1361 GLELSDVIVEPEIEYDLLRSHRII 1384          

HSP 6 Score: 75.0998 bits (183), Expect = 2.095e-16
Identity = 50/110 (45.45%), Postives = 65/110 (59.09%), Query Frame = 1
Query:  565 KKQ*FNVQNKDNLCFINSVLDILKFDKI*KDRERPTKYLPYLTELVNDF-NDMPMKLYDIPIFEKKNP--GLAINVLIYNS--ANPVNNGSTVMKHPCLNIIHRKKVTGV 879
            KK   NV+N D+ CFI SVL ILK D + K+RER + Y  ++ EL  D   D PM+L +IP FE+ N    LAINV  YN+  +  +N+   V  HP L +IHR K   V
Sbjct:  584 KKAIVNVKNTDHSCFIYSVLSILKRDIVLKNRERVSSYTTFMDELNYDLITDCPMRLCNIPKFERNNSDLNLAINVFEYNNTPSKQLNDIDYVPHHPHLALIHRTKKLAV 693          

HSP 7 Score: 31.5722 bits (70), Expect = 2.095e-16
Identity = 16/41 (39.02%), Postives = 26/41 (63.41%), Query Frame = 3
Query:  456 WELDRIIEVNFKITKVSNISR*S*HSYIFISKGLIVKKAIV 578
            W + +I E++F +T    +SR + HS+I   + L+ KKAIV
Sbjct:  548 WRVVKIREIDFILTAYYPVSRLAGHSFIPTPESLVGKKAIV 588          
BLAST of Retrotransposable element vs. Planmine SMEST
Match: SMESG000050587.1 (SMESG000050587.1)

HSP 1 Score: 176.022 bits (445), Expect = 2.256e-85
Identity = 93/129 (72.09%), Postives = 102/129 (79.07%), Query Frame = 1
Query:  565 KKQ*FNVQNKDNLCFINSVLDILKFDKI*KDRERPTKYLPYLTELVNDFNDMPMKLYDIPIFEKKNPGLAINVLIYNSANPVNNGSTVMKHPCLNIIHRKKVTGVDPIYLLLIKEVKKY-FTAVNNLQK 948
            KK   NVQN DNLCFI SVL +LKFDKI KDR RP KYLPY+ +LV D NDMPMKL DIP FEKKNPGLAINV+IYN+ N  +    +MKHP LNIIHR KVTGVDPIYLLLIKE +KY +TAV NLQ 
Sbjct: 1526 KKAIVNVQNTDNLCFIYSVLGVLKFDKIKKDRNRPRKYLPYMNDLVYDPNDMPMKLCDIPTFEKKNPGLAINVMIYNNENFEDREELIMKHPYLNIIHRTKVTGVDPIYLLLIKEGEKYHYTAVTNLQS 1654          

HSP 2 Score: 69.3218 bits (168), Expect = 2.256e-85
Identity = 42/60 (70.00%), Postives = 47/60 (78.33%), Query Frame = 3
Query:  405 MVKIN*MEKIVEQTEL--RWELDRIIEVNFKITKVSNISR*S*HSYIFISKGLIVKKAIV 578
            M KIN  EKIVE+TEL   W+++RIIEVNFK+TKVSNISR S HSYI   K LI KKAIV
Sbjct: 1473 MKKIN--EKIVERTELGSSWKINRIIEVNFKVTKVSNISRLSGHSYIQTPKALIGKKAIV 1530          

HSP 3 Score: 68.9366 bits (167), Expect = 2.256e-85
Identity = 35/60 (58.33%), Postives = 45/60 (75.00%), Query Frame = 3
Query:    3 QTKTFNPYPKFYNDYRAHLTQFNDDKISLFKSGVKRKCTMSSEIFEKINIKDIIRAGV*L 182
            QT+T +PY KFYND++ HLTQF  DK S+FK  +KRK T+ SEI EKI IKD ++ G+ L
Sbjct: 1325 QTQTSDPYLKFYNDHKNHLTQFYTDKKSMFKHSLKRKSTIKSEILEKIFIKDELQIGLEL 1384          

HSP 4 Score: 48.521 bits (114), Expect = 2.256e-85
Identity = 29/63 (46.03%), Postives = 38/63 (60.32%), Query Frame = 2
Query:  245 VNIDRYNAKDIKLQ-----------QFMKQSKIEFGIQVEFEKD-ENKIICM*NRAVPMISTF 397
            VNI RYN K+I L              MK SK++FG+QVEFEKD E K++ + NRA  + +TF
Sbjct: 1406 VNIGRYNVKEIVLPFSLLEKLKITLNEMKHSKVQFGVQVEFEKDGELKVVSISNRAASVTTTF 1468          

HSP 5 Score: 37.7354 bits (86), Expect = 2.256e-85
Identity = 16/24 (66.67%), Postives = 19/24 (79.17%), Query Frame = 1
Query:  172 GFNYSIVIAEPEIDYDLLRSHQVI 243
            G   S VI EPEI+YDLLRSH++I
Sbjct: 1381 GLELSDVIVEPEIEYDLLRSHRII 1404          

HSP 6 Score: 90.5077 bits (223), Expect = 4.989e-21
Identity = 60/134 (44.78%), Postives = 83/134 (61.94%), Query Frame = 1
Query:  565 KKQ*FNVQNKDNLCFINSVLDILKFDKI*KDRERPTKYLPYLTELVNDF-NDMPMKLYDIPIFEKKNP--GLAINVLIYNS--ANPVNNGSTVMKHPCLNIIHRKKVTGVDPIYLLLIKEVKKY-FTAVNNLQK 948
            KK   NV+N D+ CFI SVL ILK D + K+RER + Y  ++ EL  D   D PM+L +IP FE+ N    LAINV  YN+  +  +N+   V  HP L +IHR KV G +PI LLL+++   + +TA+ NL +
Sbjct:  616 KKAIVNVKNTDHSCFIYSVLSILKRDIVLKNRERVSSYTTFMDELNYDLITDCPMRLCNIPKFERNNSDLNLAINVFEYNNTPSKQLNDIDYVPHHPHLALIHRTKVIGGNPINLLLLQDGDNFHYTAIFNLNR 749          

HSP 7 Score: 31.5722 bits (70), Expect = 4.989e-21
Identity = 16/41 (39.02%), Postives = 26/41 (63.41%), Query Frame = 3
Query:  456 WELDRIIEVNFKITKVSNISR*S*HSYIFISKGLIVKKAIV 578
            W + +I E++F +T    +SR + HS+I   + L+ KKAIV
Sbjct:  580 WRVVKIREIDFILTAYYPVSRLAGHSFIPTPESLVGKKAIV 620          
BLAST of Retrotransposable element vs. Planmine SMEST
Match: SMESG000018611.1 (SMESG000018611.1)

HSP 1 Score: 169.088 bits (427), Expect = 2.383e-83
Identity = 90/129 (69.77%), Postives = 101/129 (78.29%), Query Frame = 1
Query:  565 KKQ*FNVQNKDNLCFINSVLDILKFDKI*KDRERPTKYLPYLTELVNDFNDMPMKLYDIPIFEKKNPGLAINVLIYNSANPVNNGSTVMKHPCLNIIHRKKVTGVDPIYLLLIKEVKKY-FTAVNNLQK 948
            KK   NVQN DNLCFI SVL +LK DKI KDR+RP KYLPY+ +LV D NDMPMKL DIP F+KKNPGLAINV+IYN+ N  +    +MKHP LNII R KVTGVDPIYLLLIKE +KY +TAV NLQ 
Sbjct: 1388 KKAIVNVQNTDNLCFIYSVLAVLKSDKIKKDRDRPRKYLPYMNDLVYDPNDMPMKLCDIPTFKKKNPGLAINVMIYNNENFEDREELIMKHPYLNIIQRTKVTGVDPIYLLLIKEGEKYHYTAVTNLQS 1516          

HSP 2 Score: 70.0922 bits (170), Expect = 2.383e-83
Identity = 36/60 (60.00%), Postives = 45/60 (75.00%), Query Frame = 3
Query:    3 QTKTFNPYPKFYNDYRAHLTQFNDDKISLFKSGVKRKCTMSSEIFEKINIKDIIRAGV*L 182
            QT+T +PY KFYND++ HLTQF  DK SLFK  +KRK T+ SEI EKI IKD ++ G+ L
Sbjct: 1187 QTQTSDPYLKFYNDHKNHLTQFYTDKKSLFKHSLKRKSTIKSEILEKIFIKDDLQIGLGL 1246          

HSP 3 Score: 68.1662 bits (165), Expect = 2.383e-83
Identity = 41/60 (68.33%), Postives = 47/60 (78.33%), Query Frame = 3
Query:  405 MVKIN*MEKIVEQTEL--RWELDRIIEVNFKITKVSNISR*S*HSYIFISKGLIVKKAIV 578
            M KIN  EKIVE+TEL   W+++RI+EVNFK+TKVSNISR S HSYI   K LI KKAIV
Sbjct: 1335 MKKIN--EKIVERTELGSSWKINRILEVNFKVTKVSNISRLSGHSYIPTPKALIGKKAIV 1392          

HSP 4 Score: 49.2914 bits (116), Expect = 2.383e-83
Identity = 29/63 (46.03%), Postives = 38/63 (60.32%), Query Frame = 2
Query:  245 VNIDRYNAKDIKLQQF-----------MKQSKIEFGIQVEFEKD-ENKIICM*NRAVPMISTF 397
            VNI RYN K+I L              MK SK++FG+QVEFEKD E K++ + NRA  + +TF
Sbjct: 1268 VNIGRYNVKEIVLPSSLLEKLKITLNEMKHSKVQFGVQVEFEKDGELKVVSISNRAASVTTTF 1330          

HSP 5 Score: 37.3502 bits (85), Expect = 2.383e-83
Identity = 15/24 (62.50%), Postives = 19/24 (79.17%), Query Frame = 1
Query:  172 GFNYSIVIAEPEIDYDLLRSHQVI 243
            G   S +I EPEI+YDLLRSH++I
Sbjct: 1243 GLGLSDIIVEPEIEYDLLRSHRII 1266          
BLAST of Retrotransposable element vs. Planmine SMEST
Match: SMESG000018611.1 (SMESG000018611.1)

HSP 1 Score: 169.088 bits (427), Expect = 2.481e-83
Identity = 90/129 (69.77%), Postives = 101/129 (78.29%), Query Frame = 1
Query:  565 KKQ*FNVQNKDNLCFINSVLDILKFDKI*KDRERPTKYLPYLTELVNDFNDMPMKLYDIPIFEKKNPGLAINVLIYNSANPVNNGSTVMKHPCLNIIHRKKVTGVDPIYLLLIKEVKKY-FTAVNNLQK 948
            KK   NVQN DNLCFI SVL +LK DKI KDR+RP KYLPY+ +LV D NDMPMKL DIP F+KKNPGLAINV+IYN+ N  +    +MKHP LNII R KVTGVDPIYLLLIKE +KY +TAV NLQ 
Sbjct: 1442 KKAIVNVQNTDNLCFIYSVLAVLKSDKIKKDRDRPRKYLPYMNDLVYDPNDMPMKLCDIPTFKKKNPGLAINVMIYNNENFEDREELIMKHPYLNIIQRTKVTGVDPIYLLLIKEGEKYHYTAVTNLQS 1570          

HSP 2 Score: 70.0922 bits (170), Expect = 2.481e-83
Identity = 36/60 (60.00%), Postives = 45/60 (75.00%), Query Frame = 3
Query:    3 QTKTFNPYPKFYNDYRAHLTQFNDDKISLFKSGVKRKCTMSSEIFEKINIKDIIRAGV*L 182
            QT+T +PY KFYND++ HLTQF  DK SLFK  +KRK T+ SEI EKI IKD ++ G+ L
Sbjct: 1241 QTQTSDPYLKFYNDHKNHLTQFYTDKKSLFKHSLKRKSTIKSEILEKIFIKDDLQIGLGL 1300          

HSP 3 Score: 68.1662 bits (165), Expect = 2.481e-83
Identity = 41/60 (68.33%), Postives = 47/60 (78.33%), Query Frame = 3
Query:  405 MVKIN*MEKIVEQTEL--RWELDRIIEVNFKITKVSNISR*S*HSYIFISKGLIVKKAIV 578
            M KIN  EKIVE+TEL   W+++RI+EVNFK+TKVSNISR S HSYI   K LI KKAIV
Sbjct: 1389 MKKIN--EKIVERTELGSSWKINRILEVNFKVTKVSNISRLSGHSYIPTPKALIGKKAIV 1446          

HSP 4 Score: 49.2914 bits (116), Expect = 2.481e-83
Identity = 29/63 (46.03%), Postives = 38/63 (60.32%), Query Frame = 2
Query:  245 VNIDRYNAKDIKLQQF-----------MKQSKIEFGIQVEFEKD-ENKIICM*NRAVPMISTF 397
            VNI RYN K+I L              MK SK++FG+QVEFEKD E K++ + NRA  + +TF
Sbjct: 1322 VNIGRYNVKEIVLPSSLLEKLKITLNEMKHSKVQFGVQVEFEKDGELKVVSISNRAASVTTTF 1384          

HSP 5 Score: 37.3502 bits (85), Expect = 2.481e-83
Identity = 15/24 (62.50%), Postives = 19/24 (79.17%), Query Frame = 1
Query:  172 GFNYSIVIAEPEIDYDLLRSHQVI 243
            G   S +I EPEI+YDLLRSH++I
Sbjct: 1297 GLGLSDIIVEPEIEYDLLRSHRII 1320          
BLAST of Retrotransposable element vs. Planmine SMEST
Match: SMESG000017693.1 (SMESG000017693.1)

HSP 1 Score: 172.17 bits (435), Expect = 2.931e-83
Identity = 91/128 (71.09%), Postives = 102/128 (79.69%), Query Frame = 1
Query:  565 KKQ*FNVQNKDNLCFINSVLDILKFDKI*KDRERPTKYLPYLTELVNDFNDMPMKLYDIPIFEKKNPGLAINVLIYNSANPVNNGSTVMKHPCLNIIHRKKVTGVDPIYLLLIKEVKKY-FTAVNNLQ 945
            KK   NVQN DNLCFI SVL +LK DKI KDR+RP KYLPY+ +LV D NDMPMKL DIP FEKKNPGLAINV+IYN+ N  +    +MKHP LNIIHR KV+GVDPIYLLLIKE +KY +TAV NLQ
Sbjct:  937 KKAIVNVQNTDNLCFIYSVLAVLKSDKIKKDRDRPRKYLPYMNDLVYDPNDMPMKLCDIPTFEKKNPGLAINVMIYNNENFEDREELIMKHPYLNIIHRTKVSGVDPIYLLLIKEGEKYHYTAVTNLQ 1064          

HSP 2 Score: 70.0922 bits (170), Expect = 2.931e-83
Identity = 36/60 (60.00%), Postives = 45/60 (75.00%), Query Frame = 3
Query:    3 QTKTFNPYPKFYNDYRAHLTQFNDDKISLFKSGVKRKCTMSSEIFEKINIKDIIRAGV*L 182
            QT+T +PY KFYND++ HLTQF  DK SLFK  +KRK T+ SEI EKI IKD ++ G+ L
Sbjct:  736 QTQTSDPYLKFYNDHKNHLTQFYTDKKSLFKHSLKRKSTIKSEILEKIFIKDDLQIGLGL 795          

HSP 3 Score: 65.855 bits (159), Expect = 2.931e-83
Identity = 40/58 (68.97%), Postives = 45/58 (77.59%), Query Frame = 3
Query:  411 KIN*MEKIVEQTEL--RWELDRIIEVNFKITKVSNISR*S*HSYIFISKGLIVKKAIV 578
            KIN  EKIVE+TEL   W++ RIIEVNFK+TKVSNISR S HSYI   K L+ KKAIV
Sbjct:  886 KIN--EKIVERTELGSSWKISRIIEVNFKVTKVSNISRLSGHSYIPKPKALLGKKAIV 941          

HSP 4 Score: 48.521 bits (114), Expect = 2.931e-83
Identity = 29/63 (46.03%), Postives = 38/63 (60.32%), Query Frame = 2
Query:  245 VNIDRYNAKDIKLQ-----------QFMKQSKIEFGIQVEFEKD-ENKIICM*NRAVPMISTF 397
            VNI RYN K+I L              MK SK++FG+QVEFEKD E K++ + NRA  + +TF
Sbjct:  817 VNIGRYNVKEIVLPFSLFEKLKITLNEMKHSKVQFGVQVEFEKDGELKVVSISNRAASVTTTF 879          

HSP 5 Score: 37.3502 bits (85), Expect = 2.931e-83
Identity = 15/24 (62.50%), Postives = 19/24 (79.17%), Query Frame = 1
Query:  172 GFNYSIVIAEPEIDYDLLRSHQVI 243
            G   S +I EPEI+YDLLRSH++I
Sbjct:  792 GLGLSDIIVEPEIEYDLLRSHRII 815          

HSP 6 Score: 172.17 bits (435), Expect = 8.656e-81
Identity = 91/128 (71.09%), Postives = 102/128 (79.69%), Query Frame = 1
Query:  565 KKQ*FNVQNKDNLCFINSVLDILKFDKI*KDRERPTKYLPYLTELVNDFNDMPMKLYDIPIFEKKNPGLAINVLIYNSANPVNNGSTVMKHPCLNIIHRKKVTGVDPIYLLLIKEVKKY-FTAVNNLQ 945
            KK   NVQN DNLCFI SVL +LK DKI KDR+RP KYLPY+ +LV D NDMPMKL DIP FEKKNPGLAINV+IYN+ N  +    +MKHP LNIIHR KV+GVDPIYLLLIKE +KY +TAV NLQ
Sbjct:  316 KKAIVNVQNTDNLCFIYSVLAVLKSDKIKKDRDRPRKYLPYMNDLVYDPNDMPMKLCDIPTFEKKNPGLAINVMIYNNENFEDREELIMKHPYLNIIHRTKVSGVDPIYLLLIKEGEKYHYTAVTNLQ 443          

HSP 7 Score: 70.0922 bits (170), Expect = 8.656e-81
Identity = 36/60 (60.00%), Postives = 45/60 (75.00%), Query Frame = 3
Query:    3 QTKTFNPYPKFYNDYRAHLTQFNDDKISLFKSGVKRKCTMSSEIFEKINIKDIIRAGV*L 182
            QT+T +PY KFYND++ HLTQF  DK SLFK  +KRK T+ SEI EKI IKD ++ G+ L
Sbjct:  130 QTQTSDPYLKFYNDHKNHLTQFYTDKKSLFKHSLKRKSTIKSEILEKIFIKDDLQIGLGL 189          

HSP 8 Score: 56.9954 bits (136), Expect = 8.656e-81
Identity = 29/41 (70.73%), Postives = 33/41 (80.49%), Query Frame = 3
Query:  456 WELDRIIEVNFKITKVSNISR*S*HSYIFISKGLIVKKAIV 578
            W++ RIIEVNFK+TKVSNISR S HSYI   K L+ KKAIV
Sbjct:  280 WKISRIIEVNFKVTKVSNISRLSGHSYIPTPKALLGKKAIV 320          

HSP 9 Score: 48.9062 bits (115), Expect = 8.656e-81
Identity = 29/63 (46.03%), Postives = 38/63 (60.32%), Query Frame = 2
Query:  245 VNIDRYNAKDIKLQ-----------QFMKQSKIEFGIQVEFEKD-ENKIICM*NRAVPMISTF 397
            VNI RYN K+I L              MK SK++FG+QVEFEKD E K++ + NRA  + +TF
Sbjct:  211 VNIGRYNVKEIVLSFSLFEKLKITLNEMKHSKVQFGVQVEFEKDVELKVVSISNRAASVTTTF 273          

HSP 10 Score: 37.3502 bits (85), Expect = 8.656e-81
Identity = 15/24 (62.50%), Postives = 19/24 (79.17%), Query Frame = 1
Query:  172 GFNYSIVIAEPEIDYDLLRSHQVI 243
            G   S +I EPEI+YDLLRSH++I
Sbjct:  186 GLGLSDIIVEPEIEYDLLRSHRII 209          

HSP 11 Score: 70.0922 bits (170), Expect = 7.240e-17
Identity = 36/60 (60.00%), Postives = 45/60 (75.00%), Query Frame = 3
Query:    3 QTKTFNPYPKFYNDYRAHLTQFNDDKISLFKSGVKRKCTMSSEIFEKINIKDIIRAGV*L 182
            QT+T +PY KFYND++ HLTQF  DK SLFK  +KRK T+ SEI EKI IKD ++ G+ L
Sbjct: 1357 QTQTSDPYLKFYNDHKNHLTQFYTDKKSLFKHSLKRKSTIKSEILEKIFIKDDLQIGLGL 1416          

HSP 12 Score: 37.3502 bits (85), Expect = 7.240e-17
Identity = 15/24 (62.50%), Postives = 19/24 (79.17%), Query Frame = 1
Query:  172 GFNYSIVIAEPEIDYDLLRSHQVI 243
            G   S +I EPEI+YDLLRSH++I
Sbjct: 1413 GLGLSDIIVEPEIEYDLLRSHRII 1436          

HSP 13 Score: 20.4014 bits (41), Expect = 7.240e-17
Identity = 9/13 (69.23%), Postives = 10/13 (76.92%), Query Frame = 2
Query:  245 VNIDRYNAKDIKL 283
            VNI RYN K+I L
Sbjct: 1438 VNIGRYNVKEIVL 1450          
The following BLAST results are available for this feature:
BLAST of Retrotransposable element vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrotransposable element vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrotransposable element vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrotransposable element vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX546500.16.879e-1029.58pep chromosome:GRCz11:23:12926092:12931693:-1 gene... [more]
BX511082.14.743e-928.87pep chromosome:GRCz11:9:14291932:14297132:1 gene:E... [more]
BX511224.15.429e-928.87pep chromosome:GRCz11:2:18017000:18022765:1 gene:E... [more]
CR855320.16.538e-928.87pep chromosome:GRCz11:1:7956030:7961696:1 gene:ENS... [more]
FO704673.18.511e-937.66pep chromosome:GRCz11:12:14545475:14551077:-1 gene... [more]
back to top
BLAST of Retrotransposable element vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000031144.13.376e-1127.41pep primary_assembly:Xenopus_tropicalis_v9.1:8:632... [more]
ENSXETT00000035618.13.753e-1137.21pep primary_assembly:Xenopus_tropicalis_v9.1:2:369... [more]
anxa64.018e-1131.41annexin A6 [Source:Xenbase;Acc:XB-GENE-989741][more]
ENSXETT00000006041.13.165e-1029.01pep primary_assembly:Xenopus_tropicalis_v9.1:6:373... [more]
ENSXETT00000024810.12.193e-928.67pep primary_assembly:Xenopus_tropicalis_v9.1:KV464... [more]
back to top
BLAST of Retrotransposable element vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrotransposable element vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P04323|POL3_DROME1.010e-1131.14Retrovirus-related Pol polyprotein from transposon... [more]
sp|P20825|POL2_DROME1.679e-1133.73Retrovirus-related Pol polyprotein from transposon... [more]
sp|Q8I7P9|POL5_DROME6.068e-1030.77Retrovirus-related Pol polyprotein from transposon... [more]
sp|P10401|POLY_DROME6.141e-1029.76Retrovirus-related Pol polyprotein from transposon... [more]
sp|P10394|POL4_DROME1.065e-732.41Retrovirus-related Pol polyprotein from transposon... [more]
back to top
BLAST of Retrotransposable element vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
F1AGB52.548e-1859.26Pol polyprotein (Fragment) OS=Schmidtea mediterran... [more]
A0A1B6J8231.873e-1536.55Reverse transcriptase domain-containing protein (F... [more]
A0A3Q0JL771.967e-1436.42uncharacterized protein LOC108254503 OS=Diaphorina... [more]
A0A3B5QL733.080e-1433.68Uncharacterized protein OS=Xiphophorus maculatus O... [more]
A0A3Q0JG653.403e-1436.42uncharacterized protein LOC103518485 OS=Diaphorina... [more]
back to top
BLAST of Retrotransposable element vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000039384.11.459e-1627.78pep primary_assembly:Astyanax_mexicanus-2.0:25:211... [more]
ENSAMXT00000049799.14.487e-1531.14pep primary_assembly:Astyanax_mexicanus-2.0:13:118... [more]
ENSAMXT00000051531.15.082e-1532.05pep primary_assembly:Astyanax_mexicanus-2.0:16:234... [more]
ENSAMXT00000048059.11.232e-1431.41pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000048130.12.066e-1431.74pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Retrotransposable element vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrotransposable element vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrotransposable element vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrotransposable element vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000033871.13.190e-1631.74pep primary_assembly:ASM223467v1:5:24767545:247706... [more]
ENSORLT00000037716.12.118e-1430.71pep primary_assembly:ASM223467v1:20:9739400:974266... [more]
ENSORLT00000034171.18.922e-1431.90pep primary_assembly:ASM223467v1:20:12459257:12462... [more]
ENSORLT00000040077.11.439e-1328.14pep primary_assembly:ASM223467v1:11:4916397:491908... [more]
ENSORLT00000033726.13.001e-1331.74pep primary_assembly:ASM223467v1:14:24352555:24357... [more]
back to top
BLAST of Retrotransposable element vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000050587.11.438e-8572.66SMESG000050587.1[more]
SMESG000050587.12.256e-8572.09SMESG000050587.1[more]
SMESG000018611.12.383e-8369.77SMESG000018611.1[more]
SMESG000018611.12.481e-8369.77SMESG000018611.1[more]
SMESG000017693.12.931e-8371.09SMESG000017693.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013953 ID=SMED30013953|Name=Retrotransposable element|organism=Schmidtea mediterranea sexual|type=transcript|length=4527bp
GTCAGACCAAGACTTTTAATCCTTACCCTAAATTTTATAATGATTATAGA
GCGCATTTGACCCAATTTAATGATGATAAAATATCTTTATTTAAAAGCGG
TGTAAAAAGAAAATGTACTATGAGTTCTGAGATATTTGAAAAAATAAATA
TTAAAGATATTATTCGGGCAGGGGTTTAATTATTCCATCGTAATTGCTGA
ACCGGAGATTGATTACGATTTATTACGTTCACATCAAGTTATTAGTGAAT
ATCGATAGATATAATGCTAAAGATATAAAACTTCAACAATTTATGAAACA
ATCAAAAATTGAATTTGGAATCCAGGTGGAATTTGAAAAAGATGAAAACA
AAATAATTTGTATGTAGAATCGTGCTGTTCCTATGATTAGCACTTTCCTT
AATGATGGTAAAAATTAATTAAATGGAAAAAATTGTTGAACAAACAGAAT
TAAGATGGGAATTAGATCGAATAATAGAAGTAAACTTTAAAATAACAAAG
GTCTCCAATATATCTAGGTAATCGTGACATAGCTACATTTTCATATCTAA
AGGATTAATAGTTAAAAAAGCAATAGTTTAATGTACAAAATAAGGATAAT
TTATGTTTCATAAACAGTGTTTTGGATATATTGAAATTTGATAAAATCTA
GAAAGATAGAGAAAGACCAACAAAATATTTACCATACTTGACGGAATTAG
TAAATGACTTTAATGATATGCCTATGAAACTATATGATATTCCAATTTTT
GAGAAGAAAAATCCTGGTTTGGCAATCAATGTGTTAATTTATAATAGTGC
CAACCCAGTGAATAATGGTAGTACTGTAATGAAACACCCTTGTTTGAATA
TAATTCATCGTAAAAAGGTTACTGGAGTGGATCCGATTTATTTGTTATTG
ATAAAAGAGGTCAAAAAATATTTTACTGCGGTGAATAATCTACAAAAGTA
ATGAATGTCAATAAAAACCATGATTTTAACGTTTGGACTAGCTGTTAATG
ATGTTAAATTTGTTTAAATTGATTTTGAAAGCCAAACGATTTTGAAAAGA
ATCAAGAATTATATTGATATTTTATTTGTCAAAAAATGAAGTCCATCTAT
ATTTAATTATTTGATGAATATTTGTCTATTTTAGGTGCTACTTGATTCCG
TTCTGTCTCAGTTTATTTGCTCGCAATTTAATTTATTTCATTTAATTATT
ATGCGCGACCTTCACAATATCATACGTAAACACGAACAATACTTTTCAAT
ATTAATTCAATTTCTGTACAGATTAATTTAAAAAGTGAACTTTGGTGAAG
ATGCAAAATAATTATTTGTCAAACGTTTTGCAGGATTTATTTTTTGATTA
AATTTCAATGAGCCAAAATTTCAGTAAGAACTTATTTGTTGACCAATATT
GTTTGCGCAAATTTTAGCAACGGAGATTTAATATTTACACTGACTTCAGT
CAACAAAGACTCGAAGTTGTTAATAAAAATAATAAAAAATCATGATTAAT
TATATTTAATTGGTTTTCCTCAGATTTTCACCAAATTATTAATGAATTAT
TTAACGCAGAGATTATTCAGCCAAATTCACAACAATTTCCTCACCAACTG
ATAGAAACTCTTTGTCATTCTTCTGACTTATCTCCATCAAAACTCCGAAA
TAAGGCTGGAATAATTATCAATTCTATTTGTATTTGAAAAATAAGTTTTT
TAACTTTTCCGCTATTATTTCTCCTAAGCGTCCGTAAAGGATTAGACTCA
TACTCAAGATAGTTAATATCAAGATTTACCGCCCGGCACCGTTCACATAA
TTCCTGTGTCTAAAAACCAAGTAGACTATCAAAATTACTAATTTGTATAC
TTCTAATTCTAATTTATTTATAGAGATTCTTTTCCATTTATTTTCTTCCA
GTGGCATAGAGTTACTGATAATTAGGTTACCTCTGAATCGCCAACAGAAT
TCTGATAAATCTAAAATGATATGAAACTTTAAGTGTAAGTTTATATTTCA
AAGTACCATTTGAAAAGTACCCTTGGTCTTCTGCAACTTTCTCAGCCAGG
TCCTTAACTGAGCTAGCACTAATGATTAAAAATTGTCCAATGATTATGCT
CTTATTTCCTTAAGTTTTTAATTTATTATTAATTATGTAGTTTATTATCA
ATATATTGAATGAGCACAAAATTGATACATCTGGTGGACAAAGCCGAAAA
GATAGTTTATCTATTTGGAGGAATAAATAAACATGACCATCAAAAATCTA
GAATATAATGATATTTTAAGGAGATTTAATTCACCTTGGAATATCCAATT
AGTTTGCATTAATTTTTACGAATACAATGGAGAAACACTATAAACTGCTG
GAACGGTGTTGCAGAAAATTTCAGAGGTTAAACTAAAAATTAACCAAAAA
AATATCAAATATTGAAGTGAGTTGAGATTCTTAGGTCACATTATAAATAA
AGTTGGTATTCAAATAGATCAAAGCAAAATTGAAGCCATTAAATCGTTCT
AAATACCAAAATGTGTGAAAAATTTAAGGAGTTTCTTGGGCATTTGCAAC
TACTATTGGAGATTTATTAAGGACTACTCAAAAAAAGTCGAAGGCTTCAG
TAAGTTTATGGTAAGAATAATGATAAGATAATATGGAATGAAAACTGTTT
TGGAGAAAATGAAGTTAGGACAAATCCTAGTATTTCAAGATTTTAAGAAA
TAAATGATATTATACACGGATGCAAGCTTTGTCACATTTGGGACAGTCTT
ATCACAGAAAATTTATGGCATATGGATCGCAAAGAATGACTACGAAAGAT
GCGATTATATTGCGAGAAAAGATTTATTATAAAAAGAAATGTTTGTCCGG
ACTATCTGATGAGCCTTAACTGTGGTTTTTTTTGACTATGCGCACTTAAT
GACAATAATCACATTTTTGATATTCCGACTTTGACTAGATTCGACTTAAT
CCCTTTAGTTTTCCAGTTATCTTATTTCAACTAATTTCTATATTTCCTTA
AACCTATTCTGATTTTCTTCAATCTCTATATGAGGCAAAATCCCCACGGT
TTAAAATTTAGATAGTGGAAATAATCCTTTTGATTAATTACTTTTGAACC
ACTTGGCATCCGTTTGGCGGCCTTTGCTTTAATTAAGTTAATTAATTACT
TTTCGTGCGCCTTCCCTCTAATAATCCTTCTCTTATTTGTTCCCATTAAT
AAAGATATCCTTTTTGTTTGCTTTTCTTATTGTTTACCCAACTCGGGTTT
TCTAAAATAATTAACGAATTCCTGTCTTTTACACACTCTACCGCTTTTCG
ACCCTTCCTAAACATATTCTGATAAATTCATTATCACCCTTGTCTAATCT
ATATCTGACTCGTTTGAAACTTTGATGATTGATTGATTTTCTGAAATTTC
GCAATTTTACTGCTTTCTTTTAAAATGATTTTAGATTTACAACCCCAACA
AAACGAATTTATTGTTTTCCTATATAGGAGTAGAAAAAGTGATAAAATGC
ATACGGAAAAAAATTCTAAATGATAGATTTTGAGGTAAAAGCAACAATAT
CAAATTGCGAAGTGTCAAAAAGTGAAAATTGTAACTACAAAAATGAAAAA
TGAATCAAAAGTAATTCAATCATCAAAACCTTTTGAGAAAATATTTGTTG
ACATCTGTGACCCATTGCGAGAAACATTTAACTGGAAAAGATACATATAT
GCAATAATCTACCATTATAGCAAATACATTTCGCTAACAGCAATCCATAA
GCAAGACGAAGAAACAGTTAACAAGATATTTTTAAACAACTGGATTCTAA
AATTTGGTGCCCATAAAGAACTACGTGTACACTGCTGGAAAACATTCGAA
TCGAATAGCATTGAAAATATAGGCCAGATAGCAGAAATAAAAATAGTGTA
TTTACGTTGTGTACAATAGCCCAATTCATAATTTGATCATCATTGAAGTT
TTCCATAAAAGGTATACACAAAATATAATTGGAAAATCATTTTATATTCC
TTTTATGGGGAAACACTTTTATCACTTAACTAAAAATTAACTTAAAGTAA
CTTTCAAAAAAAAATTCAAGTCAACTAAAAGTAATGAAAGTGTGACGATA
AATTTCTCTGTGTATAGCAGATTGAAAAATCAAGCTTCTTACTGGAGTTA
CACAAAAATGTATAAATTTAAAATGGAAATTTATTAAAAATTAATTAAAA
ACTAAGTAAATATATAAAAATTTAAAAATTAAAATTTTTCTGAAGGAGTG
GTAACTGATGACAAATTAAAGTTGAAGACGAATGAAATAATTTCAAAATG
ATAGAAAGCTTGGAAGGAGCCAGAACAAAAAATTAATTAATTAATGTACC
TTATTTATTATTCAAGGAAATTTAAAAAATCATTAGGAAAATTTTAGAGT
TGATAAATTGGTTGGTTACTTAAATTAAATAGGAGGGAAAGTCTTAACAA
TGACTTGTTTGTCTCTAGATGTATATGTGTTAGAAGTCATTAACAAAATC
ATTAAAAAAACAACACAATTAATACAA
back to top

protein sequence of SMED30013953-orf-1

>SMED30013953-orf-1 ID=SMED30013953-orf-1|Name=SMED30013953-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=109bp
MKNESKVIQSSKPFEKIFVDICDPLRETFNWKRYIYAIIYHYSKYISLTA
IHKQDEETVNKIFLNNWILKFGAHKELRVHCWKTFESNSIENIGQIAEIK
IVYLRCVQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR012337RNaseH-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 12..34