DENN domain-containing protein 5B

Overview
NameDENN domain-containing protein 5B
Smed IDSMED30013942
Length (bp)4974
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DENN domain-containing protein 5B (SMED30013942) t-SNE clustered cells

Violin plots show distribution of expression levels for DENN domain-containing protein 5B (SMED30013942) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DENN domain-containing protein 5B (SMED30013942) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DENN domain-containing protein 5B (SMED30013942) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013942

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30013942SMESG000072343.1 dd_Smed_v4_7039_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013942SMESG000072343.1 dd_Smed_v4_7039_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013942SMESG000072343.1 dd_Smed_v4_7039_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013942SMESG000072343.1 dd_Smed_v4_7039_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30013942SMESG000072343.1 dd_Smed_v4_7039_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013942SMESG000072343.1 dd_Smed_v4_7039_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30013942SMESG000072343.1 dd_Smed_v4_7039_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013942SMESG000072343.1 dd_Smed_v4_10857_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013942SMESG000072343.1 dd_Smed_v4_7039_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DENN domain-containing protein 5B vs. Ensembl Human
Match: DENND5A (DENN domain containing 5A [Source:HGNC Symbol;Acc:HGNC:19344])

HSP 1 Score: 409.068 bits (1050), Expect = 2.134e-119
Identity = 304/983 (30.93%), Postives = 477/983 (48.52%), Query Frame = 2
Query:  140 LVDYFFVCGLDYNVGLDTYELS--------TESNEYSSPHCIP----------PLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARD-SGWYSYSNISVTGL--CGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLV--GSINHGNITTRPFSGRRGFCGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIV-DKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIR--SYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRKK 3010
              DYF +CGLD   GL+  ELS        +++ + +SP              PL R +   +L  +P++     F +D ++  LCMP GL  F T   P+ P  H FI+TRED +R +G +L F EE+ +++I +    +Q++Y + HN+E   +H            P    RD S      +  VT L    S+    + LY  K I +++   ++   +S L  +   V++                                + LESY++N+L+E   P  G S+   G      CQ P   +LP+F+ P++++ E+LG+E++ ++++C LLE+++++ SQ Y+ LM VAE IT L+FPF W HVY PILP +  HFL+APVP++MG+  N  D+   ++LP +A +C+V+ID   ++  +D+P FP ++   +E++E+L+  G    GN+     + +             + SEL S      +     L  Y+    L+ EN TI  L  +      ++R    TG S+           +  DP             N+D   V  D  ++  ++   N  +RE+F N F  +F DY+ F+I P    +  ++F  R+  +Q FDKA FLS+QPE +LPFLS FLETQMF  F++ KI+    +D  P L +F+ ++ K +             +L++R  + R+    K     E +  ++L         + PH+LD    +IG                   + KY   +  F       FP LQ D L + P     +K              P ++R+K R    T  +               N Q+EKY+ E      +T      +P L N+ P  +AQ +W FV  LL+EC+ KTKRM++EKM G+EA+ELGHG++ ++G+EENTL+A LCDLLERIW HGL  K GKSALW+HL  Y D  ++K
Sbjct:   15 FADYFVICGLDTETGLEPDELSALCQYIQASKARDGASPFISSTTEGENFEQTPLRRTFKSKVLARYPENVEWNPFDQD-AVGMLCMPKGL-AFKTQADPREPQFHAFIITREDGSRTFGFALTFYEEVTSKQICSA---MQTLYHM-HNAEYDVLHA-----------PPADDRDQSSMEDGEDTPVTKLQRFNSYDISRDTLYVSKCICLITPMSFMKACRSVLEQLHQAVTSPQ---------------------------PPPLPLESYIYNVLYEVPLPPPGRSLKFSGVYGPIICQRPSTNELPLFDFPVKEVFELLGVENVFQLFTCALLEFQILLYSQHYQRLMTVAETITALMFPFQWQHVYVPILPASLLHFLDAPVPYLMGLHSNGLDDRSKLELPQEANLCFVDIDNHFIELPEDLPQFPNKLEFVQEVSEILMAFGIPPEGNLHCSESASKLKRL---------RASELVSDKRNGNIAGS-PLHSYE----LLKENETIARLQAL------VKR----TGVSL-------EKLEVREDPSS-----------NKD-LKVQCDEEEL--RIYQLNIQIREVFANRFTQMFADYEVFVIQPSQ--DKESWFTNREQ-MQNFDKASFLSDQPEPYLPFLSRFLETQMFASFIDNKIMCHDDDDKDPVLRVFDSRVDKIR-------------LLNVRTPTLRTSMYQKCTTVDEAEKAIELRLAKIDHTAIHPHLLDM---KIG-------------------QGKY---EPGF-------FPKLQSDVLSTGPASNKWTKR-----------NAPAQWRRKDRQKQHTEHLRLD------------NDQREKYIQEA-----RTMGSTIRQPKLSNLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKM-GREAVELGHGEVNITGVEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQDNRQRK 831          

HSP 2 Score: 254.988 bits (650), Expect = 3.641e-68
Identity = 170/435 (39.08%), Postives = 253/435 (58.16%), Query Frame = 2
Query: 3302 NWNQNLTGSLGRSGGISINTGSSKSIDLESIFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKD 4603
            N  + LT     + GI +++   KS D  S+  P R SL+ D+  I+++ +I TDVG ARA+VRL++EKKLLS HLK+LL D  L K+LYKR+AFLRC++E+EQFL+HLL+  AV+Y+ FTN++  I + Y + I   K+   G+  TAN W C++G+   T    IP+ + +  FE  NLG LT+++IGHDNSG+  KW +++V+++N ITG  YKFPC  WLGKG+DD S ER+LVGE++  ++ +++E     P               + SV+    T               +K +     IQE +G AVN +VK+F++ ++ER  L           TLLLCG  GLV ++E+ F+ GFKS RLF K  ++WD+LEK  + +              NE     N     + FC+ ++ I +  ++IGKD
Sbjct:  827 NRQRKLTSGSLSTSGILLDSERRKS-DASSLMPPLRISLIQDMRHIQNIGEIKTDVGKARAWVRLSMEKKLLSRHLKQLLSDHELTKKLYKRYAFLRCDDEKEQFLYHLLSFNAVDYFCFTNVFTTILIPYHILIVPSKKLG-GSMFTANPWICISGELGETQIMQIPRNVLEMTFECQNLGKLTTVQIGHDNSGLYAKWLVEYVMVRNEITGHTYKFPCGRWLGKGMDDGSLERILVGELL-TSQPEVDERPCRTPPLQQ-----------SPSVIRRLVTIS-----------PNNKPKLNTGQIQESIGEAVNGIVKHFHKPEKERGSL-----------TLLLCGECGLVSALEQAFQHGFKSPRLF-KNVFIWDFLEKAQTYYETLEK---------NEVVPEENWHTRARNFCRFVTAINNTPRNIGKD 1215          
BLAST of DENN domain-containing protein 5B vs. Ensembl Human
Match: DENND5A (DENN domain containing 5A [Source:HGNC Symbol;Acc:HGNC:19344])

HSP 1 Score: 409.453 bits (1051), Expect = 3.709e-119
Identity = 304/983 (30.93%), Postives = 477/983 (48.52%), Query Frame = 2
Query:  140 LVDYFFVCGLDYNVGLDTYELS--------TESNEYSSPHCIP----------PLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARD-SGWYSYSNISVTGL--CGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLV--GSINHGNITTRPFSGRRGFCGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIV-DKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIR--SYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRKK 3010
              DYF +CGLD   GL+  ELS        +++ + +SP              PL R +   +L  +P++     F +D ++  LCMP GL  F T   P+ P  H FI+TRED +R +G +L F EE+ +++I +    +Q++Y + HN+E   +H            P    RD S      +  VT L    S+    + LY  K I +++   ++   +S L  +   V++                                + LESY++N+L+E   P  G S+   G      CQ P   +LP+F+ P++++ E+LG+E++ ++++C LLE+++++ SQ Y+ LM VAE IT L+FPF W HVY PILP +  HFL+APVP++MG+  N  D+   ++LP +A +C+V+ID   ++  +D+P FP ++   +E++E+L+  G    GN+     + +             + SEL S      +     L  Y+    L+ EN TI  L  +      ++R    TG S+           +  DP             N+D   V  D  ++  ++   N  +RE+F N F  +F DY+ F+I P    +  ++F  R+  +Q FDKA FLS+QPE +LPFLS FLETQMF  F++ KI+    +D  P L +F+ ++ K +             +L++R  + R+    K     E +  ++L         + PH+LD    +IG                   + KY   +  F       FP LQ D L + P     +K              P ++R+K R    T  +               N Q+EKY+ E      +T      +P L N+ P  +AQ +W FV  LL+EC+ KTKRM++EKM G+EA+ELGHG++ ++G+EENTL+A LCDLLERIW HGL  K GKSALW+HL  Y D  ++K
Sbjct:   15 FADYFVICGLDTETGLEPDELSALCQYIQASKARDGASPFISSTTEGENFEQTPLRRTFKSKVLARYPENVEWNPFDQD-AVGMLCMPKGL-AFKTQADPREPQFHAFIITREDGSRTFGFALTFYEEVTSKQICSA---MQTLYHM-HNAEYDVLHA-----------PPADDRDQSSMEDGEDTPVTKLQRFNSYDISRDTLYVSKCICLITPMSFMKACRSVLEQLHQAVTSPQ---------------------------PPPLPLESYIYNVLYEVPLPPPGRSLKFSGVYGPIICQRPSTNELPLFDFPVKEVFELLGVENVFQLFTCALLEFQILLYSQHYQRLMTVAETITALMFPFQWQHVYVPILPASLLHFLDAPVPYLMGLHSNGLDDRSKLELPQEANLCFVDIDNHFIELPEDLPQFPNKLEFVQEVSEILMAFGIPPEGNLHCSESASKLKRL---------RASELVSDKRNGNIAGS-PLHSYE----LLKENETIARLQAL------VKR----TGVSL-------EKLEVREDPSS-----------NKD-LKVQCDEEEL--RIYQLNIQIREVFANRFTQMFADYEVFVIQPSQ--DKESWFTNREQ-MQNFDKASFLSDQPEPYLPFLSRFLETQMFASFIDNKIMCHDDDDKDPVLRVFDSRVDKIR-------------LLNVRTPTLRTSMYQKCTTVDEAEKAIELRLAKIDHTAIHPHLLDM---KIG-------------------QGKY---EPGF-------FPKLQSDVLSTGPASNKWTKR-----------NAPAQWRRKDRQKQHTEHLRLD------------NDQREKYIQEA-----RTMGSTIRQPKLSNLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKM-GREAVELGHGEVNITGVEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQDNRQRK 831          

HSP 2 Score: 303.138 bits (775), Expect = 2.057e-83
Identity = 198/504 (39.29%), Postives = 290/504 (57.54%), Query Frame = 2
Query: 3302 NWNQNLTGSLGRSGGISINTGSSKSIDLESIFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            N  + LT     + GI +++   KS D  S+  P R SL+ D+  I+++ +I TDVG ARA+VRL++EKKLLS HLK+LL D  L K+LYKR+AFLRC++E+EQFL+HLL+  AV+Y+ FTN++  I + Y + I   K+   G+  TAN W C++G+   T    IP+ + +  FE  NLG LT+++IGHDNSG+  KW +++V+++N ITG  YKFPC  WLGKG+DD S ER+LVGE++  ++ +++E     P               + SV+    T               +K +     IQE +G AVN +VK+F++ ++ER  L           TLLLCG  GLV ++E+ F+ GFKS RLF K  ++WD+LEK  + +              NE     N     + FC+ ++ I +  ++IGKDGKFQ  V L  RDH L   I LL     T   YE+    +D+ L + LI++L +L +F I LE +L  G
Sbjct:  827 NRQRKLTSGSLSTSGILLDSERRKS-DASSLMPPLRISLIQDMRHIQNIGEIKTDVGKARAWVRLSMEKKLLSRHLKQLLSDHELTKKLYKRYAFLRCDDEKEQFLYHLLSFNAVDYFCFTNVFTTILIPYHILIVPSKKLG-GSMFTANPWICISGELGETQIMQIPRNVLEMTFECQNLGKLTTVQIGHDNSGLYAKWLVEYVMVRNEITGHTYKFPCGRWLGKGMDDGSLERILVGELL-TSQPEVDERPCRTPPLQQ-----------SPSVIRRLVTIS-----------PNNKPKLNTGQIQESIGEAVNGIVKHFHKPEKERGSL-----------TLLLCGECGLVSALEQAFQHGFKSPRLF-KNVFIWDFLEKAQTYYETLEK---------NEVVPEENWHTRARNFCRFVTAINNTPRNIGKDGKFQMLVCLGARDHLLHHWIALLADCPITAHMYEDVALIKDHTLVNSLIRVLQTLQEFNITLETSLVKG 1284          
BLAST of DENN domain-containing protein 5B vs. Ensembl Human
Match: DENND5A (DENN domain containing 5A [Source:HGNC Symbol;Acc:HGNC:19344])

HSP 1 Score: 392.889 bits (1008), Expect = 1.297e-117
Identity = 293/946 (30.97%), Postives = 459/946 (48.52%), Query Frame = 2
Query:  140 LVDYFFVCGLDYNVGLDTYELSTESNEYSSPHCIPPLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARD-SGWYSYSNISVTGL--CGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLV--GSINHGNITTRPFSGRRGFCGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTI-VPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIV-DKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIR--SYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNK 2950
              DYF +CGLD   GL+  ELS E+ E +      PL R +   +L  +P++     F +D ++  LCMP GL  F T   P+ P  H FI+TRED +R +G +L F EE+ +++I +    +Q++Y + HN+E   +H            P    RD S      +  VT L    S+    + LY  K I +++   ++   +S L  +   V++                                + LESY++N+L+E   P  G S+   G      CQ P   +LP+F+ P++++ E+LG+E++ ++++C LLE+++++ SQ Y+ LM VAE IT L+FPF W HVY PILP +  HFL+APVP++MG+  N  D+   ++LP +A +C+V+ID   ++  +D+P FP ++   +E++E+L+  G    GN+     + +             + SEL S      +     L  Y+    L+ EN TI  L  +      ++R    TG S+           +  DP             N+D  +    +  +IY      N  +RE+F N F  +F DY+ F+I P    +  ++F  R+  +Q FDKA FLS+QPE +LPFLS FLETQMF  F++ KI+    +D  P L +F+ ++ K +             +L++R  + R+    K     E +  ++L         + PH+LD    +IG                   + KY   +  F       FP LQ D L + P     +K              P ++R+K R    T  +               N Q+EKY+ E      +T      +P L N+ P  +AQ +W FV  LL+EC+ KTKRM++EKM G+EA+ELGHG++ ++G+EENTL+A LCDLLERIW HGL  K
Sbjct:   15 FADYFVICGLDTETGLEPDELSGENFEQT------PLRRTFKSKVLARYPENVEWNPFDQD-AVGMLCMPKGLA-FKTQADPREPQFHAFIITREDGSRTFGFALTFYEEVTSKQICSA---MQTLYHM-HNAEYDVLHA-----------PPADDRDQSSMEDGEDTPVTKLQRFNSYDISRDTLYVSKCICLITPMSFMKACRSVLEQLHQAVTSPQ---------------------------PPPLPLESYIYNVLYEVPLPPPGRSLKFSGVYGPIICQRPSTNELPLFDFPVKEVFELLGVENVFQLFTCALLEFQILLYSQHYQRLMTVAETITALMFPFQWQHVYVPILPASLLHFLDAPVPYLMGLHSNGLDDRSKLELPQEANLCFVDIDNHFIELPEDLPQFPNKLEFVQEVSEILMAFGIPPEGNLHCSESASKLKRL---------RASELVSDKRNGNIAGS-PLHSYE----LLKENETIARLQAL------VKR----TGVSL-------EKLEVREDPSS-----------NKDLKVQCDEEELRIY----QLNIQIREVFANRFTQMFADYEVFVIQPSQ--DKESWFTNREQ-MQNFDKASFLSDQPEPYLPFLSRFLETQMFASFIDNKIMCHDDDDKDPVLRVFDSRVDKIR-------------LLNVRTPTLRTSMYQKCTTVDEAEKAIELRLAKIDHTAIHPHLLDM---KIG-------------------QGKY---EPGF-------FPKLQSDVLSTGPASNKWTKR-----------NAPAQWRRKDRQKQHTEHLRLD------------NDQREKYIQEA-----RTMGSTIRQPKLSNLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKM-GREAVELGHGEVNITGVEENTLIASLCDLLERIWSHGLQVK 787          
BLAST of DENN domain-containing protein 5B vs. Ensembl Human
Match: DENND5B (DENN domain containing 5B [Source:HGNC Symbol;Acc:HGNC:28338])

HSP 1 Score: 402.905 bits (1034), Expect = 5.041e-117
Identity = 295/981 (30.07%), Postives = 486/981 (49.54%), Query Frame = 2
Query:  149 YFFVCGLDYNVGLDTYELSTESNEYSSPHCIPPLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLVGSINHGNITTRPFSGRRGFCGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNS-----YRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIVDKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIRS--YRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRKK-NIIKRPNIEIPRRGSVTAG 3067
            YF +CG+D + GL+  EL+ E+ + S      PL R +   +L H+P +     F +D ++  LCMP GL  F T T  + P  H+FI+TRED +R YG  L F EE+ +++I T    +Q++Y++ HN+E+   +     +S+       S+ D G    +++       S+    + LY  K+I +++  P++   + +L  ++  V+++                               + LESY+ NIL+E   P  G S+   G      CQ P P +LP+ + P+R+  E+LGLE+L+++++CVLLE ++++ SQDY+ LM VAE IT LLFPF W HVY PILP +  HFL+APVP++MG++     +   ++LP +A +C+V+ID   ++  ++ P FP +++                                     IQ++SE+  +  I   PP+ +L   ++   L  +N+ + +LV+        + G+  T +  M   L  N        L    G ++ ++     + E    +     +   +    N  LRE+F N F  +F DY+ F+I  +   +M ++   R+  +Q FDKA FLS+QPE +LPFLS F+ETQMF  F++ KI+ +WE+  P L +F+ ++ K +             + ++R+   R+    K     E    ++   +      + PH+LD    +IG                   + KY   ++ F       FP LQ D L + P   S ++ + + +     +R   + RQ S  V   +D+                  +EKY+ E      ++  K   +P L ++ P  +AQ +  FV  LL+EC+ KTKRM++EKMG  EA+ELGHG+  ++G+EENTL+A LCDLLERIW HGL  K GKSALW+HL ++ DR+ K+ ++ + P    P R    +G
Sbjct:   24 YFVLCGIDADSGLEPDELAGENFDQS------PLRRTFKSKVLAHYPQNIEWNPFDQD-AVNMLCMPKGLS-FRTQTDNKDPQFHSFIITREDGSRTYGFVLTFYEEVTSKQICTA---MQTLYQM-HNAEH---YSSVYASSSCSMDSLASSLDEG--DTTSLLKLQRYNSYDISRDTLYVSKSICLITPLPFMQACKKFLIQLYKAVTSQQ---------------------------PPPLPLESYIHNILYEVPLPPPGRSLKFYGVYEPVICQRPGPSELPLSDYPLREAFELLGLENLVQVFTCVLLEMQILLYSQDYQRLMTVAEGITTLLFPFQWQHVYVPILPASLLHFLDAPVPYLMGLQSKEGTDRSKLELPQEANLCFVDIDNHFIELPEEFPQFPNKVDF------------------------------------IQELSEVLVQFGI---PPEGSLHCSESTSKL--KNMVLKDLVN------DKKNGNVCTNNISMYELLKGNETIARLQALAKRTGVAVEKMDLSASLGEKDKDLKLHCEEAELRDYQLNVQLREVFANRFTQMFADYEAFVI--QTAQDMESWLTNREQ-MQNFDKASFLSDQPEPYLPFLSRFIETQMFATFIDNKIMSQWEEKDPLLRVFDTRIDKIR-------------LYNVRAPTLRTSIYQKCSTLKEAAQSIEQRLMKMDHTAIHPHLLDM---KIG-------------------QGKY---EQGF-------FPKLQSDVLATGP--TSNNRWVSRSA---TAQRRKERLRQHSEHVGLDNDL------------------REKYMQEA-----RSLGKNLRQPKLSDLSPAVIAQTNCKFVEGLLKECRMKTKRMLVEKMG-HEAVELGHGEANITGLEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLIQFQDREEKQEHLAESPVALGPERRKSDSG 836          

HSP 2 Score: 310.842 bits (795), Expect = 5.150e-86
Identity = 197/478 (41.21%), Postives = 284/478 (59.41%), Query Frame = 2
Query: 3407 RRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEII-RLNEDDMNEIMINNPDG--------VDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            R SL+ D+  I++M++I TDVG ARA++RL+LEKKLLS+HLK+LL +  L K+LYKR+AFLRCEEEREQFL+HLL+L AV+Y+ FT+++  I + YR  I   K+ S     T+N W CV+G+   TG   IPK L +  FE  NLG LT+++IGHDNSG+  KW +D V+++N ITG  Y+FPC  WLGKG+DD S ER+L+GE++   +++D+ +     P          + I+  + +N+ PN+                                IQE +G AVNN+VK+F++ ++ER  L           T+LLCG +GLV ++E+VF  GFKS+R+F K  ++WD++EK  + F       +N  +   +K    + C T   FC  ++ I    ++IGKDGKFQ  V L  RD  LP+ I LL +     + YEES   RD    + LI+IL ++ DF I LE +L  G
Sbjct:  843 RVSLIQDMRHIQNMSEIKTDVGRARAWIRLSLEKKLLSQHLKQLLSNQPLTKKLYKRYAFLRCEEEREQFLYHLLSLNAVDYFCFTSVFTTIMIPYRSVIIPIKKLSNAI-ITSNPWICVSGELGDTGVMQIPKNLLEMTFECQNLGKLTTVQIGHDNSGLLAKWLVDCVMVRNEITGHTYRFPCGRWLGKGIDDGSLERILIGELMTSASDEDLVKQCRTPPQQKSPTTARRLSITSLTGKNNKPNA------------------------------GQIQEGIGEAVNNIVKHFHKPEKERGSL-----------TVLLCGENGLVAALEQVFHHGFKSARIFHKNVFIWDFIEKVVAYFETTDQILDNEDDVLIQK----SSCKT---FCHYVNAINTAPRNIGKDGKFQILVCLGTRDRLLPQWIPLLAECPAITRMYEESALLRDRMTVNSLIRILQTIQDFTIVLEGSLIKG 1271          
BLAST of DENN domain-containing protein 5B vs. Ensembl Human
Match: DENND5B (DENN domain containing 5B [Source:HGNC Symbol;Acc:HGNC:28338])

HSP 1 Score: 387.882 bits (995), Expect = 1.424e-111
Identity = 284/949 (29.93%), Postives = 467/949 (49.21%), Query Frame = 2
Query:  245 PLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLVGSINHGNITTRPFSGRRGFCGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNS-----YRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIVDKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIRS--YRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRKK-NIIKRPNIEIPRRGSVTAG 3067
            PL R +   +L H+P +     F +D ++  LCMP GL  F T T  + P  H+FI+TRED +R YG  L F EE+ +++I T    +Q++Y++ HN+E+   +     +S+       S+ D G    +++       S+    + LY  K+I +++  P++   + +L  ++  V+++                               + LESY+ NIL+E   P  G S+   G      CQ P P +LP+ + P+R+  E+LGLE+L+++++CVLLE ++++ SQDY+ LM VAE IT LLFPF W HVY PILP +  HFL+APVP++MG++     +   ++LP +A +C+V+ID   ++  ++ P FP +++                                     IQ++SE+  +  I   PP+ +L   ++   L  +N+ + +LV+        + G+  T +  M   L  N        L    G ++ ++     + E    +     +   +    N  LRE+F N F  +F DY+ F+I    +  M ++   R+  +Q FDKA FLS+QPE +LPFLS F+ETQMF  F++ KI+ +WE+  P L +F+ ++ K +             + ++R+   R+    K     E    ++   +      + PH+LD    +IG                   + KY   ++ F       FP LQ D L + P   S ++ + + +     +R   + RQ S  V   +D+                  +EKY+ E      ++  K   +P L ++ P  +AQ +  FV  LL+EC+ KTKRM++EKMG  EA+ELGHG+  ++G+EENTL+A LCDLLERIW HGL  K GKSALW+HL ++ DR+ K+ ++ + P    P R    +G
Sbjct:   85 PLRRTFKSKVLAHYPQNIEWNPFDQD-AVNMLCMPKGLS-FRTQTDNKDPQFHSFIITREDGSRTYGFVLTFYEEVTSKQICTA---MQTLYQM-HNAEH---YSSVYASSSCSMDSLASSLDEG--DTTSLLKLQRYNSYDISRDTLYVSKSICLITPLPFMQACKKFLIQLYKAVTSQQ---------------------------PPPLPLESYIHNILYEVPLPPPGRSLKFYGVYEPVICQRPGPSELPLSDYPLREAFELLGLENLVQVFTCVLLEMQILLYSQDYQRLMTVAEGITTLLFPFQWQHVYVPILPASLLHFLDAPVPYLMGLQSKEGTDRSKLELPQEANLCFVDIDNHFIELPEEFPQFPNKVDF------------------------------------IQELSEVLVQFGI---PPEGSLHCSESTSKL--KNMVLKDLVN------DKKNGNVCTNNISMYELLKGNETIARLQALAKRTGVAVEKMDLSASLGEKDKDLKLHCEEAELRDYQLNVQLREVFANRFTQMFADYEAFVIQTAQD--MESWLTNREQ-MQNFDKASFLSDQPEPYLPFLSRFIETQMFATFIDNKIMSQWEEKDPLLRVFDTRIDKIR-------------LYNVRAPTLRTSIYQKCSTLKEAAQSIEQRLMKMDHTAIHPHLLDM---KIG-------------------QGKY---EQGF-------FPKLQSDVLATGP--TSNNRWVSRSA---TAQRRKERLRQHSEHVGLDNDL------------------REKYMQEA-----RSLGKNLRQPKLSDLSPAVIAQTNCKFVEGLLKECRMKTKRMLVEKMG-HEAVELGHGEANITGLEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLIQFQDREEKQEHLAESPVALGPERRKSDSG 871          

HSP 2 Score: 311.227 bits (796), Expect = 5.782e-86
Identity = 197/478 (41.21%), Postives = 284/478 (59.41%), Query Frame = 2
Query: 3407 RRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEII-RLNEDDMNEIMINNPDG--------VDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            R SL+ D+  I++M++I TDVG ARA++RL+LEKKLLS+HLK+LL +  L K+LYKR+AFLRCEEEREQFL+HLL+L AV+Y+ FT+++  I + YR  I   K+ S     T+N W CV+G+   TG   IPK L +  FE  NLG LT+++IGHDNSG+  KW +D V+++N ITG  Y+FPC  WLGKG+DD S ER+L+GE++   +++D+ +     P          + I+  + +N+ PN+                                IQE +G AVNN+VK+F++ ++ER  L           T+LLCG +GLV ++E+VF  GFKS+R+F K  ++WD++EK  + F       +N  +   +K    + C T   FC  ++ I    ++IGKDGKFQ  V L  RD  LP+ I LL +     + YEES   RD    + LI+IL ++ DF I LE +L  G
Sbjct:  878 RVSLIQDMRHIQNMSEIKTDVGRARAWIRLSLEKKLLSQHLKQLLSNQPLTKKLYKRYAFLRCEEEREQFLYHLLSLNAVDYFCFTSVFTTIMIPYRSVIIPIKKLSNAI-ITSNPWICVSGELGDTGVMQIPKNLLEMTFECQNLGKLTTVQIGHDNSGLLAKWLVDCVMVRNEITGHTYRFPCGRWLGKGIDDGSLERILIGELMTSASDEDLVKQCRTPPQQKSPTTARRLSITSLTGKNNKPNA------------------------------GQIQEGIGEAVNNIVKHFHKPEKERGSL-----------TVLLCGENGLVAALEQVFHHGFKSARIFHKNVFIWDFIEKVVAYFETTDQILDNEDDVLIQK----SSCKT---FCHYVNAINTAPRNIGKDGKFQILVCLGTRDRLLPQWIPLLAECPAITRMYEESALLRDRMTVNSLIRILQTIQDFTIVLEGSLIKG 1306          
BLAST of DENN domain-containing protein 5B vs. Ensembl Celegans
Match: lst-6 (Lateral Signaling Target [Source:UniProtKB/TrEMBL;Acc:Q18780])

HSP 1 Score: 256.529 bits (654), Expect = 9.776e-69
Identity = 197/708 (27.82%), Postives = 318/708 (44.92%), Query Frame = 2
Query:  137 NLVDYFFVCGLDYNVGL------DTYELSTESNEYSSPHCIPPLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSA-------RDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNL-----------------------RKEITELLVGSINHGNITTRP--FSGRRGFCGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNE--DGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIVDKWEDPHPNLVLFEQKLQKRQD 2140
             LVDYF V G D ++GL      D      ES   S+P   PPL R ++  I+ HFP       F +D  I  LCMP GLR +T   VP+  + H F   +ED +RI GT+L F EE+++  I   +  LQ  +     + + G+    +     P T +G         RD        IS     G        LY  + I VLS+ P ++  ++ L  +  ++++ ++                             + LESY++  L+E   P+   ++ I         Q P PK+LP F+  +  + + L +E  IR++SC LLE+++++ S+D   LM V E +  L FPF W   YAP+LP +   F  APVP++MG     +  E+  Q    + VC V++D    +  +D+P+FP    L                       R E  E++VG +       RP  ++ +R          + +  +LE  +++++      L G       M    +   L   PLP+E + R +                 R+     ++   +   N+ +E  D   + + IA+ Y+     N  +RE  LN F+ +F  Y+ F+I  +   +  +Y   R+S    FDKA FLS+QP++HL FL+AFLETQMFT F++ KI+ +WE P   +VLF+ ++   +D
Sbjct:   11 TLVDYFAVAGYDPDIGLVVDTKYDPGHTPCESPGSSAPEFRPPLQRSFVAKIINHFPQRRPGNPFSDD--ILHLCMPRGLRFYTEKDVPKKLMIHTFANIKEDGSRINGTALTFYEEVKDLAICDAMAQLQQDHVREITARHNGIIEKQQRIHHPPGTVSGGTHTLPRNRRDRS----KRISYYEGGGH-----NSLYMSRTICVLSRLPLVNSTRALLTALHQIIASPSS---------------------------PHLPLESYIYWCLYEVPLPSPSMTLKIPLLGTTLVVQRPGPKELPFFDDSIGSIFDYLPVEKFIRLFSCFLLEHQILLCSKDLSRLMTVCESLLALSFPFRWQMTYAPVLPYSKLDFFEAPVPYVMGWYYEDTVPEELFQ----SNVCVVDLDTGRSELPEDVPVFPGARQLATDIKNSLERLSDSDKMLTSTLDRSEPEEVVVGGVKMRRKNKRPEDWAAKR----------MSRSFDLEDGSAMSE-----ELSG-------MMRRPSRTGLQ--PLPLENVLRNNSTLA-------------RVAEIARRAGVVVDVDNIKSEFADAQNLDSPIARHYFVDAKVNNAIRECVLNRFVEMFYSYEHFVIGGQGCDDRESYEANRESMAD-FDKASFLSDQPDSHLTFLAAFLETQMFTSFIDSKILSQWETPDEGVVLFDSRISAMRD 638          

HSP 2 Score: 220.705 bits (561), Expect = 1.427e-57
Identity = 170/481 (35.34%), Postives = 255/481 (53.01%), Query Frame = 2
Query: 3392 IFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPC------NNWLGKGVDDSSTERLLVGE-IIRLNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYRQQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRL-FQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            +  P    +  D+  +  MT+I TD+G ARAFVRLALE+KLL +HL  LL ++ +L+ELYK +AF+  +EE+EQFLFH+L+L A ++  FTN + K ++ Y+V I +G    +G       W  V G  CST    +      F+F++ NLG+L++LRIGH  S    +WF+++VL++N ITG  YKFPC      + W G G +D + ER+LV E  +  + +D   I    P       FS       SS     Q      +   +   S ++ +++V+ ++  LG AVN LVKYF  +++              +  LLCG  GLV ++E+ F+ G + S L + +    WDY+E+  S F +    +      P E+K        I +  +L  KI     S+GKDGKF  FV LSIRDH LP L+ L+     T   Y E  F R      +L K++ SL++F I ++ +LT G
Sbjct: 1036 VLSPLPTHVAYDLKNVLRMTEIKTDIGYARAFVRLALERKLLHKHLGALLSNSRVLRELYKPYAFVGSDEEKEQFLFHILSLNAAQFRCFTNTFTKTKMDYQVVIVTG----SGRGAIPAIWVTVEGSLCSTPPIMLKPNTPLFKFDHKNLGILSTLRIGHQQSEKPVQWFLEYVLVRNEITGQTYKFPCSKKFGEDRWFGNG-EDITLERMLVAEPFVEYDGNDNGIIEQGEP-------FSPARTRRMSSRSQTPQRERSPSNGRMAESSSRNR-KTKVSEVEHLLGEAVNALVKYFCSERK----------VKSELAHLLCGQKGLVLAIEQAFQLGRQESLLKYFRNTCPWDYIERVCSWFFELCRKKEVDKL-PKEQK------TMIHHALRLYRKI-DAKTSLGKDGKFHVFVLLSIRDHILPGLLPLMRYSPVTADMYNEPSFLRTPAHMTYLAKLMYSLSEFNITIDPSLTYG 1485          

HSP 3 Score: 114.775 bits (286), Expect = 3.464e-25
Identity = 51/85 (60.00%), Postives = 68/85 (80.00%), Query Frame = 2
Query: 2741 MAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVD 2995
            +AQ  +AFV +LL+E K KTKRM+++KMG KEA++LGH D  ++G+EENTLVA  CDLLERIW HGL NK+GKS+LW  + ++ D
Sbjct:  757 IAQQQYAFVQQLLKETKAKTKRMLVDKMG-KEAVQLGHLDAGITGVEENTLVASFCDLLERIWAHGLKNKHGKSSLWNFVLQHQD 840          
BLAST of DENN domain-containing protein 5B vs. Ensembl Celegans
Match: denn-4 (DENN domain type RAB GEF [Source:UniProtKB/TrEMBL;Acc:U4PRB8])

HSP 1 Score: 72.7886 bits (177), Expect = 2.419e-12
Identity = 108/470 (22.98%), Postives = 183/470 (38.94%), Query Frame = 2
Query:  281 HFP--DHCGNYA-FPEDYSITSLCMPDG--LRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPA-RGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITEL------LVGSINHGNITTRPFSGRRGFCGPIINSNIQQVSELESKNSINQLPPKI---NLKGYDNF-----KTLMNENVT-IDNLVDI 1627
            +FP  DH G    F    ++   C+P G  +  + T   P       F++T E+ T+ YG+++ F E+       T  +    + ++   S+ GG       T     + N  A D     Y N+S                    I ++S+ P+ + F+ +L+ +  M S  +                              V +E Y+ ++++E   P  R   + +   +        D   LP+    + D L+ LG E+L+ +    LLE +++I S    +L  VAE +  L+FPF W   Y P  PL     L+AP+PFI G+    S   +  + P D   C+ ++D  T+  S     F   M  +K   +L      + G +   + +T   S   G   P+    ++Q    E +N I+    K     +KGY  F        M E+ T   NL D+
Sbjct:  221 YFPRSDHSGEMEDFKLAQNVAMFCLPMGALIECWPTKCAPPDRSFSTFVLTDENGTKFYGSAVTFYEKY------TKQLSEDQLEQLDLKSDEGG-------TVEDSGSNNDPADDLQILFYKNVS--------------------ICLISRFPFFNSFKRFLFFLHRMSSTPS--------------------------CSHPVPIERYISHLMYEVSFPTPRRPRVFMQLGAENISFDSHDDSQLPLNGAQLIDTLKYLGSENLMYLMLLALLEQKILIHSLRPWMLAAVAESVCALMFPFHWQCPYIPQCPLGLAGVLHAPLPFIAGV---DSRYFELYEDPPDDVTCF-DLDTSTISFSTVRATFKTSMLPKKPAKQLKSALEDIFGKLQKQDYSTN--SKSDGGFIPVDQDLVKQRQRREFENEIHDAFLKFIASIMKGYQAFLRPIKGAPMTEHATDTGNLFDL 625          
BLAST of DENN domain-containing protein 5B vs. Ensembl Celegans
Match: denn-4 (DENN domain type RAB GEF [Source:UniProtKB/TrEMBL;Acc:U4PRB8])

HSP 1 Score: 72.7886 bits (177), Expect = 2.419e-12
Identity = 108/470 (22.98%), Postives = 183/470 (38.94%), Query Frame = 2
Query:  281 HFP--DHCGNYA-FPEDYSITSLCMPDG--LRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPA-RGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITEL------LVGSINHGNITTRPFSGRRGFCGPIINSNIQQVSELESKNSINQLPPKI---NLKGYDNF-----KTLMNENVT-IDNLVDI 1627
            +FP  DH G    F    ++   C+P G  +  + T   P       F++T E+ T+ YG+++ F E+       T  +    + ++   S+ GG       T     + N  A D     Y N+S                    I ++S+ P+ + F+ +L+ +  M S  +                              V +E Y+ ++++E   P  R   + +   +        D   LP+    + D L+ LG E+L+ +    LLE +++I S    +L  VAE +  L+FPF W   Y P  PL     L+AP+PFI G+    S   +  + P D   C+ ++D  T+  S     F   M  +K   +L      + G +   + +T   S   G   P+    ++Q    E +N I+    K     +KGY  F        M E+ T   NL D+
Sbjct:  221 YFPRSDHSGEMEDFKLAQNVAMFCLPMGALIECWPTKCAPPDRSFSTFVLTDENGTKFYGSAVTFYEKY------TKQLSEDQLEQLDLKSDEGG-------TVEDSGSNNDPADDLQILFYKNVS--------------------ICLISRFPFFNSFKRFLFFLHRMSSTPS--------------------------CSHPVPIERYISHLMYEVSFPTPRRPRVFMQLGAENISFDSHDDSQLPLNGAQLIDTLKYLGSENLMYLMLLALLEQKILIHSLRPWMLAAVAESVCALMFPFHWQCPYIPQCPLGLAGVLHAPLPFIAGV---DSRYFELYEDPPDDVTCF-DLDTSTISFSTVRATFKTSMLPKKPAKQLKSALEDIFGKLQKQDYSTN--SKSDGGFIPVDQDLVKQRQRREFENEIHDAFLKFIASIMKGYQAFLRPIKGAPMTEHATDTGNLFDL 625          
BLAST of DENN domain-containing protein 5B vs. Ensembl Celegans
Match: denn-4 (DENN domain type RAB GEF [Source:UniProtKB/TrEMBL;Acc:U4PRB8])

HSP 1 Score: 72.7886 bits (177), Expect = 2.611e-12
Identity = 108/470 (22.98%), Postives = 183/470 (38.94%), Query Frame = 2
Query:  281 HFP--DHCGNYA-FPEDYSITSLCMPDG--LRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPA-RGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITEL------LVGSINHGNITTRPFSGRRGFCGPIINSNIQQVSELESKNSINQLPPKI---NLKGYDNF-----KTLMNENVT-IDNLVDI 1627
            +FP  DH G    F    ++   C+P G  +  + T   P       F++T E+ T+ YG+++ F E+       T  +    + ++   S+ GG       T     + N  A D     Y N+S                    I ++S+ P+ + F+ +L+ +  M S  +                              V +E Y+ ++++E   P  R   + +   +        D   LP+    + D L+ LG E+L+ +    LLE +++I S    +L  VAE +  L+FPF W   Y P  PL     L+AP+PFI G+    S   +  + P D   C+ ++D  T+  S     F   M  +K   +L      + G +   + +T   S   G   P+    ++Q    E +N I+    K     +KGY  F        M E+ T   NL D+
Sbjct:  221 YFPRSDHSGEMEDFKLAQNVAMFCLPMGALIECWPTKCAPPDRSFSTFVLTDENGTKFYGSAVTFYEKY------TKQLSEDQLEQLDLKSDEGG-------TVEDSGSNNDPADDLQILFYKNVS--------------------ICLISRFPFFNSFKRFLFFLHRMSSTPS--------------------------CSHPVPIERYISHLMYEVSFPTPRRPRVFMQLGAENISFDSHDDSQLPLNGAQLIDTLKYLGSENLMYLMLLALLEQKILIHSLRPWMLAAVAESVCALMFPFHWQCPYIPQCPLGLAGVLHAPLPFIAGV---DSRYFELYEDPPDDVTCF-DLDTSTISFSTVRATFKTSMLPKKPAKQLKSALEDIFGKLQKQDYSTN--SKSDGGFIPVDQDLVKQRQRREFENEIHDAFLKFIASIMKGYQAFLRPIKGAPMTEHATDTGNLFDL 625          
BLAST of DENN domain-containing protein 5B vs. Ensembl Celegans
Match: denn-4 (DENN domain type RAB GEF [Source:UniProtKB/TrEMBL;Acc:U4PRB8])

HSP 1 Score: 72.7886 bits (177), Expect = 2.611e-12
Identity = 108/470 (22.98%), Postives = 183/470 (38.94%), Query Frame = 2
Query:  281 HFP--DHCGNYA-FPEDYSITSLCMPDG--LRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPA-RGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITEL------LVGSINHGNITTRPFSGRRGFCGPIINSNIQQVSELESKNSINQLPPKI---NLKGYDNF-----KTLMNENVT-IDNLVDI 1627
            +FP  DH G    F    ++   C+P G  +  + T   P       F++T E+ T+ YG+++ F E+       T  +    + ++   S+ GG       T     + N  A D     Y N+S                    I ++S+ P+ + F+ +L+ +  M S  +                              V +E Y+ ++++E   P  R   + +   +        D   LP+    + D L+ LG E+L+ +    LLE +++I S    +L  VAE +  L+FPF W   Y P  PL     L+AP+PFI G+    S   +  + P D   C+ ++D  T+  S     F   M  +K   +L      + G +   + +T   S   G   P+    ++Q    E +N I+    K     +KGY  F        M E+ T   NL D+
Sbjct:  221 YFPRSDHSGEMEDFKLAQNVAMFCLPMGALIECWPTKCAPPDRSFSTFVLTDENGTKFYGSAVTFYEKY------TKQLSEDQLEQLDLKSDEGG-------TVEDSGSNNDPADDLQILFYKNVS--------------------ICLISRFPFFNSFKRFLFFLHRMSSTPS--------------------------CSHPVPIERYISHLMYEVSFPTPRRPRVFMQLGAENISFDSHDDSQLPLNGAQLIDTLKYLGSENLMYLMLLALLEQKILIHSLRPWMLAAVAESVCALMFPFHWQCPYIPQCPLGLAGVLHAPLPFIAGV---DSRYFELYEDPPDDVTCF-DLDTSTISFSTVRATFKTSMLPKKPAKQLKSALEDIFGKLQKQDYSTN--SKSDGGFIPVDQDLVKQRQRREFENEIHDAFLKFIASIMKGYQAFLRPIKGAPMTEHATDTGNLFDL 625          
BLAST of DENN domain-containing protein 5B vs. Ensembl Fly
Match: pns (gene:FBgn0035229 transcript:FBtr0072735)

HSP 1 Score: 282.722 bits (722), Expect = 6.810e-77
Identity = 201/491 (40.94%), Postives = 277/491 (56.42%), Query Frame = 2
Query: 3368 SKSIDLESIFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYRQQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPN--------QCMTIQYFCKL-ISKIAHVN-QSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            +K + LE +  P   SL  DV  + +M DI T +G  RA+VRL+LEKKLLS H + LL D  LL+ LYKR AFLRCEEE+EQFL+HLL L  V+Y+SFTN+Y   +L YRV I+  +++ +   T++N W  V+G    T +  +PKG  +F F   NLG+LT++RIGHDNSG S KW ++ V+++N +TG  YKFPC  WLG+GVDD STERLLVG+ +  N                           N+ ++ G  T    R+ S S ++      SE   IQ QLGN VN LVK+ Y+   RD+ VG        +T LLCG DGLV  +E+VF  GF+S+R F +  Y+WDY  K    F  +L  +    +   +  +S          Q   I    +L +  +  +N  ++GKDGKFQ  + LS+R+H L  LI  +     T + YEE  F R  +L  FLI+IL  L+D  I LE ++T G
Sbjct:  990 NKFVGLEQL-CPLPESLEFDVKNVLAMADIKTHIGYTRAWVRLSLEKKLLSRHFRTLLSDEALLRSLYKRSAFLRCEEEKEQFLYHLLTLNTVDYFSFTNIYPTTKLPYRVVIFPSRKYGS-YHTSSNVWIMVSGTMNETQRVPVPKGSLEFIFHYKNLGLLTTMRIGHDNSGPSHKWLVEQVVMRNEVTGHTYKFPCGRWLGRGVDDDSTERLLVGQRVLTNAK-------------------------NAELVPGSDTRTPPRTRSPSVQRQETLAPSE---IQHQLGNCVNVLVKWHYK-PSRDRDVG-------TLTNLLCGDDGLVKCLEQVFLCGFRSARFFGRNLYIWDYFTKIKELFEHNLQMELEDSSSSLDSSFSNGSGSGGNSLQRREISSIWRLYVQLMDEINGTALGKDGKFQLLICLSLREHLLTRLIKPMALTKVTHEMYEEESFLRRRNLLTFLIQILEPLDDCHIVLENSITQG 1442          

HSP 2 Score: 234.187 bits (596), Expect = 1.074e-61
Identity = 155/440 (35.23%), Postives = 229/440 (52.05%), Query Frame = 2
Query:  140 LVDYFFVCGLDYNVGLDTYELSTESNEYSSPHCIPPLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPN--------GSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVI-------DGPSMRHFCQCP-DPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELL 1411
              DYF +CGLD + GL+    + ++      HC  PL R Y    L H+P++     F + + I  L +P GLR F T      P  H+F  TRED  R YG SL+F EEI N  I   +  LQSM+ I   S     H  S      P + +        G A  S   SY +I+            +KLY  K+I ++ Q PY    Q +L +++            R L  +  + +S               LESYV+NIL+E   P  G+SI +         P +    Q P    +LP+ + P+R L + LG+E +I++ +CVLLE +V++ S DY+ LM+V ECIT LLFPFVW HVYAPILP A  HFL+APVPF+MG+    ++ E A ++ S+A +C+V+IDK+ ++  +++P+FP++++   EI  +L
Sbjct:   72 FADYFVICGLDLDTGLEPDRFAGDNL-----HC-SPLDRAYKSKPLAHYPENVPWNPF-DAHGICMLSLPQGLR-FRTQKHCIEPRFHSFATTREDGKRCYGFSLVFYEEIRNRNICGAIHTLQSMF-ITELSNGQQTHSLSRVKQDGPVSRSLPRHFKVAGQAPQSA-QSYYDIN-----------KDKLYVAKSITLICQAPYAFAAQMFLKNLY------------RCLPRQPGAGIS---------------LESYVYNILYEVMLPQPGKSIRVYLPPTEPHLPPIALILQRPLLATELPLLDFPLRLLFKYLGVECVIQLLTCVLLENQVLLRSTDYQRLMIVGECITSLLFPFVWPHVYAPILPAALHHFLDAPVPFVMGLH---AECEAAHKIGSEATLCFVDIDKKHIQLPEELPVFPHKVDFMAEIGSVL 460          

HSP 3 Score: 111.309 bits (277), Expect = 5.765e-24
Identity = 54/92 (58.70%), Postives = 69/92 (75.00%), Query Frame = 2
Query: 2723 NIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELG-HGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVD 2995
            ++ P  +AQ +W FV +LL++ K+KTKRM+LEKMG  EA+ LG  GD    GIEENTL+A +CDLLE+IW HGL NK GKSALW HL  Y++
Sbjct:  834 DVSPALIAQANWTFVERLLKDIKSKTKRMLLEKMGN-EAVALGLKGD----GIEENTLIASMCDLLEKIWSHGLQNKQGKSALWAHLQAYLE 920          

HSP 4 Score: 90.8929 bits (224), Expect = 9.262e-18
Identity = 48/107 (44.86%), Postives = 69/107 (64.49%), Query Frame = 2
Query: 1811 YYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIVDKWE-DPHPNLVLFEQKLQ 2128
            YY+ L  N  +RE+FLN F+H+F+ Y+ F+I P  N     +   R+ T+Q FDK+ FLS+QPE H  FLS FLE+QMF   ++ KI+  WE  P   L LF+Q+++
Sbjct:  619 YYQDLRINNSVREIFLNRFVHMFHAYEYFVIYP--NQARDEWISNRE-TLQNFDKSSFLSDQPEHHRAFLSRFLESQMFATLIDNKILAMWESQPDEQLQLFDQRVK 722          
BLAST of DENN domain-containing protein 5B vs. Ensembl Fly
Match: pns (gene:FBgn0035229 transcript:FBtr0072736)

HSP 1 Score: 282.722 bits (722), Expect = 6.810e-77
Identity = 201/491 (40.94%), Postives = 277/491 (56.42%), Query Frame = 2
Query: 3368 SKSIDLESIFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYRQQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPN--------QCMTIQYFCKL-ISKIAHVN-QSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            +K + LE +  P   SL  DV  + +M DI T +G  RA+VRL+LEKKLLS H + LL D  LL+ LYKR AFLRCEEE+EQFL+HLL L  V+Y+SFTN+Y   +L YRV I+  +++ +   T++N W  V+G    T +  +PKG  +F F   NLG+LT++RIGHDNSG S KW ++ V+++N +TG  YKFPC  WLG+GVDD STERLLVG+ +  N                           N+ ++ G  T    R+ S S ++      SE   IQ QLGN VN LVK+ Y+   RD+ VG        +T LLCG DGLV  +E+VF  GF+S+R F +  Y+WDY  K    F  +L  +    +   +  +S          Q   I    +L +  +  +N  ++GKDGKFQ  + LS+R+H L  LI  +     T + YEE  F R  +L  FLI+IL  L+D  I LE ++T G
Sbjct:  990 NKFVGLEQL-CPLPESLEFDVKNVLAMADIKTHIGYTRAWVRLSLEKKLLSRHFRTLLSDEALLRSLYKRSAFLRCEEEKEQFLYHLLTLNTVDYFSFTNIYPTTKLPYRVVIFPSRKYGS-YHTSSNVWIMVSGTMNETQRVPVPKGSLEFIFHYKNLGLLTTMRIGHDNSGPSHKWLVEQVVMRNEVTGHTYKFPCGRWLGRGVDDDSTERLLVGQRVLTNAK-------------------------NAELVPGSDTRTPPRTRSPSVQRQETLAPSE---IQHQLGNCVNVLVKWHYK-PSRDRDVG-------TLTNLLCGDDGLVKCLEQVFLCGFRSARFFGRNLYIWDYFTKIKELFEHNLQMELEDSSSSLDSSFSNGSGSGGNSLQRREISSIWRLYVQLMDEINGTALGKDGKFQLLICLSLREHLLTRLIKPMALTKVTHEMYEEESFLRRRNLLTFLIQILEPLDDCHIVLENSITQG 1442          

HSP 2 Score: 234.187 bits (596), Expect = 1.074e-61
Identity = 155/440 (35.23%), Postives = 229/440 (52.05%), Query Frame = 2
Query:  140 LVDYFFVCGLDYNVGLDTYELSTESNEYSSPHCIPPLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPN--------GSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVI-------DGPSMRHFCQCP-DPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELL 1411
              DYF +CGLD + GL+    + ++      HC  PL R Y    L H+P++     F + + I  L +P GLR F T      P  H+F  TRED  R YG SL+F EEI N  I   +  LQSM+ I   S     H  S      P + +        G A  S   SY +I+            +KLY  K+I ++ Q PY    Q +L +++            R L  +  + +S               LESYV+NIL+E   P  G+SI +         P +    Q P    +LP+ + P+R L + LG+E +I++ +CVLLE +V++ S DY+ LM+V ECIT LLFPFVW HVYAPILP A  HFL+APVPF+MG+    ++ E A ++ S+A +C+V+IDK+ ++  +++P+FP++++   EI  +L
Sbjct:   72 FADYFVICGLDLDTGLEPDRFAGDNL-----HC-SPLDRAYKSKPLAHYPENVPWNPF-DAHGICMLSLPQGLR-FRTQKHCIEPRFHSFATTREDGKRCYGFSLVFYEEIRNRNICGAIHTLQSMF-ITELSNGQQTHSLSRVKQDGPVSRSLPRHFKVAGQAPQSA-QSYYDIN-----------KDKLYVAKSITLICQAPYAFAAQMFLKNLY------------RCLPRQPGAGIS---------------LESYVYNILYEVMLPQPGKSIRVYLPPTEPHLPPIALILQRPLLATELPLLDFPLRLLFKYLGVECVIQLLTCVLLENQVLLRSTDYQRLMIVGECITSLLFPFVWPHVYAPILPAALHHFLDAPVPFVMGLH---AECEAAHKIGSEATLCFVDIDKKHIQLPEELPVFPHKVDFMAEIGSVL 460          

HSP 3 Score: 111.309 bits (277), Expect = 5.765e-24
Identity = 54/92 (58.70%), Postives = 69/92 (75.00%), Query Frame = 2
Query: 2723 NIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELG-HGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVD 2995
            ++ P  +AQ +W FV +LL++ K+KTKRM+LEKMG  EA+ LG  GD    GIEENTL+A +CDLLE+IW HGL NK GKSALW HL  Y++
Sbjct:  834 DVSPALIAQANWTFVERLLKDIKSKTKRMLLEKMGN-EAVALGLKGD----GIEENTLIASMCDLLEKIWSHGLQNKQGKSALWAHLQAYLE 920          

HSP 4 Score: 90.8929 bits (224), Expect = 9.262e-18
Identity = 48/107 (44.86%), Postives = 69/107 (64.49%), Query Frame = 2
Query: 1811 YYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIVDKWE-DPHPNLVLFEQKLQ 2128
            YY+ L  N  +RE+FLN F+H+F+ Y+ F+I P  N     +   R+ T+Q FDK+ FLS+QPE H  FLS FLE+QMF   ++ KI+  WE  P   L LF+Q+++
Sbjct:  619 YYQDLRINNSVREIFLNRFVHMFHAYEYFVIYP--NQARDEWISNRE-TLQNFDKSSFLSDQPEHHRAFLSRFLESQMFATLIDNKILAMWESQPDEQLQLFDQRVK 722          
BLAST of DENN domain-containing protein 5B vs. Ensembl Fly
Match: pns (gene:FBgn0035229 transcript:FBtr0072737)

HSP 1 Score: 231.876 bits (590), Expect = 9.342e-63
Identity = 152/441 (34.47%), Postives = 228/441 (51.70%), Query Frame = 2
Query:  137 NLVDYFFVCGLDYNVGLDTYELSTESNEYSSPHCIPPLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPN--------GSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVI-------DGPSMRHFCQCP-DPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELL 1411
               DYF +CGLD + GL+    + ++      HC  PL R Y    L H+P++     F + + I  L +P GLR F T      P  H+F  TRED  R YG SL+F EEI N  I   +  LQSM+ I   S     H  S      P + +        G A  S   SY +I+            +KLY  K+I ++ Q PY    Q +L +++  +  +                             + ++LESYV+NIL+E   P  G+SI +         P +    Q P    +LP+ + P+R L + LG+E +I++ +CVLLE +V++ S DY+ LM+V ECIT LLFPFVW HVYAPILP A  HFL+APVPF+MG+    ++ E A ++ S+A +C+V+IDK+ ++  +++P+FP++++   EI  +L
Sbjct:   71 RFADYFVICGLDLDTGLEPDRFAGDNL-----HC-SPLDRAYKSKPLAHYPENVPWNPF-DAHGICMLSLPQGLR-FRTQKHCIEPRFHSFATTREDGKRCYGFSLVFYEEIRNRNICGAIHTLQSMF-ITELSNGQQTHSLSRVKQDGPVSRSLPRHFKVAGQAPQSAQ-SYYDIN-----------KDKLYVAKSITLICQAPYAFAAQMFLKNLYRCLPRQPG---------------------------AGISLESYVYNILYEVMLPQPGKSIRVYLPPTEPHLPPIALILQRPLLATELPLLDFPLRLLFKYLGVECVIQLLTCVLLENQVLLRSTDYQRLMIVGECITSLLFPFVWPHVYAPILPAALHHFLDAPVPFVMGLH---AECEAAHKIGSEATLCFVDIDKKHIQLPEELPVFPHKVDFMAEIGSVL 460          

HSP 2 Score: 90.1225 bits (222), Expect = 1.074e-17
Identity = 50/121 (41.32%), Postives = 72/121 (59.50%), Query Frame = 2
Query: 1811 YYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIVDKWE-DPHPNLVLFEQKLQKRQDKYKRLSKGQN 2170
            YY+ L  N  +RE+FLN F+H+F+ Y+ F+I P    +    ++    T+Q FDK+ FLS+QPE H  FLS FLE+QMF   ++ KI+  WE  P   L LF+Q++     K  R   G+N
Sbjct:  619 YYQDLRINNSVREIFLNRFVHMFHAYEYFVIYPNQARDE---WISNRETLQNFDKSSFLSDQPEHHRAFLSRFLESQMFATLIDNKILAMWESQPDEQLQLFDQRV-----KLLRRRHGEN 731          
BLAST of DENN domain-containing protein 5B vs. Ensembl Fly
Match: Crag (gene:FBgn0025864 transcript:FBtr0071219)

HSP 1 Score: 79.7221 bits (195), Expect = 2.094e-14
Identity = 92/372 (24.73%), Postives = 139/372 (37.37%), Query Frame = 2
Query:  179 VGLDTYELSTESNEYSSPHCIPPLGRPYMPSILQHFP--DHCGNYAFPEDY--SITSLCMPDGLRL-------FTTSTVPQSPVNHNFIVTREDAT-RIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSM-RHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGI 1255
            VG D Y L  + + Y   H        Y P IL  +P  DH     FP +   S+   C+P G  L        T    P SPV   F++T  D T ++YG++L F E+ +  ++     +L     +  + E G  H                                           L+ IKAI +LS  P+   F  WL  +  MV  + N+                            + +E Y+  +L E   PA    + +   S  R     P+   LP        LL+ LG ++ + +    L E +++I S     L  VAE I  LLFPF W   Y P+ PL     L+AP+P+++G+
Sbjct:  183 VGSDVY-LCYKKSMYRPKHI------SYKPEILLRYPTFDHTD---FPLNLCPSVPLFCLPMGASLEAWPHVNGTEKRKPISPVFSTFVLTVSDGTYKVYGSALTFYEDYDESKLSAEQKEL-----LGWDEEFGAQHS------------------------------------------LHMIKAICLLSHHPFGDTFDKWLKYLHRMVLYDVNIP---------------------------IPVERYITQLLDEVPFPAPSIHLQLSSESNDRILLTQPEDSPLPRSGAGFHILLQNLGTDNCLHVLLLALTEQKILIHSLRPATLTAVAEAIVSLLFPFKWQCPYIPLCPLGLAEVLHAPLPYLIGV 470          
BLAST of DENN domain-containing protein 5B vs. Ensembl Fly
Match: Crag (gene:FBgn0025864 transcript:FBtr0343356)

HSP 1 Score: 79.7221 bits (195), Expect = 2.094e-14
Identity = 92/372 (24.73%), Postives = 139/372 (37.37%), Query Frame = 2
Query:  179 VGLDTYELSTESNEYSSPHCIPPLGRPYMPSILQHFP--DHCGNYAFPEDY--SITSLCMPDGLRL-------FTTSTVPQSPVNHNFIVTREDAT-RIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSM-RHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGI 1255
            VG D Y L  + + Y   H        Y P IL  +P  DH     FP +   S+   C+P G  L        T    P SPV   F++T  D T ++YG++L F E+ +  ++     +L     +  + E G  H                                           L+ IKAI +LS  P+   F  WL  +  MV  + N+                            + +E Y+  +L E   PA    + +   S  R     P+   LP        LL+ LG ++ + +    L E +++I S     L  VAE I  LLFPF W   Y P+ PL     L+AP+P+++G+
Sbjct:  183 VGSDVY-LCYKKSMYRPKHI------SYKPEILLRYPTFDHTD---FPLNLCPSVPLFCLPMGASLEAWPHVNGTEKRKPISPVFSTFVLTVSDGTYKVYGSALTFYEDYDESKLSAEQKEL-----LGWDEEFGAQHS------------------------------------------LHMIKAICLLSHHPFGDTFDKWLKYLHRMVLYDVNIP---------------------------IPVERYITQLLDEVPFPAPSIHLQLSSESNDRILLTQPEDSPLPRSGAGFHILLQNLGTDNCLHVLLLALTEQKILIHSLRPATLTAVAEAIVSLLFPFKWQCPYIPLCPLGLAEVLHAPLPYLIGV 470          
BLAST of DENN domain-containing protein 5B vs. Ensembl Zebrafish
Match: dennd5a (DENN/MADD domain containing 5A [Source:ZFIN;Acc:ZDB-GENE-071211-1])

HSP 1 Score: 429.483 bits (1103), Expect = 1.472e-126
Identity = 312/971 (32.13%), Postives = 481/971 (49.54%), Query Frame = 2
Query:  122 TRNSENLVDYFFVCGLDYNVGLDTYELSTESNEYSSPHCIPPLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLVG---SINHGNITTRPFSGRRGF-CGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIV-DKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIR--SYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRKKN 3013
            + +S    DYF +CGLD   GL+  ELS E+ E S      PL R +   +L H+PD+     F +D ++  LCMP GL  F T T  + P  H+FI+TRED +R YG +L F EE+ +++I +    +Q++Y + HN+E   +   +  T  SPE P  + +    ++   +S      S+    + LY  K I +++   + H  +  L  +   V++                                + LESYV+N+L+E   P  G S+   G      CQ P   +LP+F+ P++++ E+LGLE+++++++C LLE ++++ SQ Y+ LM VAE IT L+FPF W HVY PILP +  HFL+APVP++MG+  N  D+   ++LP +A +C+V+ID   ++  +D+P FP ++   +EI+E+L+    S       +   S  RGF CG + +         + +N         NL G      L+ EN TI  L  +      ++R    TG S+          +L      S ++ T      E+             KM   N  +RE+F N F  +F+DY+ F+I P    +  ++F  RD  +Q FDKA FLS+QPE +LPFLS FLETQMF  F++ KI+    ED    L +F+ ++ K +             ++++R  + R+    K     E +  +++         + PH+LD    +IG                   + +Y   +  F       FP LQ D L + P    TS    KRS        P ++R+K R       +               N Q+EKY+ E        R     +P L N+ P  +AQ +W FV  LL+EC+ KTKRM++EKM G+EA+ELGHG++ ++G+EENTL+A LCDLLERIW HGL  K GKSALW+HL  Y +   K++
Sbjct:    6 SSSSCRFADYFVICGLDTESGLEPDELSGENFEQS------PLRRTFKSKVLAHYPDNVEWNPFDQD-AVGMLCMPKGLS-FRTQTDTREPQFHSFIITREDGSRTYGFALTFFEEVTSKQICSA---MQTLYHM-HNAEQYDILH-TPPTPRSPEDPRPTTQQ--LHASPALSRLQRFNSYDISRDTLYVSKCICLITPMAFAHACRKVLEQLHQAVTSPQ---------------------------PPPLPLESYVYNVLYEVPLPPAGRSLKFSGVYRPVICQRPSTAELPLFDFPLQEVFELLGLENILQLFTCALLEIQILLYSQHYQRLMTVAESITALMFPFQWQHVYVPILPASLLHFLDAPVPYLMGLHSNGQDDRTKLELPQEANLCFVDIDNHFIELPEDLPQFPNKLEFIQEISEVLLAFGLSPEANPQCSEGQSKIRGFRCGDMAS---------DKRNG--------NLAGSPLNSFLLRENQTIARLQAL------VKR----TGVSL---------EKLDVKDDASTNKDTKVQCEEEE------------MKMHQLNIRVREVFANRFSQMFSDYEVFVIQPSQ--DKESWFSNRDQ-MQNFDKASFLSDQPEPYLPFLSRFLETQMFASFIDSKILCHDDEDKEHTLRVFDSRVDKIR-------------MINVRTPTLRTSMYQKCTNIDEAEKAIEVRLCKIDHTALHPHLLDM---KIG-------------------QGRY---EPGF-------FPRLQSDVLSTGP----TSNKWAKRS-------APAQWRRKDRQKQHAEHLYLD------------NDQREKYIQEARNLGTTLR-----QPKLSNLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKM-GREAVELGHGEVSITGVEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQESKEKRD 809          

HSP 2 Score: 306.605 bits (784), Expect = 8.317e-85
Identity = 203/495 (41.01%), Postives = 283/495 (57.17%), Query Frame = 2
Query: 3344 GISINTGSSKSIDLESIFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNP-----DGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            GI  +T   KS D      P + SL+ D+  I+++++I TDVG ARA+VRL++EKKLLS HLK+LL D  L K+LYKR+AFLRC++E+EQFL+HLL+  AV+Y+ FTN++  I + Y V I   K+   G+  TAN W CV+G+   TG   +PK   +  FE  NLG LT++++GHDNSG+  KW ++ V+++N ITG  YKFPC  WLGKGVDD S ER+LVGE++   E D  E M   P      G+   F +     PNS                        K +     IQE +G A+N +VK+F++ ++ER  L           TLLLCG  GLV ++E+VF+ GFKS RLF K  ++WD+LEK    F              ++     N  M +++FC  +  I    ++IGKDGKFQ  V L  RDH L   I LL +   T Q YE+    +D+ L + LI++L +L +F I LE +L  G
Sbjct:  819 GIIHDTERRKS-DASCAMPPLKVSLIQDMRHIQNISEIKTDVGKARAWVRLSMEKKLLSRHLKQLLSDHELTKKLYKRYAFLRCDDEKEQFLYHLLSFNAVDYFCFTNVFTTIMIPYHVVIIPSKKLG-GSMFTANPWVCVSGELAETGVLQVPKNTLEITFECQNLGKLTTVQMGHDNSGLYAKWLVECVMVRNGITGHTYKFPCGRWLGKGVDDGSLERILVGELVTNMESD--ERMCRTPPMQQSPGMMRRFVTIS---PNS------------------------KPKLNTGQIQESVGEAINGIVKHFHKPEKERGSL-----------TLLLCGEYGLVWALEQVFQHGFKSPRLF-KNVFIWDFLEKAQVYFESAER---------SQMTQDENWQMRVRHFCHFMRAINSTPRNIGKDGKFQMLVCLGARDHLLHHWIALLAECPITAQMYEDVALLKDHSLVNSLIRVLQTLQEFNITLEASLVKG 1261          
BLAST of DENN domain-containing protein 5B vs. Ensembl Zebrafish
Match: dennd5a (DENN/MADD domain containing 5A [Source:ZFIN;Acc:ZDB-GENE-071211-1])

HSP 1 Score: 417.927 bits (1073), Expect = 2.759e-122
Identity = 309/989 (31.24%), Postives = 478/989 (48.33%), Query Frame = 2
Query:  122 TRNSENLVDYFFVCGLDYNVGLDTYELSTESNEYSSPHCI------------------PPLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLVG---SINHGNITTRPFSGRRGF-CGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIV-DKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIR--SYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRKKN 3013
            + +S    DYF +CGLD   GL+  ELS       +                       PL R +   +L H+PD+     F +D ++  LCMP GL  F T T  + P  H+FI+TRED +R YG +L F EE+ +++I +    +Q++Y + HN+E   +   +  T  SPE P  + +    ++   +S      S+    + LY  K I +++   + H  +  L  +   V++                                + LESYV+N+L+E   P  G S+   G      CQ P   +LP+F+ P++++ E+LGLE+++++++C LLE ++++ SQ Y+ LM VAE IT L+FPF W HVY PILP +  HFL+APVP++MG+  N  D+   ++LP +A +C+V+ID   ++  +D+P FP ++   +EI+E+L+    S       +   S  RGF CG + +         + +N         NL G      L+ EN TI  L  +      ++R    TG S+          +L      S ++ T      E+             KM   N  +RE+F N F  +F+DY+ F+I P    +  ++F  RD  +Q FDKA FLS+QPE +LPFLS FLETQMF  F++ KI+    ED    L +F+ ++ K +             ++++R  + R+    K     E +  +++         + PH+LD    +IG                   + +Y   +  F       FP LQ D L + P    TS    KRS        P ++R+K R       +               N Q+EKY+ E        R     +P L N+ P  +AQ +W FV  LL+EC+ KTKRM++EKM G+EA+ELGHG++ ++G+EENTL+A LCDLLERIW HGL  K GKSALW+HL  Y +   K++
Sbjct:    6 SSSSCRFADYFVICGLDTESGLEPDELSALCQYIQATKFTDGARGKLASANEGENFEQSPLRRTFKSKVLAHYPDNVEWNPFDQD-AVGMLCMPKGLS-FRTQTDTREPQFHSFIITREDGSRTYGFALTFFEEVTSKQICSA---MQTLYHM-HNAEQYDILH-TPPTPRSPEDPRPTTQQ--LHASPALSRLQRFNSYDISRDTLYVSKCICLITPMAFAHACRKVLEQLHQAVTSPQ---------------------------PPPLPLESYVYNVLYEVPLPPAGRSLKFSGVYRPVICQRPSTAELPLFDFPLQEVFELLGLENILQLFTCALLEIQILLYSQHYQRLMTVAESITALMFPFQWQHVYVPILPASLLHFLDAPVPYLMGLHSNGQDDRTKLELPQEANLCFVDIDNHFIELPEDLPQFPNKLEFIQEISEVLLAFGLSPEANPQCSEGQSKIRGFRCGDMAS---------DKRNG--------NLAGSPLNSFLLRENQTIARLQAL------VKR----TGVSL---------EKLDVKDDASTNKDTKVQCEEEE------------MKMHQLNIRVREVFANRFSQMFSDYEVFVIQPSQ--DKESWFSNRDQ-MQNFDKASFLSDQPEPYLPFLSRFLETQMFASFIDSKILCHDDEDKEHTLRVFDSRVDKIR-------------MINVRTPTLRTSMYQKCTNIDEAEKAIEVRLCKIDHTALHPHLLDM---KIG-------------------QGRY---EPGF-------FPRLQSDVLSTGP----TSNKWAKRS-------APAQWRRKDRQKQHAEHLYLD------------NDQREKYIQEARNLGTTLR-----QPKLSNLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKM-GREAVELGHGEVSITGVEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQESKEKRD 833          

HSP 2 Score: 306.605 bits (784), Expect = 8.257e-85
Identity = 203/495 (41.01%), Postives = 283/495 (57.17%), Query Frame = 2
Query: 3344 GISINTGSSKSIDLESIFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNP-----DGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            GI  +T   KS D      P + SL+ D+  I+++++I TDVG ARA+VRL++EKKLLS HLK+LL D  L K+LYKR+AFLRC++E+EQFL+HLL+  AV+Y+ FTN++  I + Y V I   K+   G+  TAN W CV+G+   TG   +PK   +  FE  NLG LT++++GHDNSG+  KW ++ V+++N ITG  YKFPC  WLGKGVDD S ER+LVGE++   E D  E M   P      G+   F +     PNS                        K +     IQE +G A+N +VK+F++ ++ER  L           TLLLCG  GLV ++E+VF+ GFKS RLF K  ++WD+LEK    F              ++     N  M +++FC  +  I    ++IGKDGKFQ  V L  RDH L   I LL +   T Q YE+    +D+ L + LI++L +L +F I LE +L  G
Sbjct:  843 GIIHDTERRKS-DASCAMPPLKVSLIQDMRHIQNISEIKTDVGKARAWVRLSMEKKLLSRHLKQLLSDHELTKKLYKRYAFLRCDDEKEQFLYHLLSFNAVDYFCFTNVFTTIMIPYHVVIIPSKKLG-GSMFTANPWVCVSGELAETGVLQVPKNTLEITFECQNLGKLTTVQMGHDNSGLYAKWLVECVMVRNGITGHTYKFPCGRWLGKGVDDGSLERILVGELVTNMESD--ERMCRTPPMQQSPGMMRRFVTIS---PNS------------------------KPKLNTGQIQESVGEAINGIVKHFHKPEKERGSL-----------TLLLCGEYGLVWALEQVFQHGFKSPRLF-KNVFIWDFLEKAQVYFESAER---------SQMTQDENWQMRVRHFCHFMRAINSTPRNIGKDGKFQMLVCLGARDHLLHHWIALLAECPITAQMYEDVALLKDHSLVNSLIRVLQTLQEFNITLEASLVKG 1285          
BLAST of DENN domain-containing protein 5B vs. Ensembl Zebrafish
Match: dennd5b (DENN/MADD domain containing 5B [Source:NCBI gene;Acc:323528])

HSP 1 Score: 411.379 bits (1056), Expect = 4.778e-120
Identity = 301/959 (31.39%), Postives = 467/959 (48.70%), Query Frame = 2
Query:  149 YFFVCGLDYNVGLDTYELSTESNEYSSPHCIPPLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTG---LCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLVGSINHGNITTRPFSGRRGFCGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNED-GTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIVDKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIR--SYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRK 3007
            YF VCGLD   GL+   L+ E+ + S      PL R +   +L H+P++     F +D ++  LCMP GL  F T     +P  H+F++TRED +R YG    F EE+ + +I + +  L  M++  HN+        S  +S+S  + +  +  S      + S  G    C  + S  + LY  KA+ +++  P++H  + +L  +   VS                                 + LESY++N+L+E   PA G S+   G      CQ P   +LP+ + P+ D   +LG+E+L+++++CVLLE ++++ SQDY+ LM+VAE IT LLFPF W HVY PILP +  HFL+APVP++MG++     +   ++LP +A +C+V+ID   ++  +D P FP      +E++E+L   ++ G       S   G   P       Q S LE +     L   ++ K   N   L  E + +  L+     +E+++  +  TG  +                   L  + AG   +E  G   P +  ++    LN    LRE+F   F  +F DY+ F+I  +++ ++ ++   R+  +  FDKA FLS+QPE +LPFLS F+ETQMF  F++ KI+ +WE+  P L +F+ +++K             + + ++R  S RS    K     E    ++          + PH+LD    +IG                   + KY   Q+ F       FP LQ D L S P    TS     R+    + R+    +Q    V +                   N  KEKY+ E      +   K   +P L ++ P  +AQ +W FV  LL+ECK KTKRM++EKM G+EA+ELGHG+  ++G+EENTL+A LCDLLERIW HGL  K GKSALW+HL  Y  R+ K
Sbjct:   18 YFIVCGLDDETGLEPDALAGENFDQS------PLKRTFKSKVLAHYPENIECNPFDQD-AVNMLCMPKGLS-FRTQRDSLAPHFHSFLITREDGSRTYGFVHTFYEEVTSPQICSAMQTLHQMHQAEHNTSAQNCTSSSSSSSSSSSSSSMDSLSSSLDDVDSPSAHGGRRTCEGYDSIRDTLYVSKAMCLIAPMPFMHACKRFLAQMHRAVS---------------------------CSPPPPLPLESYIYNVLYEVPLPASGRSLKFHGVYEPILCQRPGVGELPLADFPLADAFRLLGVENLVQLFTCVLLEMQILLYSQDYQRLMVVAEGITTLLFPFQWQHVYVPILPASLLHFLDAPVPYLMGLQSKEGTDRSKLELPQEANLCFVDIDNHCIELPEDFPQFPNRSEFIQELSEVL---LSFGQ------SPEGGSSSPEPAVMSLQTSVLEKELKSTSLRELVDDKTNGN---LGGEALDVLELLQGNPTLERLQALAKRTGVKV-----------------ARLEALAAGQKGDEGVGGRSPVEEEELRNAKLNVQ--LREVFAARFATMFADYESFVI--QNSPDLESWLTNREQ-MHNFDKASFLSDQPEPYLPFLSHFIETQMFATFIDNKIMSQWEEKEPLLRVFDGRIEK-------------ARLYNVRAPSLRSSVYQKCTFLKESAQAIEQRLRKIDHTAIHPHLLDM---KIG-------------------QGKY---QQGF-------FPKLQADVLASGP----TSNKWSNRT-CSTQRRVERHRQQNEHLVLD-------------------NELKEKYMQEA-----RNLGKNLRQPKLSDLSPAVIAQTNWKFVEGLLKECKMKTKRMLVEKM-GREAVELGHGEANITGLEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQAREEK 832          

HSP 2 Score: 289.656 bits (740), Expect = 2.785e-79
Identity = 184/467 (39.40%), Postives = 271/467 (58.03%), Query Frame = 2
Query: 3407 RRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALT 4804
            R S++ D+  I++M +I TDVG ARA++RL+LEKKLLS+HLK+LL +  L K+LYKR+AFLRCEEE+EQFLFHLL+L AV+Y+ FT+++  I + YR  I   K+ S    TT+N W CV+G+   +G   I K + +  F+  NLG LT++++GHDNSG+  KW +D V+++N ITG  YKFPC  WLGKGVDD S ER+L+GE +    DD        P                       Q  P      +    +    +     IQE +G AVNN++K+F++ ++ER  L           T+LLCG  GLV ++E+ F  GF+S+R+FQK  +VWD+ E+  + F ++ +   +    P          +  +  C+ ++ I ++ ++IGKDGKFQ  V L  RD  LP+ + LL +     + YEE+   RD      L+ +L +L+DF I LE +LT
Sbjct:  860 RVSVIQDMRHIQNMAEIKTDVGRARAWIRLSLEKKLLSQHLKQLLSNQALTKKLYKRYAFLRCEEEKEQFLFHLLSLNAVDYFCFTSVFTTIMIPYRAVIIPIKKLSNAM-TTSNPWLCVSGELGDSGILQITKNILEMTFDCQNLGKLTTVQLGHDNSGLLAKWLVDCVMVRNEITGHTYKFPCGRWLGKGVDDGSLERVLIGEFVVPCGDDEGGRGSKTPP---------------------LQRSPSQIRRISITSLTGKGNKPTTVQIQESIGEAVNNIIKHFHKPEKERGSL-----------TVLLCGEGGLVWALEQFFHHGFRSARIFQKNVFVWDFFERIVA-FMENRDQTGDLQESPEPLS------LNSESLCRYVNAINNMPRNIGKDGKFQLLVCLGARDRLLPQWLPLLAESPVITRMYEENALLRDKLTVSSLLGVLETLHDFPITLETSLT 1286          
BLAST of DENN domain-containing protein 5B vs. Ensembl Zebrafish
Match: dennd5b (DENN/MADD domain containing 5B [Source:NCBI gene;Acc:323528])

HSP 1 Score: 405.216 bits (1040), Expect = 1.005e-117
Identity = 300/973 (30.83%), Postives = 465/973 (47.79%), Query Frame = 2
Query:  149 YFFVCGLDYNVGLD------TYELSTESNEYSSPHCIP--------PLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTG---LCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLVGSINHGNITTRPFSGRRGFCGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNED-GTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIVDKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIR--SYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRK 3007
            YF VCGLD   GL+       Y+      +   P            PL R +   +L H+P++     F +D ++  LCMP GL  F T     +P  H+F++TRED +R YG    F EE+ + +I + +  L  M++  HN+        S  +S+S  + +  +  S      + S  G    C  + S  + LY  KA+ +++  P++H  + +L  +   VS                                 + LESY++N+L+E   PA G S+   G      CQ P   +LP+ + P+ D   +LG+E+L+++++CVLLE ++++ SQDY+ LM+VAE IT LLFPF W HVY PILP +  HFL+APVP++MG++     +   ++LP +A +C+V+ID   ++  +D P FP      +E++E+L   ++ G       S   G   P       Q S LE +     L   ++ K   N   L  E + +  L+     +E+++  +  TG  +                   L  + AG   +E  G   P +  ++    LN    LRE+F   F  +F DY+ F+I  +++ ++ ++   R+  +  FDKA FLS+QPE +LPFLS F+ETQMF  F++ KI+ +WE+  P L +F+ +++K             + + ++R  S RS    K     E    ++          + PH+LD    +IG                   + KY   Q+ F       FP LQ D L S P    TS     R+    + R+    +Q    V +                   N  KEKY+ E      +   K   +P L ++ P  +AQ +W FV  LL+ECK KTKRM++EKM G+EA+ELGHG+  ++G+EENTL+A LCDLLERIW HGL  K GKSALW+HL  Y  R+ K
Sbjct:   18 YFIVCGLDDETGLEPDALAALYQWLEADRQGKDPEATAAGENFDQSPLKRTFKSKVLAHYPENIECNPFDQD-AVNMLCMPKGLS-FRTQRDSLAPHFHSFLITREDGSRTYGFVHTFYEEVTSPQICSAMQTLHQMHQAEHNTSAQNCTSSSSSSSSSSSSSSMDSLSSSLDDVDSPSAHGGRRTCEGYDSIRDTLYVSKAMCLIAPMPFMHACKRFLAQMHRAVS---------------------------CSPPPPLPLESYIYNVLYEVPLPASGRSLKFHGVYEPILCQRPGVGELPLADFPLADAFRLLGVENLVQLFTCVLLEMQILLYSQDYQRLMVVAEGITTLLFPFQWQHVYVPILPASLLHFLDAPVPYLMGLQSKEGTDRSKLELPQEANLCFVDIDNHCIELPEDFPQFPNRSEFIQELSEVL---LSFGQ------SPEGGSSSPEPAVMSLQTSVLEKELKSTSLRELVDDKTNGN---LGGEALDVLELLQGNPTLERLQALAKRTGVKV-----------------ARLEALAAGQKGDEGVGGRSPVEEEELRNAKLNVQ--LREVFAARFATMFADYESFVI--QNSPDLESWLTNREQ-MHNFDKASFLSDQPEPYLPFLSHFIETQMFATFIDNKIMSQWEEKEPLLRVFDGRIEK-------------ARLYNVRAPSLRSSVYQKCTFLKESAQAIEQRLRKIDHTAIHPHLLDM---KIG-------------------QGKY---QQGF-------FPKLQADVLASGP----TSNKWSNRT-CSTQRRVERHRQQNEHLVLD-------------------NELKEKYMQEA-----RNLGKNLRQPKLSDLSPAVIAQTNWKFVEGLLKECKMKTKRMLVEKM-GREAVELGHGEANITGLEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQAREEK 852          

HSP 2 Score: 289.656 bits (740), Expect = 3.026e-79
Identity = 184/467 (39.40%), Postives = 271/467 (58.03%), Query Frame = 2
Query: 3407 RRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALT 4804
            R S++ D+  I++M +I TDVG ARA++RL+LEKKLLS+HLK+LL +  L K+LYKR+AFLRCEEE+EQFLFHLL+L AV+Y+ FT+++  I + YR  I   K+ S    TT+N W CV+G+   +G   I K + +  F+  NLG LT++++GHDNSG+  KW +D V+++N ITG  YKFPC  WLGKGVDD S ER+L+GE +    DD        P                       Q  P      +    +    +     IQE +G AVNN++K+F++ ++ER  L           T+LLCG  GLV ++E+ F  GF+S+R+FQK  +VWD+ E+  + F ++ +   +    P          +  +  C+ ++ I ++ ++IGKDGKFQ  V L  RD  LP+ + LL +     + YEE+   RD      L+ +L +L+DF I LE +LT
Sbjct:  880 RVSVIQDMRHIQNMAEIKTDVGRARAWIRLSLEKKLLSQHLKQLLSNQALTKKLYKRYAFLRCEEEKEQFLFHLLSLNAVDYFCFTSVFTTIMIPYRAVIIPIKKLSNAM-TTSNPWLCVSGELGDSGILQITKNILEMTFDCQNLGKLTTVQLGHDNSGLLAKWLVDCVMVRNEITGHTYKFPCGRWLGKGVDDGSLERVLIGEFVVPCGDDEGGRGSKTPP---------------------LQRSPSQIRRISITSLTGKGNKPTTVQIQESIGEAVNNIIKHFHKPEKERGSL-----------TVLLCGEGGLVWALEQFFHHGFRSARIFQKNVFVWDFFERIVA-FMENRDQTGDLQESPEPLS------LNSESLCRYVNAINNMPRNIGKDGKFQLLVCLGARDRLLPQWLPLLAESPVITRMYEENALLRDKLTVSSLLGVLETLHDFPITLETSLT 1306          
BLAST of DENN domain-containing protein 5B vs. Ensembl Zebrafish
Match: dennd5b (DENN/MADD domain containing 5B [Source:NCBI gene;Acc:323528])

HSP 1 Score: 404.831 bits (1039), Expect = 1.677e-117
Identity = 300/973 (30.83%), Postives = 465/973 (47.79%), Query Frame = 2
Query:  149 YFFVCGLDYNVGLD------TYELSTESNEYSSPHCIP--------PLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTG---LCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLVGSINHGNITTRPFSGRRGFCGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNED-GTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIVDKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIR--SYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRK 3007
            YF VCGLD   GL+       Y+      +   P            PL R +   +L H+P++     F +D ++  LCMP GL  F T     +P  H+F++TRED +R YG    F EE+ + +I + +  L  M++  HN+        S  +S+S  + +  +  S      + S  G    C  + S  + LY  KA+ +++  P++H  + +L  +   VS                                 + LESY++N+L+E   PA G S+   G      CQ P   +LP+ + P+ D   +LG+E+L+++++CVLLE ++++ SQDY+ LM+VAE IT LLFPF W HVY PILP +  HFL+APVP++MG++     +   ++LP +A +C+V+ID   ++  +D P FP      +E++E+L   ++ G       S   G   P       Q S LE +     L   ++ K   N   L  E + +  L+     +E+++  +  TG  +                   L  + AG   +E  G   P +  ++    LN    LRE+F   F  +F DY+ F+I  +++ ++ ++   R+  +  FDKA FLS+QPE +LPFLS F+ETQMF  F++ KI+ +WE+  P L +F+ +++K             + + ++R  S RS    K     E    ++          + PH+LD    +IG                   + KY   Q+ F       FP LQ D L S P    TS     R+    + R+    +Q    V +                   N  KEKY+ E      +   K   +P L ++ P  +AQ +W FV  LL+ECK KTKRM++EKM G+EA+ELGHG+  ++G+EENTL+A LCDLLERIW HGL  K GKSALW+HL  Y  R+ K
Sbjct:   18 YFIVCGLDDETGLEPDALAALYQWLEADRQGKDPEATAAGENFDQSPLKRTFKSKVLAHYPENIECNPFDQD-AVNMLCMPKGLS-FRTQRDSLAPHFHSFLITREDGSRTYGFVHTFYEEVTSPQICSAMQTLHQMHQAEHNTSAQNCTSSSSSSSSSSSSSSMDSLSSSLDDVDSPSAHGGRRTCEGYDSIRDTLYVSKAMCLIAPMPFMHACKRFLAQMHRAVS---------------------------CSPPPPLPLESYIYNVLYEVPLPASGRSLKFHGVYEPILCQRPGVGELPLADFPLADAFRLLGVENLVQLFTCVLLEMQILLYSQDYQRLMVVAEGITTLLFPFQWQHVYVPILPASLLHFLDAPVPYLMGLQSKEGTDRSKLELPQEANLCFVDIDNHCIELPEDFPQFPNRSEFIQELSEVL---LSFGQ------SPEGGSSSPEPAVMSLQTSVLEKELKSTSLRELVDDKTNGN---LGGEALDVLELLQGNPTLERLQALAKRTGVKV-----------------ARLEALAAGQKGDEGVGGRSPVEEEELRNAKLNVQ--LREVFAARFATMFADYESFVI--QNSPDLESWLTNREQ-MHNFDKASFLSDQPEPYLPFLSHFIETQMFATFIDNKIMSQWEEKEPLLRVFDGRIEK-------------ARLYNVRAPSLRSSVYQKCTFLKESAQAIEQRLRKIDHTAIHPHLLDM---KIG-------------------QGKY---QQGF-------FPKLQADVLASGP----TSNKWSNRT-CSTQRRVERHRQQNEHLVLD-------------------NELKEKYMQEA-----RNLGKNLRQPKLSDLSPAVIAQTNWKFVEGLLKECKMKTKRMLVEKM-GREAVELGHGEANITGLEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQAREEK 852          

HSP 2 Score: 281.567 bits (719), Expect = 1.416e-76
Identity = 184/481 (38.25%), Postives = 272/481 (56.55%), Query Frame = 2
Query: 3407 RRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENP--------------NLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALT 4804
            R S++ D+  I++M +I TDVG ARA++RL+LEKKLLS+HLK+LL +  L K+LYKR+AFLRCEEE+EQFLFHLL+L AV+Y+ FT+++  I + YR  I   K+ S    TT+N W CV+G+   +G   I K + +  F++               NLG LT++++GHDNSG+  KW +D V+++N ITG  YKFPC  WLGKGVDD S ER+L+GE +    DD        P                       Q  P      +    +    +     IQE +G AVNN++K+F++ ++ER  L           T+LLCG  GLV ++E+ F  GF+S+R+FQK  +VWD+ E+  + F ++ +   +    P          +  +  C+ ++ I ++ ++IGKDGKFQ  V L  RD  LP+ + LL +     + YEE+   RD      L+ +L +L+DF I LE +LT
Sbjct:  880 RVSVIQDMRHIQNMAEIKTDVGRARAWIRLSLEKKLLSQHLKQLLSNQALTKKLYKRYAFLRCEEEKEQFLFHLLSLNAVDYFCFTSVFTTIMIPYRAVIIPIKKLSNAM-TTSNPWLCVSGELGDSGILQITKNILEMTFDSAFRPHTHISIAFKCQNLGKLTTVQLGHDNSGLLAKWLVDCVMVRNEITGHTYKFPCGRWLGKGVDDGSLERVLIGEFVVPCGDDEGGRGSKTPP---------------------LQRSPSQIRRISITSLTGKGNKPTTVQIQESIGEAVNNIIKHFHKPEKERGSL-----------TVLLCGEGGLVWALEQFFHHGFRSARIFQKNVFVWDFFERIVA-FMENRDQTGDLQESPEPLS------LNSESLCRYVNAINNMPRNIGKDGKFQLLVCLGARDRLLPQWLPLLAESPVITRMYEENALLRDKLTVSSLLGVLETLHDFPITLETSLT 1320          
BLAST of DENN domain-containing protein 5B vs. Ensembl Xenopus
Match: tead4 (TEA domain transcription factor 4 [Source:Xenbase;Acc:XB-GENE-956369])

HSP 1 Score: 401.364 bits (1030), Expect = 7.216e-117
Identity = 292/930 (31.40%), Postives = 453/930 (48.71%), Query Frame = 2
Query:  245 PLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSM----YKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLV--GSINHGNITTRPFSGRRGFCGPIINS--NIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIV-DKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIRSYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRK 3007
            PL R +   +L  +P++    AF +D ++  LCMP GL  F T   P+ P  H FI+TRED +R +G SL F EE+ +++I + +  L  M    Y I H S + G     ECT +S                  I+      S+    + LY  K I +++   ++   +  L  +   V++                                + LESY++NIL+E   P  G S+  +G      CQ P   +LP+F+ P +++ E+LG+E+++++++C LLE+++++ SQ Y+ LM VAE IT L+FPF W HVY PILP +  HFL+APVP++MG+  N  D+   ++LP +A +C+V+ID   ++  +D+P FP ++   +E++E+L+  G    GN+           C   I+   N++    +  K + N     +N   Y+    L+ EN TI  L  +      ++R    TG S+                     E+   +   +DG    A   +   +M   N  +RE+F N F  +F DY+ F+I P    +  ++F  R+  +Q FDKA FLS+QPE +LPFLS FLETQMF  F++ KI+    +D  P L +F+     R DK ++L    N     +R+      + I E ++           T    + PH+LD    +IG                   + KY   +  F       FP LQ D L + P   +T+K   + +        P ++R+K R    +  +               N Q+EKY+ E        R     +P L N+ P  +AQ +W FV  LL+EC+ KTKRM++EKM G+EA+ELGHG++ ++G+EEN L+A LCDLLERIW HGL  K GKSALW+HL  Y D  R+
Sbjct:    7 PLRRTFKSKVLARYPENVEWNAFDQD-AVGMLCMPKGL-AFKTQADPKEPQYHAFIITREDGSRTFGFSLTFFEEVTSKQICSAMQTLYHMHNAEYDIIHTSASNGRDCPGECTDSS------------------ITKLQRFNSYDITRDTLYVSKCICLIAPMSFMTACKKVLEQLHQAVTSPQ---------------------------PPPLPLESYIYNILYEVPLPPAGRSLKFNGVYGPIVCQRPSTNELPLFDFPAQEVFELLGVENVVQLFTCALLEFQILLYSQHYQRLMTVAETITGLMFPFQWQHVYVPILPASLLHFLDAPVPYLMGLHSNGLDDRSKLELPQEANLCFVDIDNHFIELPEDLPQFPNKLEFIQEVSEILLAFGIPPEGNL----------HCSESISKLRNLKAADLVSDKRNGNLAGSPLN--SYE----LLKENETIARLQAL------VKR----TGVSL------------------EKVEVREESSSKKDGK---AHCDEEELRMHQLNIQVREVFANRFTQMFADYEVFVIQPSQ--DKESWFTNREQ-MQNFDKASFLSDQPEPYLPFLSRFLETQMFASFIDNKIMCHDDDDKDPVLRVFD----SRVDKIRQL----NVRTPTLRTSMYQKCTAIEEAVKAIEQRLSKIDHT---AIHPHLLDM---KIG-------------------QGKY---EPGF-------FPKLQSDVLSTGP---ATNKWTKRNA--------PAQWRRKDRQKQHSEHLRLD------------NDQREKYIQEARNMSSGIR-----QPKLSNLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKM-GREAVELGHGEVSITGVEENALIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQDSRRR 767          

HSP 2 Score: 291.967 bits (746), Expect = 4.364e-80
Identity = 187/475 (39.37%), Postives = 276/475 (58.11%), Query Frame = 2
Query: 3392 IFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNPDGVDISFFSEENDV-PNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            +  P + SLV D+  I+++ +I TDVG ARA+VRL++EKKLLS HLK+LL+D  L K+LYKR+AFLRC++E+EQFL+HLL+  AV+Y+ FTN++  I + Y + I   K+   G+  TAN W C++G+   TG   +P+ + +  +E  NLG LT+++IGHDNSG+  KW +++V+++N ITG  YKFPC  WLGKG+DD S ER+LVG+++  + D   +     P     S       + PNS                        + +     IQE +G AVN +VK+F++ ++ER  L           TLLLCG +GLV ++E+VF+ G +S RLF K  ++WD+LEK  + +              NE     +     + F + I+ I +  ++IGKDGKFQ FV L  RDH L   I LL       Q YEE+   +D+ L + LI++L +L +F I LE +L  G
Sbjct:  789 VMYPLKISLVQDMRHIQNIGEIKTDVGKARAWVRLSMEKKLLSRHLKQLLLDHDLSKKLYKRYAFLRCDDEKEQFLYHLLSFNAVDYFCFTNVFTTIMIPYHILIVPSKKLG-GSMFTANPWICISGELGETGVLQVPRNILEMTYECQNLGKLTTVQIGHDNSGLYAKWLVEYVMVRNEITGHTYKFPCGRWLGKGMDDGSLERVLVGDLLTSSTDTEEKPCRTPPLQHSPSMIRRLVAISPNS------------------------RPKLNTGQIQEAIGEAVNGIVKHFHKPEKERGSL-----------TLLLCGENGLVSALEQVFQHGIRSPRLF-KSIFIWDFLEKAQAYYESLEV---------NELVPEEDWQKRARNFSRFINAINNNPRNIGKDGKFQMFVCLGARDHHLHHWIALLADCPIIAQMYEETALIKDHTLVNSLIRVLQTLQEFNITLESSLIKG 1217          
BLAST of DENN domain-containing protein 5B vs. Ensembl Xenopus
Match: tead4 (TEA domain transcription factor 4 [Source:Xenbase;Acc:XB-GENE-956369])

HSP 1 Score: 401.364 bits (1030), Expect = 9.066e-117
Identity = 292/930 (31.40%), Postives = 453/930 (48.71%), Query Frame = 2
Query:  245 PLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSM----YKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLV--GSINHGNITTRPFSGRRGFCGPIINS--NIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIV-DKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIRSYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRK 3007
            PL R +   +L  +P++    AF +D ++  LCMP GL  F T   P+ P  H FI+TRED +R +G SL F EE+ +++I + +  L  M    Y I H S + G     ECT +S                  I+      S+    + LY  K I +++   ++   +  L  +   V++                                + LESY++NIL+E   P  G S+  +G      CQ P   +LP+F+ P +++ E+LG+E+++++++C LLE+++++ SQ Y+ LM VAE IT L+FPF W HVY PILP +  HFL+APVP++MG+  N  D+   ++LP +A +C+V+ID   ++  +D+P FP ++   +E++E+L+  G    GN+           C   I+   N++    +  K + N     +N   Y+    L+ EN TI  L  +      ++R    TG S+                     E+   +   +DG    A   +   +M   N  +RE+F N F  +F DY+ F+I P    +  ++F  R+  +Q FDKA FLS+QPE +LPFLS FLETQMF  F++ KI+    +D  P L +F+     R DK ++L    N     +R+      + I E ++           T    + PH+LD    +IG                   + KY   +  F       FP LQ D L + P   +T+K   + +        P ++R+K R    +  +               N Q+EKY+ E        R     +P L N+ P  +AQ +W FV  LL+EC+ KTKRM++EKM G+EA+ELGHG++ ++G+EEN L+A LCDLLERIW HGL  K GKSALW+HL  Y D  R+
Sbjct:   25 PLRRTFKSKVLARYPENVEWNAFDQD-AVGMLCMPKGLA-FKTQADPKEPQYHAFIITREDGSRTFGFSLTFFEEVTSKQICSAMQTLYHMHNAEYDIIHTSASNGRDCPGECTDSS------------------ITKLQRFNSYDITRDTLYVSKCICLIAPMSFMTACKKVLEQLHQAVTSPQ---------------------------PPPLPLESYIYNILYEVPLPPAGRSLKFNGVYGPIVCQRPSTNELPLFDFPAQEVFELLGVENVVQLFTCALLEFQILLYSQHYQRLMTVAETITGLMFPFQWQHVYVPILPASLLHFLDAPVPYLMGLHSNGLDDRSKLELPQEANLCFVDIDNHFIELPEDLPQFPNKLEFIQEVSEILLAFGIPPEGNL----------HCSESISKLRNLKAADLVSDKRNGNLAGSPLN--SYE----LLKENETIARLQAL------VKR----TGVSLEK------------------VEVREESSSKKDGK---AHCDEEELRMHQLNIQVREVFANRFTQMFADYEVFVIQPSQ--DKESWFTNREQ-MQNFDKASFLSDQPEPYLPFLSRFLETQMFASFIDNKIMCHDDDDKDPVLRVFD----SRVDKIRQL----NVRTPTLRTSMYQKCTAIEEAVKAIEQRLSKIDHT---AIHPHLLDM---KIG-------------------QGKY---EPGF-------FPKLQSDVLSTGP---ATNKWTKRNA--------PAQWRRKDRQKQHSEHLRLD------------NDQREKYIQEARNMSSGIR-----QPKLSNLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKM-GREAVELGHGEVSITGVEENALIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQDSRRR 785          

HSP 2 Score: 291.582 bits (745), Expect = 6.292e-80
Identity = 187/475 (39.37%), Postives = 276/475 (58.11%), Query Frame = 2
Query: 3392 IFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNPDGVDISFFSEENDV-PNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            +  P + SLV D+  I+++ +I TDVG ARA+VRL++EKKLLS HLK+LL+D  L K+LYKR+AFLRC++E+EQFL+HLL+  AV+Y+ FTN++  I + Y + I   K+   G+  TAN W C++G+   TG   +P+ + +  +E  NLG LT+++IGHDNSG+  KW +++V+++N ITG  YKFPC  WLGKG+DD S ER+LVG+++  + D   +     P     S       + PNS                        + +     IQE +G AVN +VK+F++ ++ER  L           TLLLCG +GLV ++E+VF+ G +S RLF K  ++WD+LEK  + +              NE     +     + F + I+ I +  ++IGKDGKFQ FV L  RDH L   I LL       Q YEE+   +D+ L + LI++L +L +F I LE +L  G
Sbjct:  810 VMYPLKISLVQDMRHIQNIGEIKTDVGKARAWVRLSMEKKLLSRHLKQLLLDHDLSKKLYKRYAFLRCDDEKEQFLYHLLSFNAVDYFCFTNVFTTIMIPYHILIVPSKKLG-GSMFTANPWICISGELGETGVLQVPRNILEMTYECQNLGKLTTVQIGHDNSGLYAKWLVEYVMVRNEITGHTYKFPCGRWLGKGMDDGSLERVLVGDLLTSSTDTEEKPCRTPPLQHSPSMIRRLVAISPNS------------------------RPKLNTGQIQEAIGEAVNGIVKHFHKPEKERGSL-----------TLLLCGENGLVSALEQVFQHGIRSPRLF-KSIFIWDFLEKAQAYYESLEV---------NELVPEEDWQKRARNFSRFINAINNNPRNIGKDGKFQMFVCLGARDHHLHHWIALLADCPIIAQMYEETALIKDHTLVNSLIRVLQTLQEFNITLESSLIKG 1238          
BLAST of DENN domain-containing protein 5B vs. Ensembl Xenopus
Match: tead4 (TEA domain transcription factor 4 [Source:Xenbase;Acc:XB-GENE-956369])

HSP 1 Score: 401.364 bits (1030), Expect = 1.154e-116
Identity = 291/929 (31.32%), Postives = 454/929 (48.87%), Query Frame = 2
Query:  245 PLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSM----YKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLV--GSINHGNITTRPFSGRRGFCGPIINSNIQQVSELESKNSINQLPPKINLKGYD-NFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIV-DKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIRSYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRK 3007
            PL R +   +L  +P++    AF +D ++  LCMP GL  F T   P+ P  H FI+TRED +R +G SL F EE+ +++I + +  L  M    Y I H S + G     ECT +S                  I+      S+    + LY  K I +++   ++   +  L  +   V++                                + LESY++NIL+E   P  G S+  +G      CQ P   +LP+F+ P +++ E+LG+E+++++++C LLE+++++ SQ Y+ LM VAE IT L+FPF W HVY PILP +  HFL+APVP++MG+  N  D+   ++LP +A +C+V+ID   ++  +D+P FP ++   +E++E+L+  G    GN+                + +I ++  L++ + ++      NL G   N   L+ EN TI  L  +      ++R    TG S+                     E+   +   +DG    A   +   +M   N  +RE+F N F  +F DY+ F+I P    +  ++F  R+  +Q FDKA FLS+QPE +LPFLS FLETQMF  F++ KI+    +D  P L +F+     R DK ++L    N     +R+      + I E ++           T    + PH+LD    +IG                   + KY   +  F       FP LQ D L + P   +T+K   + +        P ++R+K R    +  +               N Q+EKY+ E        R     +P L N+ P  +AQ +W FV  LL+EC+ KTKRM++EKM G+EA+ELGHG++ ++G+EEN L+A LCDLLERIW HGL  K GKSALW+HL  Y D  R+
Sbjct:   32 PLRRTFKSKVLARYPENVEWNAFDQD-AVGMLCMPKGLA-FKTQADPKEPQYHAFIITREDGSRTFGFSLTFFEEVTSKQICSAMQTLYHMHNAEYDIIHTSASNGRDCPGECTDSS------------------ITKLQRFNSYDITRDTLYVSKCICLIAPMSFMTACKKVLEQLHQAVTSPQ---------------------------PPPLPLESYIYNILYEVPLPPAGRSLKFNGVYGPIVCQRPSTNELPLFDFPAQEVFELLGVENVVQLFTCALLEFQILLYSQHYQRLMTVAETITGLMFPFQWQHVYVPILPASLLHFLDAPVPYLMGLHSNGLDDRSKLELPQEANLCFVDIDNHFIELPEDLPQFPNKLEFIQEVSEILLAFGIPPEGNLHC--------------SESISKLRNLKAADLVSD-KRNGNLAGSPLNSYELLKENETIARLQAL------VKR----TGVSLEK------------------VEVREESSSKKDGK---AHCDEEELRMHQLNIQVREVFANRFTQMFADYEVFVIQPSQ--DKESWFTNREQ-MQNFDKASFLSDQPEPYLPFLSRFLETQMFASFIDNKIMCHDDDDKDPVLRVFD----SRVDKIRQL----NVRTPTLRTSMYQKCTAIEEAVKAIEQRLSKIDHT---AIHPHLLDM---KIG-------------------QGKY---EPGF-------FPKLQSDVLSTGP---ATNKWTKRNA--------PAQWRRKDRQKQHSEHLRLD------------NDQREKYIQEARNMSSGIR-----QPKLSNLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKM-GREAVELGHGEVSITGVEENALIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQDSRRR 792          

HSP 2 Score: 291.582 bits (745), Expect = 6.966e-80
Identity = 194/498 (38.96%), Postives = 287/498 (57.63%), Query Frame = 2
Query: 3323 GSLGRSGGISINTGSSKSIDLESIFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNPDGVDISFFSEENDV-PNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            GSLG +  + ++    KS D   +  P + SLV D+  I+++ +I TDVG ARA+VRL++EKKLLS HLK+LL+D  L K+LYKR+AFLRC++E+EQFL+HLL+  AV+Y+ FTN++  I + Y + I   K+   G+  TAN W C++G+   TG   +P+ + +  +E  NLG LT+++IGHDNSG+  KW +++V+++N ITG  YKFPC  WLGKG+DD S ER+LVG+++  + D   +     P     S       + PNS                        + +     IQE +G AVN +VK+F++ ++ER  L           TLLLCG +GLV ++E+VF+ G +S RLF K  ++WD+LEK  + +              NE     +     + F + I+ I +  ++IGKDGKFQ FV L  RDH L   I LL       Q YEE+   +D+ L + LI++L +L +F I LE +L  G
Sbjct:  796 GSLGGTD-LVLDCERRKS-DPFLVMYPLKISLVQDMRHIQNIGEIKTDVGKARAWVRLSMEKKLLSRHLKQLLLDHDLSKKLYKRYAFLRCDDEKEQFLYHLLSFNAVDYFCFTNVFTTIMIPYHILIVPSKKLG-GSMFTANPWICISGELGETGVLQVPRNILEMTYECQNLGKLTTVQIGHDNSGLYAKWLVEYVMVRNEITGHTYKFPCGRWLGKGMDDGSLERVLVGDLLTSSTDTEEKPCRTPPLQHSPSMIRRLVAISPNS------------------------RPKLNTGQIQEAIGEAVNGIVKHFHKPEKERGSL-----------TLLLCGENGLVSALEQVFQHGIRSPRLF-KSIFIWDFLEKAQAYYESLEV---------NELVPEEDWQKRARNFSRFINAINNNPRNIGKDGKFQMFVCLGARDHHLHHWIALLADCPIIAQMYEETALIKDHTLVNSLIRVLQTLQEFNITLESSLIKG 1245          
BLAST of DENN domain-containing protein 5B vs. Ensembl Xenopus
Match: tead4 (TEA domain transcription factor 4 [Source:Xenbase;Acc:XB-GENE-956369])

HSP 1 Score: 397.127 bits (1019), Expect = 3.389e-115
Identity = 290/929 (31.22%), Postives = 451/929 (48.55%), Query Frame = 2
Query:  245 PLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSM----YKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLV--GSINHGNITTRPFSGRRGFCGPIINSNIQQVSELESKNSINQLPPKINLKGYD-NFKTLMNENVTIDNLVDI----PLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIV-DKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIRSYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVD 2995
            PL R +   +L  +P++    AF +D ++  LCMP GL  F T   P+ P  H FI+TRED +R +G SL F EE+ +++I + +  L  M    Y I H S + G     ECT +S                  I+      S+    + LY  K I +++   ++   +  L  +   V++                                + LESY++NIL+E   P  G S+  +G      CQ P   +LP+F+ P +++ E+LG+E+++++++C LLE+++++ SQ Y+ LM VAE IT L+FPF W HVY PILP +  HFL+APVP++MG+  N  D+   ++LP +A +C+V+ID   ++  +D+P FP ++   +E++E+L+  G    GN+                + +I ++  L++ + ++      NL G   N   L+ EN TI  L  +     + +EK+   S ++ SS  DGK   +   L                                 +M   N  +RE+F N F  +F DY+ F+I P    +  ++F  R+  +Q FDKA FLS+QPE +LPFLS FLETQMF  F++ KI+    +D  P L +F+     R DK ++L    N     +R+      + I E       ++          + PH+LD    +IG                   + KY   +  F       FP LQ D L + P   +T+K   + +        P ++R+K R    +  +               N Q+EKY+ E        R     +P L N+ P  +AQ +W FV  LL+EC+ KTKRM++EKM G+EA+ELGHG++ ++G+EEN L+A LCDLLERIW HGL  K GKSALW+HL  Y D
Sbjct:   54 PLRRTFKSKVLARYPENVEWNAFDQD-AVGMLCMPKGLA-FKTQADPKEPQYHAFIITREDGSRTFGFSLTFFEEVTSKQICSAMQTLYHMHNAEYDIIHTSASNGRDCPGECTDSS------------------ITKLQRFNSYDITRDTLYVSKCICLIAPMSFMTACKKVLEQLHQAVTSPQ---------------------------PPPLPLESYIYNILYEVPLPPAGRSLKFNGVYGPIVCQRPSTNELPLFDFPAQEVFELLGVENVVQLFTCALLEFQILLYSQHYQRLMTVAETITGLMFPFQWQHVYVPILPASLLHFLDAPVPYLMGLHSNGLDDRSKLELPQEANLCFVDIDNHFIELPEDLPQFPNKLEFIQEVSEILLAFGIPPEGNLHC--------------SESISKLRNLKAADLVSD-KRNGNLAGSPLNSYELLKENETIARLQALVKRTGVSLEKV---SLLSLSSKKDGKAHCDEEEL---------------------------------RMHQLNIQVREVFANRFTQMFADYEVFVIQPSQ--DKESWFTNREQ-MQNFDKASFLSDQPEPYLPFLSRFLETQMFASFIDNKIMCHDDDDKDPVLRVFD----SRVDKIRQL----NVRTPTLRTSMYQKCTAIEE-----AAIEQRLSKIDHTAIHPHLLDM---KIG-------------------QGKY---EPGF-------FPKLQSDVLSTGP---ATNKWTKRNA--------PAQWRRKDRQKQHSEHLRLD------------NDQREKYIQEARNMSSGIR-----QPKLSNLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKM-GREAVELGHGEVSITGVEENALIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQD 807          

HSP 2 Score: 290.041 bits (741), Expect = 2.102e-79
Identity = 186/474 (39.24%), Postives = 276/474 (58.23%), Query Frame = 2
Query: 3392 IFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            +  P + SLV D+  I+++ +I TDVG ARA+VRL++EKKLLS HLK+LL+D  L K+LYKR+AFLRC++E+EQFL+HLL+  AV+Y+ FTN++  I + Y + I   K+   G+  TAN W C++G+   TG   +P+ + +  +E  NLG LT+++IGHDNSG+  KW +++V+++N ITG  YKFPC  WLGKG+DD S ER+LVG+++  + D   +     P     S       +                        S +K+ +    IQE +G AVN +VK+F++ ++ER  L           TLLLCG +GLV ++E+VF+ G +S RLF K  ++WD+LEK  + +              NE     +     + F + I+ I +  ++IGKDGKFQ FV L  RDH L   I LL       Q YEE+   +D+ L + LI++L +L +F I LE +L  G
Sbjct:  823 VMYPLKISLVQDMRHIQNIGEIKTDVGKARAWVRLSMEKKLLSRHLKQLLLDHDLSKKLYKRYAFLRCDDEKEQFLYHLLSFNAVDYFCFTNVFTTIMIPYHILIVPSKKLG-GSMFTANPWICISGELGETGVLQVPRNILEMTYECQNLGKLTTVQIGHDNSGLYAKWLVEYVMVRNEITGHTYKFPCGRWLGKGMDDGSLERVLVGDLLTSSTDTEEKPCRTPPLQHSPSMIRRLVAI------------------------SPNKLNT--GQIQEAIGEAVNGIVKHFHKPEKERGSL-----------TLLLCGENGLVSALEQVFQHGIRSPRLF-KSIFIWDFLEKAQAYYESLEV---------NELVPEEDWQKRARNFSRFINAINNNPRNIGKDGKFQMFVCLGARDHHLHHWIALLADCPIIAQMYEETALIKDHTLVNSLIRVLQTLQEFNITLESSLIKG 1248          
BLAST of DENN domain-containing protein 5B vs. Ensembl Xenopus
Match: tead4 (TEA domain transcription factor 4 [Source:Xenbase;Acc:XB-GENE-956369])

HSP 1 Score: 390.963 bits (1003), Expect = 1.652e-113
Identity = 284/899 (31.59%), Postives = 438/899 (48.72%), Query Frame = 2
Query:  338 LCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSM----YKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLV--GSINHGNITTRPFSGRRGFCGPIINS--NIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIV-DKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIRSYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRK 3007
            LCMP GL  F T   P+ P  H FI+TRED +R +G SL F EE+ +++I + +  L  M    Y I H S + G     ECT +S                  I+      S+    + LY  K I +++   ++   +  L  +   V++                                + LESY++NIL+E   P  G S+  +G      CQ P   +LP+F+ P +++ E+LG+E+++++++C LLE+++++ SQ Y+ LM VAE IT L+FPF W HVY PILP +  HFL+APVP++MG+  N  D+   ++LP +A +C+V+ID   ++  +D+P FP ++   +E++E+L+  G    GN+           C   I+   N++    +  K + N     +N   Y+    L+ EN TI  L  +      ++R    TG S+                 +   E+   +   +DG    A   +   +M   N  +RE+F N F  +F DY+ F+I P    +  ++F  R+  +Q FDKA FLS+QPE +LPFLS FLETQMF  F++ KI+    +D  P L +F+     R DK ++L    N     +R+      + I E ++           T    + PH+LD    +IG                   + KY   +  F       FP LQ D L + P   +T+K   + +        P ++R+K R    +  +               N Q+EKY+ E        R     +P L N+ P  +AQ +W FV  LL+EC+ KTKRM++EKM G+EA+ELGHG++ ++G+EEN L+A LCDLLERIW HGL  K GKSALW+HL  Y D  R+
Sbjct:    2 LCMPKGLA-FKTQADPKEPQYHAFIITREDGSRTFGFSLTFFEEVTSKQICSAMQTLYHMHNAEYDIIHTSASNGRDCPGECTDSS------------------ITKLQRFNSYDITRDTLYVSKCICLIAPMSFMTACKKVLEQLHQAVTSPQ---------------------------PPPLPLESYIYNILYEVPLPPAGRSLKFNGVYGPIVCQRPSTNELPLFDFPAQEVFELLGVENVVQLFTCALLEFQILLYSQHYQRLMTVAETITGLMFPFQWQHVYVPILPASLLHFLDAPVPYLMGLHSNGLDDRSKLELPQEANLCFVDIDNHFIELPEDLPQFPNKLEFIQEVSEILLAFGIPPEGNL----------HCSESISKLRNLKAADLVSDKRNGNLAGSPLN--SYE----LLKENETIARLQAL------VKR----TGVSL-----------------EKQVEVREESSSKKDGK---AHCDEEELRMHQLNIQVREVFANRFTQMFADYEVFVIQPSQ--DKESWFTNREQ-MQNFDKASFLSDQPEPYLPFLSRFLETQMFASFIDNKIMCHDDDDKDPVLRVFD----SRVDKIRQL----NVRTPTLRTSMYQKCTAIEEAVKAIEQRLSKIDHT---AIHPHLLDM---KIG-------------------QGKY---EPGF-------FPKLQSDVLSTGP---ATNKWTKRNA--------PAQWRRKDRQKQHSEHLRLD------------NDQREKYIQEARNMSSGIR-----QPKLSNLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKM-GREAVELGHGEVSITGVEENALIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQDSRRR 733          

HSP 2 Score: 292.352 bits (747), Expect = 2.606e-80
Identity = 187/475 (39.37%), Postives = 276/475 (58.11%), Query Frame = 2
Query: 3392 IFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNPDGVDISFFSEENDV-PNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            +  P + SLV D+  I+++ +I TDVG ARA+VRL++EKKLLS HLK+LL+D  L K+LYKR+AFLRC++E+EQFL+HLL+  AV+Y+ FTN++  I + Y + I   K+   G+  TAN W C++G+   TG   +P+ + +  +E  NLG LT+++IGHDNSG+  KW +++V+++N ITG  YKFPC  WLGKG+DD S ER+LVG+++  + D   +     P     S       + PNS                        + +     IQE +G AVN +VK+F++ ++ER  L           TLLLCG +GLV ++E+VF+ G +S RLF K  ++WD+LEK  + +              NE     +     + F + I+ I +  ++IGKDGKFQ FV L  RDH L   I LL       Q YEE+   +D+ L + LI++L +L +F I LE +L  G
Sbjct:  758 VMYPLKISLVQDMRHIQNIGEIKTDVGKARAWVRLSMEKKLLSRHLKQLLLDHDLSKKLYKRYAFLRCDDEKEQFLYHLLSFNAVDYFCFTNVFTTIMIPYHILIVPSKKLG-GSMFTANPWICISGELGETGVLQVPRNILEMTYECQNLGKLTTVQIGHDNSGLYAKWLVEYVMVRNEITGHTYKFPCGRWLGKGMDDGSLERVLVGDLLTSSTDTEEKPCRTPPLQHSPSMIRRLVAISPNS------------------------RPKLNTGQIQEAIGEAVNGIVKHFHKPEKERGSL-----------TLLLCGENGLVSALEQVFQHGIRSPRLF-KSIFIWDFLEKAQAYYESLEV---------NELVPEEDWQKRARNFSRFINAINNNPRNIGKDGKFQMFVCLGARDHHLHHWIALLADCPIIAQMYEETALIKDHTLVNSLIRVLQTLQEFNITLESSLIKG 1186          
BLAST of DENN domain-containing protein 5B vs. Ensembl Mouse
Match: Dennd5a (DENN/MADD domain containing 5A [Source:MGI Symbol;Acc:MGI:1201681])

HSP 1 Score: 412.92 bits (1060), Expect = 9.952e-121
Identity = 303/964 (31.43%), Postives = 473/964 (49.07%), Query Frame = 2
Query:  140 LVDYFFVCGLDYNVGLDTYELSTESNEYSSPHCIPPLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGL--CGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLV--GSINHGNITTRPFSGRRGFCGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIV-DKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIR--SYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRKK 3010
              DYF +CGLD   GL+  ELS E+ E +      PL R +   +L  +P++     F +D ++  LCMP GL  F T   P+ P  H FI+TRED +R +G +L F EE+ +++I +    +Q++Y + HN+E   +H        +P    G    SG      I  T L    S+    + LY  K I +++   ++   +S L  +   V++                                + LESY++N+L+E   P  G S+   G      CQ P   +LP+F+ P++++ E+LG+E++ ++++C LLE+++++ SQ Y+ LM VAE IT L+FPF W HVY PILP +  HFL+APVP++MG+  N  D+   ++LP +A +C+V++D   ++  +D+P FP ++   +E++E+L+  G    GN+     + +             + SEL S      +     L  Y+    L+ EN TI  L  +      ++R    TG S+           +  DP             N+D   V  D  ++  ++   N  +RE+F N F  +F DY+ F+I P    +  ++F  R+  +Q FDKA FLS+QPE +LPFLS FLETQMF  F++ KI+    +D  P L +F+ ++ K +             +L++R  + R+    K     E +  ++L         V PH+LD    +IG                   + KY   +  F       FP LQ D L + P     +K              P ++R+K R    T  +               N Q+EKY+ E        R     +P L N+ P  +AQ +W FV  LL+EC+ KTKRM++EKM G+EA+ELGHG++ ++G+EENTL+A LCDLLERIW HGL  K GKSALW+HL  Y +  ++K
Sbjct:   15 FADYFVICGLDTETGLEPDELSGENFEQT------PLRRTFKSKVLARYPENVDWNPFDQD-AVGMLCMPKGLA-FKTQADPREPQFHAFIITREDGSRTFGFALTFYEEVTSKQICSA---MQTLYHM-HNAEYDVLH--------APLADGGD--QSGMEDGEGIPGTKLQRFNSYDISRDTLYVSKCICLITPMSFMKACRSVLQQLHQAVTSPQ---------------------------PPPLPLESYIYNVLYEVPLPPPGRSLKFSGVYGPIICQRPSTNELPLFDFPVKEVFELLGVENVFQLFTCALLEFQILLYSQHYQRLMTVAETITALMFPFQWQHVYVPILPASLLHFLDAPVPYLMGLHSNGLDDRSKLELPQEANLCFVDVDNHFIELPEDLPQFPNKLEFVQEVSEILMAFGVPPEGNLHCSESASKLKRI---------RASELVSDKRNGNIAGS-PLHSYE----LLKENETIARLQAL------VKR----TGVSL-------EKLEVREDPSS-----------NKDFK-VQCDEEEL--RIYQLNIQIREVFANRFTQMFADYEVFVIQPSQ--DKESWFTNREQ-MQNFDKASFLSDQPEPYLPFLSRFLETQMFASFIDNKIMCHDDDDKDPVLRVFDSRVDKIR-------------LLNVRTPTLRTSMYQKCTTVDEAEKAIELRLAKIDHTAVHPHLLDM---KIG-------------------QGKY---EPGF-------FPKLQSDVLCTGPASNKWTKR-----------NAPAQWRRKDRQKQHTEHLRLD------------NDQREKYIQEARNMGSTIR-----QPKLSNLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKM-GREAVELGHGEVNITGVEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQENRQRK 807          

HSP 2 Score: 294.664 bits (753), Expect = 6.321e-81
Identity = 193/504 (38.29%), Postives = 288/504 (57.14%), Query Frame = 2
Query: 3302 NWNQNLTGSLGRSGGISINTGSSKSIDLESIFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            N  + LT     + GI +++   KS D  ++  P R SL+ D+  I+++ +I TDVG ARA+VRL++EKKLLS HLK+LL D  L K+LYKR+AFLRC++E+EQFL+HLL+  AV+Y+ FTN++  I + Y + I   K+   G+  TAN W C++G+   T    IP+ + +  FE  NLG LT+++IGHDNSG+  KW ++ V+++N +TG  YKFPC  WLGKG+DD S ER+LVGE++  +  +++E     P               + SV+    T               +K +     IQE +G AVN +VK+F++ ++ER  L           TLLLCG  GLV ++E+ F+ GFKS RLF K  ++WD+LEK  + +              N+     N     + FC+ ++ + +  ++IGKDGKFQ  V L  RDH L   I LL     T   YE+    +D+ L + LI++L +L +F I L+ +L  G
Sbjct:  803 NRQRKLTSGSLSTSGILLDSERRKS-DASAVMSPLRISLIQDMRHIQNIGEIKTDVGKARAWVRLSMEKKLLSRHLKQLLSDHELTKKLYKRYAFLRCDDEKEQFLYHLLSFNAVDYFCFTNVFTTILIPYHILIVPSKKLG-GSMFTANPWICISGELGETQILQIPRNVLEMTFECQNLGKLTTVQIGHDNSGLYAKWLVECVMVRNEVTGHTYKFPCGRWLGKGMDDGSLERVLVGELLT-SLPEVDERPCRTPPLQQ-----------SPSVIRRLVT-----------ISPNNKPKLNTGQIQESIGEAVNGIVKHFHKPEKERGSL-----------TLLLCGECGLVSALEQAFQHGFKSPRLF-KNVFIWDFLEKAQTYYETLEQ---------NDVVPEENWHTRARNFCRFVTAVNNTPRNIGKDGKFQMLVCLGARDHLLHHWIALLADCPITAHMYEDVALIKDHTLVNSLIRVLQTLQEFNITLDTSLVKG 1260          
BLAST of DENN domain-containing protein 5B vs. Ensembl Mouse
Match: Dennd5b (DENN/MADD domain containing 5B [Source:MGI Symbol;Acc:MGI:2444273])

HSP 1 Score: 412.92 bits (1060), Expect = 1.269e-120
Identity = 307/983 (31.23%), Postives = 489/983 (49.75%), Query Frame = 2
Query:  149 YFFVCGLDYNVGLDTYELSTESNEYSSPHCIPPLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLVGSINHGNITTRPFSGRRGFCGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFK---TLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIVDKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIRS--YRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQP----RKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRKK-NIIKRPNIEIPRRGSVTAG 3067
            YF +CG+D + GL+  EL+ E+ + S      PL R +   +L H+P +     F +D ++  LCMP GL  F T    + P  H+FI+TRED +R YG  L F EE+ +++I T    +Q++Y++ HN+E    +     +S+       S+ D G    +++       S+    + LY  K+I +++  P++   + +L+ +   V+++                               + LESY+ NIL+E   P  G S+   G      CQ P P +LP+ + P+R+  E+LGLE+L+++++CVLLE + ++ SQDY+ LM VAE IT LLFPF W HVY PILP +  HFL+APVP++MG++     +   ++LP +A +C+V+ID   ++  ++ P FP +++  +E++E+L                        +   I     L S  S  +L   + LK   N K    + N +V++  L+     I +++  +  TG ++           LP+    SLSE        E    +  + A +    LN    LRE+F N F  +F DY+ F+I  +   +M ++   R+  +Q FDKA FLS+QPE +LPFLS F+ETQMF  F++ KI+ +WE+  P L +F+ +++K +             + ++R+   R+    K     E    ++   +      + PH+LD    +IG                   + KY   ++ F       FP LQ D L + P    R  S S    +R     +ERL    RQ S  +   SD+                  +EKY+ E      ++  K   +P L ++ P  +AQ +W FV  LL+EC+ KTKRM++EKM G EA+ELGHG+  ++G+EENTL+A LCDLLERIW HGL  K GKSALW+HL ++ DR+ K+ ++   P    P R    +G
Sbjct:   24 YFVLCGIDADSGLEPDELAGENFDQS------PLRRTFKSKVLAHYPQNIEWNPFDQD-AVNMLCMPKGLS-FRTQADNKEPQFHSFIITREDGSRTYGFVLTFYEEVTSKQICTA---MQTLYQM-HNAEQ---YSSVYASSSCSMDSLASSIDEG--DATSLLKLQRYNSYDINRDTLYVSKSICLITPLPFMQACKKFLFQLHKAVTSQQ---------------------------PPPLPLESYIHNILYEVPLPPPGRSLKFYGVYEPVICQRPGPNELPLSDYPLREACELLGLENLVQVFTCVLLEMQTLLYSQDYQRLMTVAEGITTLLFPFQWQHVYVPILPASLLHFLDAPVPYLMGLQSKEGTDRSKLELPQEANLCFVDIDNHFIELPEEFPQFPNKVDFIQELSEVL------------------------LQFGIPPEGSLHSSESATKLKNMV-LKDLANDKKNGNVPNNSVSVYELLKGSETIARLQALAKRTGVTM-------EKIDLPA----SLSE-------KEKDLKLQCEEADLRDSQLNVQ--LREVFANRFTQMFADYEAFVI--QTAQDMESWLTNREQ-MQNFDKASFLSDQPEPYLPFLSRFIETQMFATFIDNKIMSQWEEKDPLLRVFDSRIEKIR-------------LYNVRAPTLRTSIYQKCSSLKEAAQSIEQRLMKMDHTAIHPHLLDM---KIG-------------------QGKY---EQGF-------FPKLQSDVLATGPANNNRWVSRSATAQRR-----KERL----RQSSEHIGLDSDL------------------REKYMQEA-----RSLGKNLRQPKLSDLSPAVIAQTNWKFVEGLLKECRMKTKRMLVEKM-GHEAVELGHGEANITGLEENTLIASLCDLLERIWSHGLLVKQGKSALWSHLLQFQDREEKQEHLTDSPVALGPERRKSDSG 836          

HSP 2 Score: 313.923 bits (803), Expect = 4.126e-87
Identity = 195/470 (41.49%), Postives = 282/470 (60.00%), Query Frame = 2
Query: 3407 RRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEII-RLNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            R SL+ D+  I++MT+I TDVG ARA++RL+LEKKLLS+HLK+LL +  L K+LYKR+AFLRCEEEREQFL+HLL+L AV+Y+ FT+++  I + YR  I   K+ S     T+N W CV+G+   TG   IPK L +  FE  NLG LT+++IGHDNSG+  KW +D V+++N ITG  Y+FPC  WLGKGVDD S ER+L+GE++   +++D+ +     P          +   P ++      +             +    +     IQE +G AVNN+VK+F++ ++ER  L           T+LLCG +GLV ++E+VF  GFKS+R+F K  ++WD++EK  + F       +N  +   +K  S       + FC  ++ I    ++IGKDGKFQ  V L  RDH LP+ I LL +     + YEE+   RD+   + LI+IL ++ DF I LE +L  G
Sbjct:  843 RVSLIQDMRHIQNMTEIKTDVGRARAWIRLSLEKKLLSQHLKQLLSNQPLTKKLYKRYAFLRCEEEREQFLYHLLSLNAVDYFCFTSVFTTIMIPYRSVIIPIKKLSNAI-ITSNPWICVSGELGDTGVMQIPKNLLEMTFECQNLGKLTTVQIGHDNSGLLAKWLVDCVMVRNEITGHTYRFPCGRWLGKGVDDGSLERILIGELMTSASDEDLGKQCRTPP----------QQKSPTTTRRLSITSL------------TGKPAKPNAGQIQEGIGEAVNNIVKHFHKPEKERGSL-----------TVLLCGENGLVAALEQVFHHGFKSARIFHKNVFIWDFVEKAVAYFETTDQILDNEGDVLIQKPSS-------KTFCHYVNAINTAPRNIGKDGKFQILVCLGTRDHLLPQWIPLLAECPAITRMYEENALLRDHMTVNSLIRILQTIQDFTIVLEGSLIKG 1271          
BLAST of DENN domain-containing protein 5B vs. Ensembl Mouse
Match: Dennd5a (DENN/MADD domain containing 5A [Source:MGI Symbol;Acc:MGI:1201681])

HSP 1 Score: 405.216 bits (1040), Expect = 7.238e-118
Identity = 303/982 (30.86%), Postives = 476/982 (48.47%), Query Frame = 2
Query:  140 LVDYFFVCGLDYNVGLDTYELS--------TESNEYSSPHCIP----------PLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGL--CGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLV--GSINHGNITTRPFSGRRGFCGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIV-DKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIR--SYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRKK 3010
              DYF +CGLD   GL+  ELS        +++ + +SP              PL R +   +L  +P++     F +D ++  LCMP GL  F T   P+ P  H FI+TRED +R +G +L F EE+ +++I +    +Q++Y + HN+E   +H        +P    G    SG      I  T L    S+    + LY  K I +++   ++   +S L  +   V++                                + LESY++N+L+E   P  G S+   G      CQ P   +LP+F+ P++++ E+LG+E++ ++++C LLE+++++ SQ Y+ LM VAE IT L+FPF W HVY PILP +  HFL+APVP++MG+  N  D+   ++LP +A +C+V++D   ++  +D+P FP ++   +E++E+L+  G    GN+     + +             + SEL S      +     L  Y+    L+ EN TI  L  +      ++R    TG S+           +  DP             N+D   V  D  ++  ++   N  +RE+F N F  +F DY+ F+I P    +  ++F  R+  +Q FDKA FLS+QPE +LPFLS FLETQMF  F++ KI+    +D  P L +F+ ++ K +             +L++R  + R+    K     E +  ++L         V PH+LD    +IG                   + KY   +  F       FP LQ D L + P     +K              P ++R+K R    T  +               N Q+EKY+ E        R     +P L N+ P  +AQ +W FV  LL+EC+ KTKRM++EKM G+EA+ELGHG++ ++G+EENTL+A LCDLLERIW HGL  K GKSALW+HL  Y +  ++K
Sbjct:   15 FADYFVICGLDTETGLEPDELSALCQYIQASKARDGASPFISSTTEGENFEQTPLRRTFKSKVLARYPENVDWNPFDQD-AVGMLCMPKGLA-FKTQADPREPQFHAFIITREDGSRTFGFALTFYEEVTSKQICSA---MQTLYHM-HNAEYDVLH--------APLADGGD--QSGMEDGEGIPGTKLQRFNSYDISRDTLYVSKCICLITPMSFMKACRSVLQQLHQAVTSPQ---------------------------PPPLPLESYIYNVLYEVPLPPPGRSLKFSGVYGPIICQRPSTNELPLFDFPVKEVFELLGVENVFQLFTCALLEFQILLYSQHYQRLMTVAETITALMFPFQWQHVYVPILPASLLHFLDAPVPYLMGLHSNGLDDRSKLELPQEANLCFVDVDNHFIELPEDLPQFPNKLEFVQEVSEILMAFGVPPEGNLHCSESASKLKRI---------RASELVSDKRNGNIAGS-PLHSYE----LLKENETIARLQAL------VKR----TGVSL-------EKLEVREDPSS-----------NKDFK-VQCDEEEL--RIYQLNIQIREVFANRFTQMFADYEVFVIQPSQ--DKESWFTNREQ-MQNFDKASFLSDQPEPYLPFLSRFLETQMFASFIDNKIMCHDDDDKDPVLRVFDSRVDKIR-------------LLNVRTPTLRTSMYQKCTTVDEAEKAIELRLAKIDHTAVHPHLLDM---KIG-------------------QGKY---EPGF-------FPKLQSDVLCTGPASNKWTKR-----------NAPAQWRRKDRQKQHTEHLRLD------------NDQREKYIQEARNMGSTIR-----QPKLSNLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKM-GREAVELGHGEVNITGVEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQENRQRK 831          

HSP 2 Score: 294.664 bits (753), Expect = 7.277e-81
Identity = 193/504 (38.29%), Postives = 288/504 (57.14%), Query Frame = 2
Query: 3302 NWNQNLTGSLGRSGGISINTGSSKSIDLESIFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            N  + LT     + GI +++   KS D  ++  P R SL+ D+  I+++ +I TDVG ARA+VRL++EKKLLS HLK+LL D  L K+LYKR+AFLRC++E+EQFL+HLL+  AV+Y+ FTN++  I + Y + I   K+   G+  TAN W C++G+   T    IP+ + +  FE  NLG LT+++IGHDNSG+  KW ++ V+++N +TG  YKFPC  WLGKG+DD S ER+LVGE++  +  +++E     P               + SV+    T               +K +     IQE +G AVN +VK+F++ ++ER  L           TLLLCG  GLV ++E+ F+ GFKS RLF K  ++WD+LEK  + +              N+     N     + FC+ ++ + +  ++IGKDGKFQ  V L  RDH L   I LL     T   YE+    +D+ L + LI++L +L +F I L+ +L  G
Sbjct:  827 NRQRKLTSGSLSTSGILLDSERRKS-DASAVMSPLRISLIQDMRHIQNIGEIKTDVGKARAWVRLSMEKKLLSRHLKQLLSDHELTKKLYKRYAFLRCDDEKEQFLYHLLSFNAVDYFCFTNVFTTILIPYHILIVPSKKLG-GSMFTANPWICISGELGETQILQIPRNVLEMTFECQNLGKLTTVQIGHDNSGLYAKWLVECVMVRNEVTGHTYKFPCGRWLGKGMDDGSLERVLVGELLT-SLPEVDERPCRTPPLQQ-----------SPSVIRRLVT-----------ISPNNKPKLNTGQIQESIGEAVNGIVKHFHKPEKERGSL-----------TLLLCGECGLVSALEQAFQHGFKSPRLF-KNVFIWDFLEKAQTYYETLEQ---------NDVVPEENWHTRARNFCRFVTAVNNTPRNIGKDGKFQMLVCLGARDHLLHHWIALLADCPITAHMYEDVALIKDHTLVNSLIRVLQTLQEFNITLDTSLVKG 1284          
BLAST of DENN domain-containing protein 5B vs. Ensembl Mouse
Match: Madd (MAP-kinase activating death domain [Source:MGI Symbol;Acc:MGI:2444672])

HSP 1 Score: 78.9518 bits (193), Expect = 4.541e-14
Identity = 97/436 (22.25%), Postives = 182/436 (41.74%), Query Frame = 2
Query:  266 PSILQHFP--DHCGNYAFPEDYSITSLCMPDG-LRLFTTSTVPQSPVNHNFIVTREDA--TRIYGTSL----LFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTST--------SP---ETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESS--SDVSIENDETNLEVESKVN--------LESYVFNILFETDAPARGESIVIDGPSMRHFCQC-----PDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILP---LAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTV---KSSDDIPIFPYEMNLRKEITELLVGSINHGNITTRP 1450
            P +L+ +P  DH     FP    +   C P+G L +       +   +  F +T +D   TR YG  +     F + +  E+++ G             +      G SE  ST        +P   ++P G  R        N ++T LC                 VLS  P+   F+  LY +  +V   +     ++L +      D        +L VE K +        +E++++ +L  +  P  G+  V      +   Q      PDP    + + P+   LE+LG+++ +++ +C+LLE++VV+ S+DY  L +       +++P  +     P+LP    +A   L AP P+I+G+  +    +   ++P D  V  V++D   V    +++ +PI P   +L  E+ + L  ++   ++ T+P
Sbjct:   31 PELLRRYPLEDHP---EFPLPPDVVFFCQPEGCLSVRQRRMSLRDDTSFVFTLTDKDTGVTR-YGICVNFYRSFQKRMPKEKVEGGAGPRGKEGAHTSGASEEAAAGSSESGSTLQPPSADSTPDVNQSPRGKRRAKAGSRSRNSTLTSLC-----------------VLSHYPFFSTFRECLYTLKRLVDCCSERLLGKKLGIPRGVQRDTMWRIFTGSLLVEEKSSALLQDLREIEAWIYRLL-RSPVPVSGQKRVDIEVLPQELQQALTFALPDPSRFTLVDFPLHLPLELLGVDACLQVLTCILLEHKVVLQSRDYNALSMSVMAFVAMIYPLEYMFPVIPLLPTCMASAEQLLLAPTPYIIGVPASFFLYKLDFKMPDD--VWLVDLDSNRVIAPTNAEVLPILPEPESL--ELKKHLKQALASMSLNTQP 440          
BLAST of DENN domain-containing protein 5B vs. Ensembl Mouse
Match: Madd (MAP-kinase activating death domain [Source:MGI Symbol;Acc:MGI:2444672])

HSP 1 Score: 78.5666 bits (192), Expect = 7.306e-14
Identity = 95/426 (22.30%), Postives = 176/426 (41.31%), Query Frame = 2
Query:  266 PSILQHFP--DHCGNYAFPEDYSITSLCMPDG-LRLFTTSTVPQSPVNHNFIVTREDA--TRIYGTSL----LFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTST--------SP---ETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESS--SDVSIENDETNLEVESKVN--------LESYVFNILFETDAPARGESIVIDGPSMRHFCQC-----PDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILP---LAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTV---KSSDDIPIF--PYEMNLRKEITELLV 1414
            P +L+ +P  DH     FP    +   C P+G L +       +   +  F +T +D   TR YG  +     F + +  E+++ G             +      G SE  ST        +P   ++P G  R        N ++T LC                 VLS  P+   F+  LY +  +V   +     ++L +      D        +L VE K +        +E++++ +L  +  P  G+  V      +   Q      PDP    + + P+   LE+LG+++ +++ +C+LLE++VV+ S+DY  L +       +++P  +     P+LP    +A   L AP P+I+G+  +    +   ++P D  V  V++D   V    +++ +PI   P  + L+K + + L 
Sbjct:   31 PELLRRYPLEDHP---EFPLPPDVVFFCQPEGCLSVRQRRMSLRDDTSFVFTLTDKDTGVTR-YGICVNFYRSFQKRMPKEKVEGGAGPRGKEGAHTSGASEEAAAGSSESGSTLQPPSADSTPDVNQSPRGKRRAKAGSRSRNSTLTSLC-----------------VLSHYPFFSTFRECLYTLKRLVDCCSERLLGKKLGIPRGVQRDTMWRIFTGSLLVEEKSSALLQDLREIEAWIYRLL-RSPVPVSGQKRVDIEVLPQELQQALTFALPDPSRFTLVDFPLHLPLELLGVDACLQVLTCILLEHKVVLQSRDYNALSMSVMAFVAMIYPLEYMFPVIPLLPTCMASAEQLLLAPTPYIIGVPASFFLYKLDFKMPDD--VWLVDLDSNRVIAPTNAEVLPILPEPESLELKKHLKQALA 432          
BLAST of DENN domain-containing protein 5B vs. UniProt/SwissProt
Match: sp|A2RSQ0|DEN5B_MOUSE (DENN domain-containing protein 5B OS=Mus musculus OX=10090 GN=Dennd5b PE=1 SV=2)

HSP 1 Score: 412.92 bits (1060), Expect = 8.874e-120
Identity = 307/983 (31.23%), Postives = 489/983 (49.75%), Query Frame = 2
Query:  149 YFFVCGLDYNVGLDTYELSTESNEYSSPHCIPPLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLVGSINHGNITTRPFSGRRGFCGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFK---TLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIVDKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIRS--YRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQP----RKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRKK-NIIKRPNIEIPRRGSVTAG 3067
            YF +CG+D + GL+  EL+ E+ + S      PL R +   +L H+P +     F +D ++  LCMP GL  F T    + P  H+FI+TRED +R YG  L F EE+ +++I T    +Q++Y++ HN+E    +     +S+       S+ D G    +++       S+    + LY  K+I +++  P++   + +L+ +   V+++                               + LESY+ NIL+E   P  G S+   G      CQ P P +LP+ + P+R+  E+LGLE+L+++++CVLLE + ++ SQDY+ LM VAE IT LLFPF W HVY PILP +  HFL+APVP++MG++     +   ++LP +A +C+V+ID   ++  ++ P FP +++  +E++E+L                        +   I     L S  S  +L   + LK   N K    + N +V++  L+     I +++  +  TG ++           LP+    SLSE        E    +  + A +    LN    LRE+F N F  +F DY+ F+I  +   +M ++   R+  +Q FDKA FLS+QPE +LPFLS F+ETQMF  F++ KI+ +WE+  P L +F+ +++K +             + ++R+   R+    K     E    ++   +      + PH+LD    +IG                   + KY   ++ F       FP LQ D L + P    R  S S    +R     +ERL    RQ S  +   SD+                  +EKY+ E      ++  K   +P L ++ P  +AQ +W FV  LL+EC+ KTKRM++EKM G EA+ELGHG+  ++G+EENTL+A LCDLLERIW HGL  K GKSALW+HL ++ DR+ K+ ++   P    P R    +G
Sbjct:   24 YFVLCGIDADSGLEPDELAGENFDQS------PLRRTFKSKVLAHYPQNIEWNPFDQD-AVNMLCMPKGLS-FRTQADNKEPQFHSFIITREDGSRTYGFVLTFYEEVTSKQICTA---MQTLYQM-HNAEQ---YSSVYASSSCSMDSLASSIDEG--DATSLLKLQRYNSYDINRDTLYVSKSICLITPLPFMQACKKFLFQLHKAVTSQQ---------------------------PPPLPLESYIHNILYEVPLPPPGRSLKFYGVYEPVICQRPGPNELPLSDYPLREACELLGLENLVQVFTCVLLEMQTLLYSQDYQRLMTVAEGITTLLFPFQWQHVYVPILPASLLHFLDAPVPYLMGLQSKEGTDRSKLELPQEANLCFVDIDNHFIELPEEFPQFPNKVDFIQELSEVL------------------------LQFGIPPEGSLHSSESATKLKNMV-LKDLANDKKNGNVPNNSVSVYELLKGSETIARLQALAKRTGVTM-------EKIDLPA----SLSE-------KEKDLKLQCEEADLRDSQLNVQ--LREVFANRFTQMFADYEAFVI--QTAQDMESWLTNREQ-MQNFDKASFLSDQPEPYLPFLSRFIETQMFATFIDNKIMSQWEEKDPLLRVFDSRIEKIR-------------LYNVRAPTLRTSIYQKCSSLKEAAQSIEQRLMKMDHTAIHPHLLDM---KIG-------------------QGKY---EQGF-------FPKLQSDVLATGPANNNRWVSRSATAQRR-----KERL----RQSSEHIGLDSDL------------------REKYMQEA-----RSLGKNLRQPKLSDLSPAVIAQTNWKFVEGLLKECRMKTKRMLVEKM-GHEAVELGHGEANITGLEENTLIASLCDLLERIWSHGLLVKQGKSALWSHLLQFQDREEKQEHLTDSPVALGPERRKSDSG 836          

HSP 2 Score: 313.923 bits (803), Expect = 2.886e-86
Identity = 195/470 (41.49%), Postives = 282/470 (60.00%), Query Frame = 2
Query: 3407 RRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEII-RLNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            R SL+ D+  I++MT+I TDVG ARA++RL+LEKKLLS+HLK+LL +  L K+LYKR+AFLRCEEEREQFL+HLL+L AV+Y+ FT+++  I + YR  I   K+ S     T+N W CV+G+   TG   IPK L +  FE  NLG LT+++IGHDNSG+  KW +D V+++N ITG  Y+FPC  WLGKGVDD S ER+L+GE++   +++D+ +     P          +   P ++      +             +    +     IQE +G AVNN+VK+F++ ++ER  L           T+LLCG +GLV ++E+VF  GFKS+R+F K  ++WD++EK  + F       +N  +   +K  S       + FC  ++ I    ++IGKDGKFQ  V L  RDH LP+ I LL +     + YEE+   RD+   + LI+IL ++ DF I LE +L  G
Sbjct:  843 RVSLIQDMRHIQNMTEIKTDVGRARAWIRLSLEKKLLSQHLKQLLSNQPLTKKLYKRYAFLRCEEEREQFLYHLLSLNAVDYFCFTSVFTTIMIPYRSVIIPIKKLSNAI-ITSNPWICVSGELGDTGVMQIPKNLLEMTFECQNLGKLTTVQIGHDNSGLLAKWLVDCVMVRNEITGHTYRFPCGRWLGKGVDDGSLERILIGELMTSASDEDLGKQCRTPP----------QQKSPTTTRRLSITSL------------TGKPAKPNAGQIQEGIGEAVNNIVKHFHKPEKERGSL-----------TVLLCGENGLVAALEQVFHHGFKSARIFHKNVFIWDFVEKAVAYFETTDQILDNEGDVLIQKPSS-------KTFCHYVNAINTAPRNIGKDGKFQILVCLGTRDHLLPQWIPLLAECPAITRMYEENALLRDHMTVNSLIRILQTIQDFTIVLEGSLIKG 1271          
BLAST of DENN domain-containing protein 5B vs. UniProt/SwissProt
Match: sp|Q6IQ26|DEN5A_HUMAN (DENN domain-containing protein 5A OS=Homo sapiens OX=9606 GN=DENND5A PE=1 SV=2)

HSP 1 Score: 409.453 bits (1051), Expect = 1.781e-118
Identity = 304/983 (30.93%), Postives = 477/983 (48.52%), Query Frame = 2
Query:  140 LVDYFFVCGLDYNVGLDTYELS--------TESNEYSSPHCIP----------PLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARD-SGWYSYSNISVTGL--CGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLV--GSINHGNITTRPFSGRRGFCGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIV-DKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIR--SYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRKK 3010
              DYF +CGLD   GL+  ELS        +++ + +SP              PL R +   +L  +P++     F +D ++  LCMP GL  F T   P+ P  H FI+TRED +R +G +L F EE+ +++I +    +Q++Y + HN+E   +H            P    RD S      +  VT L    S+    + LY  K I +++   ++   +S L  +   V++                                + LESY++N+L+E   P  G S+   G      CQ P   +LP+F+ P++++ E+LG+E++ ++++C LLE+++++ SQ Y+ LM VAE IT L+FPF W HVY PILP +  HFL+APVP++MG+  N  D+   ++LP +A +C+V+ID   ++  +D+P FP ++   +E++E+L+  G    GN+     + +             + SEL S      +     L  Y+    L+ EN TI  L  +      ++R    TG S+           +  DP             N+D   V  D  ++  ++   N  +RE+F N F  +F DY+ F+I P    +  ++F  R+  +Q FDKA FLS+QPE +LPFLS FLETQMF  F++ KI+    +D  P L +F+ ++ K +             +L++R  + R+    K     E +  ++L         + PH+LD    +IG                   + KY   +  F       FP LQ D L + P     +K              P ++R+K R    T  +               N Q+EKY+ E      +T      +P L N+ P  +AQ +W FV  LL+EC+ KTKRM++EKM G+EA+ELGHG++ ++G+EENTL+A LCDLLERIW HGL  K GKSALW+HL  Y D  ++K
Sbjct:   15 FADYFVICGLDTETGLEPDELSALCQYIQASKARDGASPFISSTTEGENFEQTPLRRTFKSKVLARYPENVEWNPFDQD-AVGMLCMPKGL-AFKTQADPREPQFHAFIITREDGSRTFGFALTFYEEVTSKQICSA---MQTLYHM-HNAEYDVLHA-----------PPADDRDQSSMEDGEDTPVTKLQRFNSYDISRDTLYVSKCICLITPMSFMKACRSVLEQLHQAVTSPQ---------------------------PPPLPLESYIYNVLYEVPLPPPGRSLKFSGVYGPIICQRPSTNELPLFDFPVKEVFELLGVENVFQLFTCALLEFQILLYSQHYQRLMTVAETITALMFPFQWQHVYVPILPASLLHFLDAPVPYLMGLHSNGLDDRSKLELPQEANLCFVDIDNHFIELPEDLPQFPNKLEFVQEVSEILMAFGIPPEGNLHCSESASKLKRL---------RASELVSDKRNGNIAGS-PLHSYE----LLKENETIARLQAL------VKR----TGVSL-------EKLEVREDPSS-----------NKD-LKVQCDEEEL--RIYQLNIQIREVFANRFTQMFADYEVFVIQPSQ--DKESWFTNREQ-MQNFDKASFLSDQPEPYLPFLSRFLETQMFASFIDNKIMCHDDDDKDPVLRVFDSRVDKIR-------------LLNVRTPTLRTSMYQKCTTVDEAEKAIELRLAKIDHTAIHPHLLDM---KIG-------------------QGKY---EPGF-------FPKLQSDVLSTGPASNKWTKR-----------NAPAQWRRKDRQKQHTEHLRLD------------NDQREKYIQEA-----RTMGSTIRQPKLSNLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKM-GREAVELGHGEVNITGVEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQDNRQRK 831          

HSP 2 Score: 303.138 bits (775), Expect = 9.876e-83
Identity = 198/504 (39.29%), Postives = 290/504 (57.54%), Query Frame = 2
Query: 3302 NWNQNLTGSLGRSGGISINTGSSKSIDLESIFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            N  + LT     + GI +++   KS D  S+  P R SL+ D+  I+++ +I TDVG ARA+VRL++EKKLLS HLK+LL D  L K+LYKR+AFLRC++E+EQFL+HLL+  AV+Y+ FTN++  I + Y + I   K+   G+  TAN W C++G+   T    IP+ + +  FE  NLG LT+++IGHDNSG+  KW +++V+++N ITG  YKFPC  WLGKG+DD S ER+LVGE++  ++ +++E     P               + SV+    T               +K +     IQE +G AVN +VK+F++ ++ER  L           TLLLCG  GLV ++E+ F+ GFKS RLF K  ++WD+LEK  + +              NE     N     + FC+ ++ I +  ++IGKDGKFQ  V L  RDH L   I LL     T   YE+    +D+ L + LI++L +L +F I LE +L  G
Sbjct:  827 NRQRKLTSGSLSTSGILLDSERRKS-DASSLMPPLRISLIQDMRHIQNIGEIKTDVGKARAWVRLSMEKKLLSRHLKQLLSDHELTKKLYKRYAFLRCDDEKEQFLYHLLSFNAVDYFCFTNVFTTILIPYHILIVPSKKLG-GSMFTANPWICISGELGETQIMQIPRNVLEMTFECQNLGKLTTVQIGHDNSGLYAKWLVEYVMVRNEITGHTYKFPCGRWLGKGMDDGSLERILVGELL-TSQPEVDERPCRTPPLQQ-----------SPSVIRRLVTIS-----------PNNKPKLNTGQIQESIGEAVNGIVKHFHKPEKERGSL-----------TLLLCGECGLVSALEQAFQHGFKSPRLF-KNVFIWDFLEKAQTYYETLEK---------NEVVPEENWHTRARNFCRFVTAINNTPRNIGKDGKFQMLVCLGARDHLLHHWIALLADCPITAHMYEDVALIKDHTLVNSLIRVLQTLQEFNITLETSLVKG 1284          
BLAST of DENN domain-containing protein 5B vs. UniProt/SwissProt
Match: sp|Q6PAL8|DEN5A_MOUSE (DENN domain-containing protein 5A OS=Mus musculus OX=10090 GN=Dennd5a PE=1 SV=1)

HSP 1 Score: 405.216 bits (1040), Expect = 5.063e-117
Identity = 303/982 (30.86%), Postives = 476/982 (48.47%), Query Frame = 2
Query:  140 LVDYFFVCGLDYNVGLDTYELS--------TESNEYSSPHCIP----------PLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGL--CGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLV--GSINHGNITTRPFSGRRGFCGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIV-DKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIR--SYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRKK 3010
              DYF +CGLD   GL+  ELS        +++ + +SP              PL R +   +L  +P++     F +D ++  LCMP GL  F T   P+ P  H FI+TRED +R +G +L F EE+ +++I +    +Q++Y + HN+E   +H        +P    G    SG      I  T L    S+    + LY  K I +++   ++   +S L  +   V++                                + LESY++N+L+E   P  G S+   G      CQ P   +LP+F+ P++++ E+LG+E++ ++++C LLE+++++ SQ Y+ LM VAE IT L+FPF W HVY PILP +  HFL+APVP++MG+  N  D+   ++LP +A +C+V++D   ++  +D+P FP ++   +E++E+L+  G    GN+     + +             + SEL S      +     L  Y+    L+ EN TI  L  +      ++R    TG S+           +  DP             N+D   V  D  ++  ++   N  +RE+F N F  +F DY+ F+I P    +  ++F  R+  +Q FDKA FLS+QPE +LPFLS FLETQMF  F++ KI+    +D  P L +F+ ++ K +             +L++R  + R+    K     E +  ++L         V PH+LD    +IG                   + KY   +  F       FP LQ D L + P     +K              P ++R+K R    T  +               N Q+EKY+ E        R     +P L N+ P  +AQ +W FV  LL+EC+ KTKRM++EKM G+EA+ELGHG++ ++G+EENTL+A LCDLLERIW HGL  K GKSALW+HL  Y +  ++K
Sbjct:   15 FADYFVICGLDTETGLEPDELSALCQYIQASKARDGASPFISSTTEGENFEQTPLRRTFKSKVLARYPENVDWNPFDQD-AVGMLCMPKGLA-FKTQADPREPQFHAFIITREDGSRTFGFALTFYEEVTSKQICSA---MQTLYHM-HNAEYDVLH--------APLADGGD--QSGMEDGEGIPGTKLQRFNSYDISRDTLYVSKCICLITPMSFMKACRSVLQQLHQAVTSPQ---------------------------PPPLPLESYIYNVLYEVPLPPPGRSLKFSGVYGPIICQRPSTNELPLFDFPVKEVFELLGVENVFQLFTCALLEFQILLYSQHYQRLMTVAETITALMFPFQWQHVYVPILPASLLHFLDAPVPYLMGLHSNGLDDRSKLELPQEANLCFVDVDNHFIELPEDLPQFPNKLEFVQEVSEILMAFGVPPEGNLHCSESASKLKRI---------RASELVSDKRNGNIAGS-PLHSYE----LLKENETIARLQAL------VKR----TGVSL-------EKLEVREDPSS-----------NKDFK-VQCDEEEL--RIYQLNIQIREVFANRFTQMFADYEVFVIQPSQ--DKESWFTNREQ-MQNFDKASFLSDQPEPYLPFLSRFLETQMFASFIDNKIMCHDDDDKDPVLRVFDSRVDKIR-------------LLNVRTPTLRTSMYQKCTTVDEAEKAIELRLAKIDHTAVHPHLLDM---KIG-------------------QGKY---EPGF-------FPKLQSDVLCTGPASNKWTKR-----------NAPAQWRRKDRQKQHTEHLRLD------------NDQREKYIQEARNMGSTIR-----QPKLSNLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKM-GREAVELGHGEVNITGVEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQENRQRK 831          

HSP 2 Score: 294.664 bits (753), Expect = 5.091e-80
Identity = 193/504 (38.29%), Postives = 288/504 (57.14%), Query Frame = 2
Query: 3302 NWNQNLTGSLGRSGGISINTGSSKSIDLESIFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            N  + LT     + GI +++   KS D  ++  P R SL+ D+  I+++ +I TDVG ARA+VRL++EKKLLS HLK+LL D  L K+LYKR+AFLRC++E+EQFL+HLL+  AV+Y+ FTN++  I + Y + I   K+   G+  TAN W C++G+   T    IP+ + +  FE  NLG LT+++IGHDNSG+  KW ++ V+++N +TG  YKFPC  WLGKG+DD S ER+LVGE++  +  +++E     P               + SV+    T               +K +     IQE +G AVN +VK+F++ ++ER  L           TLLLCG  GLV ++E+ F+ GFKS RLF K  ++WD+LEK  + +              N+     N     + FC+ ++ + +  ++IGKDGKFQ  V L  RDH L   I LL     T   YE+    +D+ L + LI++L +L +F I L+ +L  G
Sbjct:  827 NRQRKLTSGSLSTSGILLDSERRKS-DASAVMSPLRISLIQDMRHIQNIGEIKTDVGKARAWVRLSMEKKLLSRHLKQLLSDHELTKKLYKRYAFLRCDDEKEQFLYHLLSFNAVDYFCFTNVFTTILIPYHILIVPSKKLG-GSMFTANPWICISGELGETQILQIPRNVLEMTFECQNLGKLTTVQIGHDNSGLYAKWLVECVMVRNEVTGHTYKFPCGRWLGKGMDDGSLERVLVGELLT-SLPEVDERPCRTPPLQQ-----------SPSVIRRLVT-----------ISPNNKPKLNTGQIQESIGEAVNGIVKHFHKPEKERGSL-----------TLLLCGECGLVSALEQAFQHGFKSPRLF-KNVFIWDFLEKAQTYYETLEQ---------NDVVPEENWHTRARNFCRFVTAVNNTPRNIGKDGKFQMLVCLGARDHLLHHWIALLADCPITAHMYEDVALIKDHTLVNSLIRVLQTLQEFNITLDTSLVKG 1284          
BLAST of DENN domain-containing protein 5B vs. UniProt/SwissProt
Match: sp|Q6NXD8|DEN5B_DANRE (DENN domain-containing protein 5B OS=Danio rerio OX=7955 GN=dennd5b PE=2 SV=2)

HSP 1 Score: 405.216 bits (1040), Expect = 7.590e-117
Identity = 300/973 (30.83%), Postives = 465/973 (47.79%), Query Frame = 2
Query:  149 YFFVCGLDYNVGLD------TYELSTESNEYSSPHCIP--------PLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTG---LCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLVGSINHGNITTRPFSGRRGFCGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNED-GTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIVDKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIR--SYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRK 3007
            YF VCGLD   GL+       Y+      +   P            PL R +   +L H+P++     F +D ++  LCMP GL  F T     +P  H+F++TRED +R YG    F EE+ + +I + +  L  M++  HN+        S  +S+S  + +  +  S      + S  G    C  + S  + LY  KA+ +++  P++H  + +L  +   VS                                 + LESY++N+L+E   PA G S+   G      CQ P   +LP+ + P+ D   +LG+E+L+++++CVLLE ++++ SQDY+ LM+VAE IT LLFPF W HVY PILP +  HFL+APVP++MG++     +   ++LP +A +C+V+ID   ++  +D P FP      +E++E+L   ++ G       S   G   P       Q S LE +     L   ++ K   N   L  E + +  L+     +E+++  +  TG  +                   L  + AG   +E  G   P +  ++    LN    LRE+F   F  +F DY+ F+I  +++ ++ ++   R+  +  FDKA FLS+QPE +LPFLS F+ETQMF  F++ KI+ +WE+  P L +F+ +++K             + + ++R  S RS    K     E    ++          + PH+LD    +IG                   + KY   Q+ F       FP LQ D L S P    TS     R+    + R+    +Q    V +                   N  KEKY+ E      +   K   +P L ++ P  +AQ +W FV  LL+ECK KTKRM++EKM G+EA+ELGHG+  ++G+EENTL+A LCDLLERIW HGL  K GKSALW+HL  Y  R+ K
Sbjct:   18 YFIVCGLDDETGLEPDALAALYQWLEADRQGKDPEATAAGENFDQSPLKRTFKSKVLAHYPENIECNPFDQD-AVNMLCMPKGLS-FRTQRDSLAPHFHSFLITREDGSRTYGFVHTFYEEVTSPQICSAMQTLHQMHQAEHNTSAQNCTSSSSSSSSSSSSSSMDSLSSSLDDVDSPSAHGGRRTCEGYDSIRDTLYVSKAMCLIAPMPFMHACKRFLAQMHRAVS---------------------------CSPPPPLPLESYIYNVLYEVPLPASGRSLKFHGVYEPILCQRPGVGELPLADFPLADAFRLLGVENLVQLFTCVLLEMQILLYSQDYQRLMVVAEGITTLLFPFQWQHVYVPILPASLLHFLDAPVPYLMGLQSKEGTDRSKLELPQEANLCFVDIDNHCIELPEDFPQFPNRSEFIQELSEVL---LSFGQ------SPEGGSSSPEPAVMSLQTSVLEKELKSTSLRELVDDKTNGN---LGGEALDVLELLQGNPTLERLQALAKRTGVKV-----------------ARLEALAAGQKGDEGVGGRSPVEEEELRNAKLNVQ--LREVFAARFATMFADYESFVI--QNSPDLESWLTNREQ-MHNFDKASFLSDQPEPYLPFLSHFIETQMFATFIDNKIMSQWEEKEPLLRVFDGRIEK-------------ARLYNVRAPSLRSSVYQKCTFLKESAQAIEQRLRKIDHTAIHPHLLDM---KIG-------------------QGKY---QQGF-------FPKLQADVLASGP----TSNKWSNRT-CSTQRRVERHRQQNEHLVLD-------------------NELKEKYMQEA-----RNLGKNLRQPKLSDLSPAVIAQTNWKFVEGLLKECKMKTKRMLVEKM-GREAVELGHGEANITGLEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQAREEK 852          

HSP 2 Score: 289.656 bits (740), Expect = 2.284e-78
Identity = 184/467 (39.40%), Postives = 271/467 (58.03%), Query Frame = 2
Query: 3407 RRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALT 4804
            R S++ D+  I++M +I TDVG ARA++RL+LEKKLLS+HLK+LL +  L K+LYKR+AFLRCEEE+EQFLFHLL+L AV+Y+ FT+++  I + YR  I   K+ S    TT+N W CV+G+   +G   I K + +  F+  NLG LT++++GHDNSG+  KW +D V+++N ITG  YKFPC  WLGKGVDD S ER+L+GE +    DD        P                       Q  P      +    +    +     IQE +G AVNN++K+F++ ++ER  L           T+LLCG  GLV ++E+ F  GF+S+R+FQK  +VWD+ E+  + F ++ +   +    P          +  +  C+ ++ I ++ ++IGKDGKFQ  V L  RD  LP+ + LL +     + YEE+   RD      L+ +L +L+DF I LE +LT
Sbjct:  880 RVSVIQDMRHIQNMAEIKTDVGRARAWIRLSLEKKLLSQHLKQLLSNQALTKKLYKRYAFLRCEEEKEQFLFHLLSLNAVDYFCFTSVFTTIMIPYRAVIIPIKKLSNAM-TTSNPWLCVSGELGDSGILQITKNILEMTFDCQNLGKLTTVQLGHDNSGLLAKWLVDCVMVRNEITGHTYKFPCGRWLGKGVDDGSLERVLIGEFVVPCGDDEGGRGSKTPP---------------------LQRSPSQIRRISITSLTGKGNKPTTVQIQESIGEAVNNIIKHFHKPEKERGSL-----------TVLLCGEGGLVWALEQFFHHGFRSARIFQKNVFVWDFFERIVA-FMENRDQTGDLQESPEPLS------LNSESLCRYVNAINNMPRNIGKDGKFQLLVCLGARDRLLPQWLPLLAESPVITRMYEENALLRDKLTVSSLLGVLETLHDFPITLETSLT 1306          
BLAST of DENN domain-containing protein 5B vs. UniProt/SwissProt
Match: sp|G3V7Q0|DEN5A_RAT (DENN domain-containing protein 5A OS=Rattus norvegicus OX=10116 GN=Dennd5a PE=2 SV=1)

HSP 1 Score: 403.675 bits (1036), Expect = 1.623e-116
Identity = 302/982 (30.75%), Postives = 473/982 (48.17%), Query Frame = 2
Query:  140 LVDYFFVCGLDYNVGLDTYELS--------TESNEYSSPHCIP----------PLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGL--CGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLV--GSINHGNITTRPFSGRRGFCGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIV-DKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIR--SYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRKK 3010
              DYF +CGLD   GL+  ELS        +++ + +SP              PL R +   +L  +P++     F +D ++  LCMP GL  F T   P+ P  H FI+TRED +R +G +L F EE+ +++I +    +Q++Y + HN+E   +H        +P    G    SG      I  T L    S+    + LY  K I +++   ++   +S L  +   V++                                + LESY++N+L+E   P  G S+   G      CQ P   +LP+F+ P++++ E+LG+E++ ++++C LLE+++++ SQ Y+ LM VAE IT L+FPF W HVY PILP +  HFL+APVP++MG+  N  D+   ++LP +A +C+V++D   ++  +D+P FP ++   +E++E+L+  G    GN+     + +             + SEL S      +     L  Y+    L+ EN TI  L  +      ++R    TG S+           +  DP             N+D   V  D  ++  ++   N  +RE+F N F  +F DY+ F+I P  +      +L     +Q FDKA FLS+QPE +LPFLS FLETQMF  F++ KI+    +D  P L +F+ ++ K +             +L++R  + R+    K     E +  ++L         V PH+LD    +IG                   + KY   +  F       FP LQ D L + P     +K              P ++R+K R    T  +               N Q+EKY+ E        R     +P L N+ P  +AQ +W FV  LL+EC+ KTKRM++EKM G+EA+ELGHG++ ++G+EENTL+A LCDLLERIW HGL  K GKSALW+HL  Y +  ++K
Sbjct:   15 FADYFVICGLDTETGLEPDELSALCQYIQASKARDGASPFISSTTEGENFEQTPLRRTFKSKVLARYPENVDWNPFDQD-AVGMLCMPKGLA-FKTQADPREPQFHAFIITREDGSRTFGFALTFYEEVTSKQICSA---MQTLYHM-HNAEYDVLH--------APLADGGD--QSGMEDGEGIPGTKLQRFNSYDISRDTLYVSKCICLITPMSFMKACRSVLQQLHQAVTSPQ---------------------------PPPLPLESYIYNVLYEVPLPPPGRSLKFSGVYGPIICQRPSTNELPLFDFPVKEVFELLGVENVFQLFTCALLEFQILLYSQHYQRLMTVAETITALMFPFQWQHVYVPILPASLLHFLDAPVPYLMGLHSNGLDDRSKLELPQEANLCFVDVDNHFIELPEDLPQFPNKLEFVQEVSEILMAFGVPPEGNLHCSESASKLKRI---------RASELVSDKKNGNIAGS-PLHSYE----LLKENETIARLQAL------VKR----TGVSL-------EKLEVREDPSS-----------NKDFK-VQCDEEEL--RIYQLNIQIREVFANRFTQMFADYEVFVIQPSQD---KESWLSNREQMQNFDKASFLSDQPEPYLPFLSRFLETQMFASFIDNKIMCHDDDDKDPVLRVFDSRVDKIR-------------LLNVRTPTLRTSMYQKCTTVDEAEKAIELRLAKIDHTAVHPHLLDM---KIG-------------------QGKY---EPGF-------FPKLQSDVLCTGPASNKWTKR-----------NAPAQWRRKDRQKQHTEHLRLD------------NDQREKYIQEARNMGSTIR-----QPKLSNLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKM-GREAVELGHGEVNITGVEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQENRQRK 831          

HSP 2 Score: 297.36 bits (760), Expect = 7.029e-81
Identity = 194/504 (38.49%), Postives = 289/504 (57.34%), Query Frame = 2
Query: 3302 NWNQNLTGSLGRSGGISINTGSSKSIDLESIFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            N  + LT     + GI +++   KS D  ++  P R SL+ D+  I+++ +I TDVG ARA+VRL++EKKLLS HLK+LL D  L K+LYKR+AFLRC++E+EQFL+HLL+  AV+Y+ FTN++  I + Y + I   K+   G+  TAN W C++G+   T    IP+ + +  FE  NLG LT+++IGHDNSG+  KW +++V+++N ITG  YKFPC  WLGKG+DD S ER+LVGE++  +  +++E     P               + SV+    T               +K +     IQE +G AVN +VK+F++ ++ER  L           TLLLCG  GLV ++E+ F+ GFKS RLF K  ++WD+LEK  + +              N+     N     + FC+ ++ + +  ++IGKDGKFQ  V L  RDH L   I LL     T   YE+    +D+ L + LI++L +L +F I L+ +L  G
Sbjct:  827 NRQRKLTSGSLSTSGILLDSERRKS-DASAVMSPLRVSLIQDMRHIQNIGEIKTDVGKARAWVRLSMEKKLLSRHLKQLLSDHELTKKLYKRYAFLRCDDEKEQFLYHLLSFNAVDYFCFTNVFTTILIPYHILIVPSKKLG-GSMFTANPWICISGELGETQILQIPRNVLEMTFECQNLGKLTTVQIGHDNSGLYAKWLVEYVMVRNEITGHTYKFPCGRWLGKGMDDGSLERVLVGELLT-SLPEVDERPCRTPPLQQ-----------SPSVIRRLVT-----------ISPNNKPKLNTGQIQESIGEAVNGIVKHFHKPEKERGSL-----------TLLLCGECGLVSALEQAFQHGFKSPRLF-KNVFIWDFLEKAQTYYETLEQ---------NDVVPEENWHTRARNFCRFVTAVNNTPRNIGKDGKFQMLVCLGARDHLLHHWIALLADCPITAHMYEDVALIKDHTLVNSLIRVLQTLQEFNITLDTSLVKG 1284          
BLAST of DENN domain-containing protein 5B vs. TrEMBL
Match: A0A2C9K4I9 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106050927 PE=4 SV=1)

HSP 1 Score: 737.258 bits (1902), Expect = 0.000e+0
Identity = 527/1579 (33.38%), Postives = 799/1579 (50.60%), Query Frame = 2
Query:  140 LVDYFFVCGLDYNVGLDTYELSTESNEYSSPHCIPPLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITEL------LVGSINHGN---ITTRPFSGRRGFCG--PIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPL----PIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIVDKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIRSYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVD----RDRKKNIIKRPNIEIPRRGSVTAGKSPSNTELVKEALTGVGVDSYCLFRYFNDSKGDLHHGDVFGSLKQMKLSSHQSERSKTPDFINKTLMNSGHGVSELFFNWNQNLTGSLGRSGGISINTGSSKSIDLESIFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQY--FCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
             VDYF +CGLD N  L+  +LS ++ +       PPL RPY   +L HFP++     F E+ ++  LC+P GL  F T    + P  H+F++TRE+ ++ YG++L+F EE+  + +   +  L +M++         V       S  P     S R S    +  +             +KL+  K I +++  P++   Q +LY ++                 E+S   S          +  + LESYVFNI+++   P  G S+     +   +   P   DLP+ +  + D+ ++LG++ ++ I+ CVLLE+++++ S DY+ LMLVAE +T L+FPF W  VY PILP + +HFL+APVPFIMG+   S+ ++  + LPS+A +C+V ID + +   +D+P+FPY+  L+ E+T++      ++G+         T R  +G +   G  P   SN    S   S      L    N + +    ++  +    D++ DI L    P +  R    I G S M           PS    +L                             FN  +RE+ LN F+H+F+ Y+ F+I P  ++     +L    T+  FDKA FLS+QP +HLPFLSAF+ETQMFT  ++ KIV +WE+  P L LF+ +++  +D     + G    I+      +Y     ME  E+ L         ++     + + C   EI + +S S+                          +G  FP L  + L S+P   S SK            R   K+R+K R +     + T+ ++           Q+E  + EK ++LW    +I  KP LP++   G AQ +W FV  LL+ECKTKTK+M+++KM G+EA+ELGHG+  + G+EENTL+A LCDLLERIW HGL  K GKSA+W+HL  Y +     D K    K     +P+R S+   KS     LV  + T +G  S  L  +    +      + + + K++ LS+   +    PD + +          E          GS GR             I+L  +  P  +SL+ D+  I+ M+DI TDVG  RA +RLALE+K+LS HLK+LL +T LL+ LYKR+AFLRCE+EREQFL+HLL+L AV+++ FTN++    + YR+ +Y   +    T T+AN W  + GQ   TG   +PK L +  FE+ NLG+LT+LRIGHDNSGM P+W +++VL++N +TG  Y+F C  WLG+G+DD STERLLV E++    D  +E+++ +P              P S                    + +    S +A IQE LG AVNNLVK+FY+ ++ER            N+T LLCG  GLV  ME+VF+FGF+SSRLF+ K ++WDY+E+  + F   L+             +  N+     Y  FC L+ KI   + ++GKDGKFQ F+ + IR   L   + L+     T Q YEE+ F R+    +F++ IL SL +F IPLE +L  G
Sbjct:   10 FVDYFVICGLDENADLEPDKLSGDTQQS------PPLERPYKSRVLAHFPENVTWNPFDEN-AVGMLCLPRGLS-FKTQWDSRQPKFHSFVITRENGSKAYGSALIFYEEVMAKSVLDTMQTLHAMHQ-------ANVAVKFSLDSPEPVRRIMSERKSKQCPFDAVR------------DKLFVSKCICLVTPMPFVRSCQQFLYQLY-----------------EASQKPS----------QLTMTLESYVFNIIYDVPLPPSGRSMQFFSCASPIYVIRPSTDDLPLLDFSLYDMFKLLGIDGVVDIFKCVLLEHQILLYSSDYQRLMLVAEGMTSLIFPFQWQLVYVPILPASMQHFLDAPVPFIMGLYKVSNTDKSQLVLPSEANMCFVEIDNKNIDFPEDLPMFPYQNELKIELTQVINKYQNIIGAETMSRSYPTTPRRETGYKSSSGLRPDDTSNTNTGSWPNSPKRKEILQ---NSEAWKKISSIAKKTGVWDSIEDIVLEDSAPGDNDREKDSIDGGSGM-----------PSCEVNTL----------------------------KFNNAVREIVLNCFVHMFSSYENFVINPSQDLE---SWLSNRETIHNFDKAAFLSDQPASHLPFLSAFIETQMFTTLMDNKIVSQWEETDPGLQLFDARIKNLKD-----AAGGEPRII------TYSPCSTMERTEQSL---------EKKAKNINFIACKPHEIASHISPSQ-------------------------YVGGVFPLLSKELLNSEP-ANSKSKF-----------RENAKWRRKDRQLQHKEHLQTNVEA----------DQQEFPVEEKKISLWVQYLRIR-KPQLPDMSQAGTAQTNWKFVETLLKECKTKTKKMLVDKM-GQEAVELGHGEASIIGVEENTLIASLCDLLERIWSHGLQAKKGKSAVWSHLLSYQETEESSDNKPVDPKLLTPGLPKRHSLIDIKS-----LVDSSFTILG-RSISLSSFLPKDQ-----NNYWENRKEIDLSNIGMD----PDKVQQ----------ERGSEKTHRRRGSQGR-------------IEL-PVLRPMPKSLLIDMKKIQQMSDIHTDVGKTRALIRLALERKMLSAHLKQLLSNTDLLRNLYKRYAFLRCEDEREQFLYHLLSLNAVDFFCFTNIFPNSVVPYRILVYPSTKLGCST-TSANVWISLAGQMGETGSMELPKSLLEMNFEHKNLGILTTLRIGHDNSGMMPRWLVEYVLVRNELTGHTYRFNCGRWLGRGIDDGSTERLLVAELMHHTIDTEDEVVVTSP---------PRTCSPKSP-------------------RKSHDANSGLADIQENLGQAVNNLVKHFYKPEKERG-----------NITYLLCGDKGLVHCMEQVFQFGFRSSRLFRNKIFIWDYMERLKTFFESALS---------GNTSHQLNEVTKAGYWLFCDLVGKINTASDTVGKDGKFQVFICVGIRKRCLHRWLPLMADTTVTAQMYEENSFLRNQAHINFVMHILDSLTEFDIPLETSLLRG 1332          
BLAST of DENN domain-containing protein 5B vs. TrEMBL
Match: A0A2C9K4J1 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106050927 PE=4 SV=1)

HSP 1 Score: 734.561 bits (1895), Expect = 0.000e+0
Identity = 524/1579 (33.19%), Postives = 793/1579 (50.22%), Query Frame = 2
Query:  140 LVDYFFVCGLDYNVGLDTYELSTESNEYSSPHCIPPLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITEL------LVGSINHGN---ITTRPFSGRRGFCG--PIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPL----PIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIVDKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIRSYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVD----RDRKKNIIKRPNIEIPRRGSVTAGKSPSNTELVKEALTGVGVDSYCLFRYFNDSKGDLHHGDVFGSLKQMKLSSHQSERSKTPDFINKTLMNSGHGVSELFFNWNQNLTGSLGRSGGISINTGSSKSIDLESIFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQY--FCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
             VDYF +CGLD N  L+  +LS ++ +       PPL RPY   +L HFP++     F E+ ++  LC+P GL  F T    + P  H+F++TRE+ ++ YG++L+F EE+  + +   +  L +M++         V       S  P     S R S    +  +             +KL+  K I +++  P++   Q +LY ++                 E+S   S          +  + LESYVFNI+++   P  G S+     +   +   P   DLP+ +  + D+ ++LG++ ++ I+ CVLLE+++++ S DY+ LMLVAE +T L+FPF W  VY PILP + +HFL+APVPFIMG+   S+ ++  + LPS+A +C+V ID + +   +D+P+FPY+  L+ E+T++      ++G+         T R  +G +   G  P   SN    S   S      L    N + +    ++  +    D++ DI L    P +  R    I G S M           PS    +L                             FN  +RE+ LN F+H+F+ Y+ F+I P  ++     +L    T+  FDKA FLS+QP +HLPFLSAF+ETQMFT  ++ KIV +WE+  P L LF+ +++  +D     + G    I+      +Y     ME  E+ L         ++     + + C   EI + +S S+                          +G  FP L  + L S+P   S SK            R   K+R+K R +     + T+ ++           Q+E  + EK ++LW    +I  KP LP++   G AQ +W FV  LL+ECKTKTK+M+++KM G+EA+ELGHG+  + G+EENTL+A LCDLLERIW HGL  K GKSA+W+HL  Y +     D K    K     +P+R S+   KS     LV  + T +G          + S  +L +  +     Q +  S ++ R +                            GS GR             I+L  +  P  +SL+ D+  I+ M+DI TDVG  RA +RLALE+K+LS HLK+LL +T LL+ LYKR+AFLRCE+EREQFL+HLL+L AV+++ FTN++    + YR+ +Y   +    T T+AN W  + GQ   TG   +PK L +  FE+ NLG+LT+LRIGHDNSGM P+W +++VL++N +TG  Y+F C  WLG+G+DD STERLLV E++    D  +E+++ +P              P S                    + +    S +A IQE LG AVNNLVK+FY+ ++ER            N+T LLCG  GLV  ME+VF+FGF+SSRLF+ K ++WDY+E+  + F   L+             +  N+     Y  FC L+ KI   + ++GKDGKFQ F+ + IR   L   + L+     T Q YEE+ F R+    +F++ IL SL +F IPLE +L  G
Sbjct:   10 FVDYFVICGLDENADLEPDKLSGDTQQS------PPLERPYKSRVLAHFPENVTWNPFDEN-AVGMLCLPRGLS-FKTQWDSRQPKFHSFVITRENGSKAYGSALIFYEEVMAKSVLDTMQTLHAMHQ-------ANVAVKFSLDSPEPVRRIMSERKSKQCPFDAVR------------DKLFVSKCICLVTPMPFVRSCQQFLYQLY-----------------EASQKPS----------QLTMTLESYVFNIIYDVPLPPSGRSMQFFSCASPIYVIRPSTDDLPLLDFSLYDMFKLLGIDGVVDIFKCVLLEHQILLYSSDYQRLMLVAEGMTSLIFPFQWQLVYVPILPASMQHFLDAPVPFIMGLYKVSNTDKSQLVLPSEANMCFVEIDNKNIDFPEDLPMFPYQNELKIELTQVINKYQNIIGAETMSRSYPTTPRRETGYKSSSGLRPDDTSNTNTGSWPNSPKRKEILQ---NSEAWKKISSIAKKTGVWDSIEDIVLEDSAPGDNDREKDSIDGGSGM-----------PSCEVNTL----------------------------KFNNAVREIVLNCFVHMFSSYENFVINPSQDLE---SWLSNRETIHNFDKAAFLSDQPASHLPFLSAFIETQMFTTLMDNKIVSQWEETDPGLQLFDARIKNLKD-----AAGGEPRII------TYSPCSTMERTEQSL---------EKKAKNINFIACKPHEIASHISPSQ-------------------------YVGGVFPLLSKELLNSEP-ANSKSKF-----------RENAKWRRKDRQLQHKEHLQTNVEA----------DQQEFPVEEKKISLWVQYLRIR-KPQLPDMSQAGTAQTNWKFVETLLKECKTKTKKMLVDKM-GQEAVELGHGEASIIGVEENTLIASLCDLLERIWSHGLQAKKGKSAVWSHLLSYQETEESSDNKPVDPKLLTPGLPKRHSLIDIKS-----LVDSSFTILGR---------SISLSNLSNIGMDPDKVQQERGSEKTHRRR----------------------------GSQGR-------------IEL-PVLRPMPKSLLIDMKKIQQMSDIHTDVGKTRALIRLALERKMLSAHLKQLLSNTDLLRNLYKRYAFLRCEDEREQFLYHLLSLNAVDFFCFTNIFPNSVVPYRILVYPSTKLGCST-TSANVWISLAGQMGETGSMELPKSLLEMNFEHKNLGILTTLRIGHDNSGMMPRWLVEYVLVRNELTGHTYRFNCGRWLGRGIDDGSTERLLVAELMHHTIDTEDEVVVTSP---------PRTCSPKSP-------------------RKSHDANSGLADIQENLGQAVNNLVKHFYKPEKERG-----------NITYLLCGDKGLVHCMEQVFQFGFRSSRLFRNKIFIWDYMERLKTFFESALS---------GNTSHQLNEVTKAGYWLFCDLVGKINTASDTVGKDGKFQVFICVGIRKRCLHRWLPLMADTTVTAQMYEENSFLRNQAHINFVMHILDSLTEFDIPLETSLLRG 1315          
BLAST of DENN domain-containing protein 5B vs. TrEMBL
Match: A0A0L8FGI4 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22021966mg PE=4 SV=1)

HSP 1 Score: 733.406 bits (1892), Expect = 0.000e+0
Identity = 522/1519 (34.36%), Postives = 784/1519 (51.61%), Query Frame = 2
Query:  338 LCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLV---GSINHGNITTRP------FSGRRGFCGPIINSNIQQVSELES-KNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIVDKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIRSYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLW-----KTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRKKNIIK--RPNIEIPRRGSVTAGKSPSNTELVKEALTGVGVDSYCLFRYFNDSKGDLHHGDVFGSLKQMKLSSHQSERSKTPDFINKTLMNSGHGVSELFFNWNQNLTGSLGRSG------GISINTGSSKSIDLESIFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRL---NEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHV-NQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            LC+P GL  F T + P+SP  H+F++T+ED +R YG   +F EE+ENE+I   +  LQ+M+  A  S +       E  ST  ++P  + R S    ++   +          ++KLY  K I ++SQ P++   + +L  +   VSN+                            E K+ LE YV+N+L+E   P  G S+   G S+  FCQ P   +LP+F+  + +L ++L   +++RI+  +LLE++V+  S DY+ LMLVAE +  L+FPF W HVY PILP +  HFL+APVPFIMG+     D  + ++LPS+A +C+V+ID+  V   +D+P+FP++ ++  E++ LL       +  N T++       +  R+G          Q  S L S ++S N  P K        ++ L N    +           KI        S++      ++S+  PSD  ++   ++    + +D +++P+    I +K   FN+ +RE+FLN F+H+F  Y+ F+IP   N+     +L     +Q FDKA FLS+QPE +LPFLS F+ETQMFT  ++ KI+ +WE P P L +F+ +++  ++K              I+S   Y        LEK                 PH+ D         L QS    C Q      K+ +    +     I   FP LQ + L ++P+ + T              +   K+R+K R +  +  I  + +            Q+E  LAEKH+ +W     +  + I   P L ++    MAQ +W FV  LL+EC+TKTKRM++EKM G+EA+ELGHG++ ++G+EENTL+A LCDLLERIW HGL  K GKSA W+H+  +++ +   +  K   P +  P   + TAG        +   + G+  +S  L  Y      D H G+++ +L     S + +              N     + ++F   + +  ++   G        +     SK      +  P  +SL  DV  +K MTDI TDVG ARAFVRLALEKK LS HLK+LL D  LL+ LYKR+AF+RCEEEREQFL+HLL+L AV+Y+ FTN +    + Y+V IY   +F   T T+AN W  + GQ   TG   IPKG  ++  E+ NLG+LT+LRIGHDNSGMSPKW +++VL++N ITG ++KFPC  WLG+ VDD STERLLVGE++     NE DM  +    P  +  +        P   +L    T                     +  IQE LG+AVNN+VK++++ ++ER            N+T LLCG +GLV  +E VF+ GFKS+RLF+ KF+ WDYLE+    F   L+   +       ++           FCKLI +I    ++SIGKDG+FQ F+   IRD  L + + L+     T Q YEE+ F R+     FL+ IL +L D+ + LE ++T G
Sbjct:    2 LCLPKGLS-FRTQSQPKSPHFHSFMITKEDGSRTYGAVYVFYEEVENEQICAAMQTLQAMHH-AELSNDQSRTLYPELESTFDQSPM-TMRKSRPRPHTIYDIN---------NDKLYVTKGIALISQLPFVSATRQFLKQLHDAVSNQK---------------------------ERKLPLECYVYNVLYEVPLPPPGRSMKFFGTSLPIFCQRPGMNELPLFDFSLWELFQLLDSRNILRIFRSILLEHQVLFYSSDYQRLMLVAEALCTLIFPFTWQHVYVPILPASLSHFLDAPVPFIMGLHHGQEDRSE-LKLPSEASMCFVDIDENNVDIPEDLPLFPHQKDMILELSALLSRYRSEFSKDNYTSQSLDRKLLYGSRKGG-----GQRKQSASSLFSDQHSWNTSPEK-------KWEMLQNNEAWV-----------KI--------STLAKKAGVWDSFDDPSDNNRNKDSMS--QTLTKDVSVMPSK-ELIEHK---FNSAVREVFLNRFVHMFCSYESFVIPSSQNMEQ---WLSNREMMQNFDKAAFLSDQPEAYLPFLSPFIETQMFTTLIDNKILSQWESPDPYLKVFDNRVKLFKEKSGEAHTPTYYPCETIQSSEPY--------LEKRASFIDLAAQK------PHLPDEQ-------LLQS----CKQ------KDGF----QKLTFGINGRFPQLQENLLNTEPKNQKTRM------------QEAAKWRRKDRHLQHSEHIQLTPE------------QREYALAEKHVKIWLKCMQEAHSIIIRNPKLSDMSKSAMAQRNWQFVETLLKECRTKTKRMLVEKM-GQEAVELGHGEVNITGVEENTLIASLCDLLERIWSHGLLTKKGKSAFWSHMLSFLELETIIDAGKPIDPKLLTP---AATAGSLQVAATQMVTLVPGLLQNSTNLMNYLTPPVADFHAGNLWPALSIQDNSPYNN--------------NGEVHAAMIWFILRKRIVNAVSAEGEKEKPAAPTHRRSRSKGGTELPMLKPLPKSLTFDVKKVKQMTDIKTDVGFARAFVRLALEKKTLSAHLKELLSDAKLLQSLYKRYAFMRCEEEREQFLYHLLSLNAVDYFCFTNTFTNTIVPYKVLIYPSTKFGCFT-TSANPWISLAGQIGETGVIEIPKGCLEYTSEHKNLGILTTLRIGHDNSGMSPKWLVEYVLVRNEITGHLFKFPCGKWLGR-VDDGSTERLLVGELVHSTTENEADMGSLSRTPPRCMSPA----PTGSPRHKLLEHSLT---------------------IPEIQEMLGHAVNNIVKHYHKPEKERG-----------NITYLLCGENGLVQCIECVFKCGFKSARLFRHKFFAWDYLERVKCCFETFLDCPESLPPAATTEQARAGYL----NFCKLIKQINDTSSESIGKDGRFQLFICFGIRDSLLQQWLPLMANTTVTTQMYEENSFLRNVTAMSFLVHILDTLVDYNVCLESSVTRG 1321          
BLAST of DENN domain-containing protein 5B vs. TrEMBL
Match: A0A0L8FH71 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22021966mg PE=4 SV=1)

HSP 1 Score: 730.324 bits (1884), Expect = 0.000e+0
Identity = 520/1518 (34.26%), Postives = 783/1518 (51.58%), Query Frame = 2
Query:  338 LCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLV---GSINHGNITTRP------FSGRRGFCGPIINSNIQQVSELES-KNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIVDKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIRSYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLW-----KTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRKKNIIK--RPNIEIPRRGSVTAGKSPSNTELVKEALTGVGVDSYCLFRYFNDSKGDLHHGDVFGSLKQMKLSSHQSERSKTPDFINKTLMNSGHGVSELFFNWNQNLTGSLGRSG------GISINTGSSKSIDLESIFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIR--LNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHV-NQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            LC+P GL  F T + P+SP  H+F++T+ED +R YG   +F EE+ENE+I   +  LQ+M+  A  S +       E  ST  ++P  + R S    ++   +          ++KLY  K I ++SQ P++   + +L  +   VSN+                            E K+ LE YV+N+L+E   P  G S+   G S+  FCQ P   +LP+F+  + +L ++L   +++RI+  +LLE++V+  S DY+ LMLVAE +  L+FPF W HVY PILP +  HFL+APVPFIMG+     D  + ++LPS+A +C+V+ID+  V   +D+P+FP++ ++  E++ LL       +  N T++       +  R+G          Q  S L S ++S N  P K        ++ L N    +           KI        S++      ++S+  PSD  ++   ++    + +D +++P+    I +K   FN+ +RE+FLN F+H+F  Y+ F+IP   N+     +L     +Q FDKA FLS+QPE +LPFLS F+ETQMFT  ++ KI+ +WE P P L +F+ +++  ++K              I+S   Y        LEK                 PH+ D         L QS    C Q      K+ +    +     I   FP LQ + L ++P+ + T              +   K+R+K R +  +  I  + +            Q+E  LAEKH+ +W     +  + I   P L ++    MAQ +W FV  LL+EC+TKTKRM++EKM G+EA+ELGHG++ ++G+EENTL+A LCDLLERIW HGL  K GKSA W+H+  +++ +   +  K   P +  P   + TAG        +   + G+  +S  L  Y      D H G+++ +L     S + +              N     + ++F   + +  ++   G        +     SK      +  P  +SL  DV  +K MTDI TDVG ARAFVRLALEKK LS HLK+LL D  LL+ LYKR+AF+RCEEEREQFL+HLL+L AV+Y+ FTN +    + Y+V IY   +F   T T+AN W  + GQ   TG   IPKG  ++  E+ NLG+LT+LRIGHDNSGMSPKW +++VL++N ITG ++KFPC  WLG+ VDD STERLLVGE++      +DM  +    P  +  +        P   +L    T                     +  IQE LG+AVNN+VK++++ ++ER            N+T LLCG +GLV  +E VF+ GFKS+RLF+ KF+ WDYLE+    F   L+   +       ++           FCKLI +I    ++SIGKDG+FQ F+   IRD  L + + L+     T Q YEE+ F R+     FL+ IL +L D+ + LE ++T G
Sbjct:    2 LCLPKGLS-FRTQSQPKSPHFHSFMITKEDGSRTYGAVYVFYEEVENEQICAAMQTLQAMHH-AELSNDQSRTLYPELESTFDQSPM-TMRKSRPRPHTIYDIN---------NDKLYVTKGIALISQLPFVSATRQFLKQLHDAVSNQK---------------------------ERKLPLECYVYNVLYEVPLPPPGRSMKFFGTSLPIFCQRPGMNELPLFDFSLWELFQLLDSRNILRIFRSILLEHQVLFYSSDYQRLMLVAEALCTLIFPFTWQHVYVPILPASLSHFLDAPVPFIMGLHHGQEDRSE-LKLPSEASMCFVDIDENNVDIPEDLPLFPHQKDMILELSALLSRYRSEFSKDNYTSQSLDRKLLYGSRKGG-----GQRKQSASSLFSDQHSWNTSPEK-------KWEMLQNNEAWV-----------KI--------STLAKKAGVWDSFDDPSDNNRNKDSMS--QTLTKDVSVMPSK-ELIEHK---FNSAVREVFLNRFVHMFCSYESFVIPSSQNMEQ---WLSNREMMQNFDKAAFLSDQPEAYLPFLSPFIETQMFTTLIDNKILSQWESPDPYLKVFDNRVKLFKEKSGEAHTPTYYPCETIQSSEPY--------LEKRASFIDLAAQK------PHLPDEQ-------LLQS----CKQ------KDGF----QKLTFGINGRFPQLQENLLNTEPKNQKTRM------------QEAAKWRRKDRHLQHSEHIQLTPE------------QREYALAEKHVKIWLKCMQEAHSIIIRNPKLSDMSKSAMAQRNWQFVETLLKECRTKTKRMLVEKM-GQEAVELGHGEVNITGVEENTLIASLCDLLERIWSHGLLTKKGKSAFWSHMLSFLELETIIDAGKPIDPKLLTP---AATAGSLQVAATQMVTLVPGLLQNSTNLMNYLTPPVADFHAGNLWPALSIQDNSPYNN--------------NGEVHAAMIWFILRKRIVNAVSAEGEKEKPAAPTHRRSRSKGGTELPMLKPLPKSLTFDVKKVKQMTDIKTDVGFARAFVRLALEKKTLSAHLKELLSDAKLLQSLYKRYAFMRCEEEREQFLYHLLSLNAVDYFCFTNTFTNTIVPYKVLIYPSTKFGCFT-TSANPWISLAGQIGETGVIEIPKGCLEYTSEHKNLGILTTLRIGHDNSGMSPKWLVEYVLVRNEITGHLFKFPCGKWLGR-VDDGSTERLLVGELVHSTTENEDMGSLSRTPPRCMSPA----PTGSPRHKLLEHSLT---------------------IPEIQEMLGHAVNNIVKHYHKPEKERG-----------NITYLLCGENGLVQCIECVFKCGFKSARLFRHKFFAWDYLERVKCCFETFLDCPESLPPAATTEQARAGYL----NFCKLIKQINDTSSESIGKDGRFQLFICFGIRDSLLQQWLPLMANTTVTTQMYEENSFLRNVTAMSFLVHILDTLVDYNVCLESSVTRG 1320          
BLAST of DENN domain-containing protein 5B vs. TrEMBL
Match: A0A2C9K4J2 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106050927 PE=4 SV=1)

HSP 1 Score: 728.783 bits (1880), Expect = 0.000e+0
Identity = 524/1579 (33.19%), Postives = 794/1579 (50.28%), Query Frame = 2
Query:  140 LVDYFFVCGLDYNVGLDTYELSTESNEYSSPHCIPPLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITEL------LVGSINHGN---ITTRPFSGRRGFCG--PIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPL----PIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIVDKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIRSYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVD----RDRKKNIIKRPNIEIPRRGSVTAGKSPSNTELVKEALTGVGVDSYCLFRYFNDSKGDLHHGDVFGSLKQMKLSSHQSERSKTPDFINKTLMNSGHGVSELFFNWNQNLTGSLGRSGGISINTGSSKSIDLESIFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQY--FCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
             VDYF +CGLD N  L+  +LS ++ +       PPL RPY   +L HFP++     F E+ ++  LC+P GL  F T    + P  H+F++TRE+ ++ YG++L+F EE+  + +   +  L +M++         V       S  P     S R S    +  +             +KL+  K I +++  P++   Q +LY ++                 E+S   S          +  + LESYVFNI+++   P  G S+     +   +   P   DLP+ +  + D+ ++LG++ ++ I+ CVLLE+++++ S DY+ LMLVAE +T L+FPF W  VY PILP + +HFL+APVPFIMG+   S+ ++  + LPS+A +C+V ID + +   +D+P+FPY+  L+ E+T++      ++G+         T R  +G +   G  P   SN    S   S      L    N + +    ++  +    D++ DI L    P +  R    I G S M           PS    +L                             FN  +RE+ LN F+H+F+ Y+ F+I P  ++     +L    T+  FDKA FLS+QP +HLPFLSAF+ETQMFT  ++ KIV +WE+  P L LF+ +++  +D     + G    I+      +Y     ME  E+ L         ++     + + C   EI + +S S+                          +G  FP L  + L S+P   S SK            R   K+R+K R +     + T+ ++           Q+E+YL  +             KP LP++   G AQ +W FV  LL+ECKTKTK+M+++KM G+EA+ELGHG+  + G+EENTL+A LCDLLERIW HGL  K GKSA+W+HL  Y +     D K    K     +P+R S+   KS     LV  + T +G  S  L  +    +      + + + K++ LS+   +    PD + +          E          GS GR             I+L  +  P  +SL+ D+  I+ M+DI TDVG  RA +RLALE+K+LS HLK+LL +T LL+ LYKR+AFLRCE+EREQFL+HLL+L AV+++ FTN++    + YR+ +Y   +    T T+AN W  + GQ   TG   +PK L +  FE+ NLG+LT+LRIGHDNSGM P+W +++VL++N +TG  Y+F C  WLG+G+DD STERLLV E++    D  +E+++ +P              P S                    + +    S +A IQE LG AVNNLVK+FY+ ++ER            N+T LLCG  GLV  ME+VF+FGF+SSRLF+ K ++WDY+E+  + F   L+             +  N+     Y  FC L+ KI   + ++GKDGKFQ F+ + IR   L   + L+     T Q YEE+ F R+    +F++ IL SL +F IPLE +L  G
Sbjct:   10 FVDYFVICGLDENADLEPDKLSGDTQQS------PPLERPYKSRVLAHFPENVTWNPFDEN-AVGMLCLPRGLS-FKTQWDSRQPKFHSFVITRENGSKAYGSALIFYEEVMAKSVLDTMQTLHAMHQ-------ANVAVKFSLDSPEPVRRIMSERKSKQCPFDAVR------------DKLFVSKCICLVTPMPFVRSCQQFLYQLY-----------------EASQKPS----------QLTMTLESYVFNIIYDVPLPPSGRSMQFFSCASPIYVIRPSTDDLPLLDFSLYDMFKLLGIDGVVDIFKCVLLEHQILLYSSDYQRLMLVAEGMTSLIFPFQWQLVYVPILPASMQHFLDAPVPFIMGLYKVSNTDKSQLVLPSEANMCFVEIDNKNIDFPEDLPMFPYQNELKIELTQVINKYQNIIGAETMSRSYPTTPRRETGYKSSSGLRPDDTSNTNTGSWPNSPKRKEILQ---NSEAWKKISSIAKKTGVWDSIEDIVLEDSAPGDNDREKDSIDGGSGM-----------PSCEVNTL----------------------------KFNNAVREIVLNCFVHMFSSYENFVINPSQDLE---SWLSNRETIHNFDKAAFLSDQPASHLPFLSAFIETQMFTTLMDNKIVSQWEETDPGLQLFDARIKNLKD-----AAGGEPRII------TYSPCSTMERTEQSL---------EKKAKNINFIACKPHEIASHISPSQ-------------------------YVGGVFPLLSKELLNSEP-ANSKSKF-----------RENAKWRRKDRQLQHKEHLQTNVEA----------DQQEQYLRIR-------------KPQLPDMSQAGTAQTNWKFVETLLKECKTKTKKMLVDKM-GQEAVELGHGEASIIGVEENTLIASLCDLLERIWSHGLQAKKGKSAVWSHLLSYQETEESSDNKPVDPKLLTPGLPKRHSLIDIKS-----LVDSSFTILG-RSISLSSFLPKDQ-----NNYWENRKEIDLSNIGMD----PDKVQQ----------ERGSEKTHRRRGSQGR-------------IEL-PVLRPMPKSLLIDMKKIQQMSDIHTDVGKTRALIRLALERKMLSAHLKQLLSNTDLLRNLYKRYAFLRCEDEREQFLYHLLSLNAVDFFCFTNIFPNSVVPYRILVYPSTKLGCST-TSANVWISLAGQMGETGSMELPKSLLEMNFEHKNLGILTTLRIGHDNSGMMPRWLVEYVLVRNELTGHTYRFNCGRWLGRGIDDGSTERLLVAELMHHTIDTEDEVVVTSP---------PRTCSPKSP-------------------RKSHDANSGLADIQENLGQAVNNLVKHFYKPEKERG-----------NITYLLCGDKGLVHCMEQVFQFGFRSSRLFRNKIFIWDYMERLKTFFESALS---------GNTSHQLNEVTKAGYWLFCDLVGKINTASDTVGKDGKFQVFICVGIRKRCLHRWLPLMADTTVTAQMYEENSFLRNQAHINFVMHILDSLTEFDIPLETSLLRG 1320          
BLAST of DENN domain-containing protein 5B vs. Ensembl Cavefish
Match: dennd5b (DENN/MADD domain containing 5B [Source:NCBI gene;Acc:323528])

HSP 1 Score: 242.276 bits (617), Expect = 1.875e-64
Identity = 135/422 (31.99%), Postives = 221/422 (52.37%), Query Frame = 2
Query:  149 YFFVCGLDYNVGLDTYELSTESNEYSSPHCIPPLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLV 1414
            YF +CGLD   GL+   L+ E+ + S      PL R +   +L H+P +     F +D ++  LCMP GL  F T     +P  H+F++TRED +R YG    F EE+ + +I++ +  L  M++  H             +S   E+P+  A                   + +E + LY  K+I +++  P++H  + +L  +   V ++                               + LESYV+N+L+E   P  G S+   G      CQ P P +LP+ + P+ D  ++LG+E+L+++++CVLLE +V++ SQDY+ LM+VAE IT LLFPF W HVY PILP +  HFL+APVP++MG++     +   ++LP +A +C+V+ID   ++  +D P FP +    +E+TE+L+
Sbjct:   18 YFVICGLDNETGLEPDALAGENFDQS------PLKRTFKSKVLAHYPQNIECNPFDQD-AVNMLCMPKGLS-FRTQRDSLAPRFHSFLITREDGSRTYGFVHTFYEEVTSAQIRSAMQTLHQMHQAEHMDSLAS-------SSDEAESPSSQA-------GGRRGCGCSGSGYDAERDTLYVSKSICIITPMPFMHACRRFLTQLQKAVVSQQ---------------------------PPPLPLESYVYNVLYEVPLPPPGRSLKFHGVYEPILCQRPGPSELPLADFPLGDAFQLLGVENLVQLFTCVLLEMQVLLYSQDYQRLMVVAEGITTLLFPFQWQHVYVPILPASLLHFLDAPVPYLMGLQSKEGTDRSKLELPQEANLCFVDIDNHCIELPEDFPQFPNKTEFIQELTEVLL 390          

HSP 2 Score: 223.787 bits (569), Expect = 1.129e-58
Identity = 169/498 (33.94%), Postives = 251/498 (50.40%), Query Frame = 2
Query: 3353 INTGSSKSIDLESIFGPHRR-SLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEE-REQFLFHLLALQAVEYYSFTNLYIKIQLV-YRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKI-----QSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQ-CMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDC--TQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            ++TG  +     SI  P  R S+V D+  I++M +I TDVG ARA++R                               L  E++   Q L  LL+ QA+   S + L     ++ YR  I   K+ S    TT+N W CV+G+   +G   IPK + +  F+  NLG LT++++GHDN+G+  KW +D V+++N ITG  YKFPC  WLGKGVDD S ER+L+GE++    D+                           V+ G +TPP  RSPS  RR S   I     +     IQ+ +  A+NN++K+F++ ++ER  L           T+LLCG  GLV ++E+ F  GF+++RLFQK  +VWD++E++                   + + +P    +T    C+  + I + +++IGKDGKFQ  + L  RD  L   + LL  VDC    + YE+S   RD    + LI IL SL+DF I LE +LT G
Sbjct:  825 VSTGQDRRKSESSIGLPALRVSVVQDMRHIQNMGEIKTDVGRARAWIR-------------------------------LSLEKKVLSQHLKQLLSNQALTNVSLSFLCSSSLVIPYRAVIIPIKKLSNAM-TTSNPWVCVSGELGDSGIMQIPKNVLEMTFDCQNLGKLTTVQLGHDNAGLLAKWLVDCVMVRNEITGHTYKFPCGRWLGKGVDDGSLERILIGELVVPCSDE--------------------------EVVRGSKTPPPQRSPSQLRRISITSITGRGNKPTTDQIQDAISEAINNILKHFHKPEKERGSL-----------TVLLCGEGGLVGAVEQFFYHGFRTARLFQKNIFVWDFIERSVVYMESADQM--------GDLQETPEPFGLTCDSLCRYANAINNTSRNIGKDGKFQLLICLGARDRLLSNWLPLL--VDCPIITRMYEDSALLRDRVAVNSLIGILQSLHDFPITLETSLTKG 1243          

HSP 3 Score: 196.438 bits (498), Expect = 3.897e-50
Identity = 141/424 (33.25%), Postives = 213/424 (50.24%), Query Frame = 2
Query: 1739 LSEITAGN-LVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIVDKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIR--SYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRD 3001
            L  + AG   + ED T       +   +    N  LRE+F   F  +F DY+ F+I  +++ ++ ++   R+  +  FDKA FLS+QPE  LPFLS F+ETQMF  F++ KI+ +WE+  P L +F+ +++K             + + ++R  S RS    K     E    ++   +      + PH+LD    +IG                   + KY   Q+ F       FP LQ D L S P   + ++  ++    +     P   RQ+                  LG + +L   KEKY+ E      ++  K   +P L ++ P  +AQ +W FV  LL+EC+ KTKRM++EKMG +EA+E+GHG+  ++G+EENTL+A LCDLLERIW HGL  K GKSALW+HL  Y  R+
Sbjct:  468 LEALVAGQKALGEDSTGGRTGAEEEELRNAKINVQLREVFAARFATMFADYEAFVI--QNSPDLESWLTNREQ-MHNFDKASFLSDQPEPFLPFLSRFIETQMFATFIDNKIMSQWEEKEPLLRVFDGRIEK-------------ARLYNVRAPSLRSSVYQKCTFLKESAQAIEQRLMKIDHTAIHPHLLDM---KIG-------------------QGKY---QQGF-------FPKLQADVLASGP--TNNNRWSNRTGPAQRRREWP---RQQPDH---------------LGLDNDL---KEKYMQEA-----RSLGKNLRQPKLSDLSPAVIAQTNWKFVEGLLKECRMKTKRMLVEKMG-REAVEMGHGEANITGLEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLMHYQARE 814          
BLAST of DENN domain-containing protein 5B vs. Ensembl Cavefish
Match: madd (MAP-kinase activating death domain [Source:ZFIN;Acc:ZDB-GENE-030131-8076])

HSP 1 Score: 70.8626 bits (172), Expect = 1.449e-11
Identity = 60/241 (24.90%), Postives = 113/241 (46.89%), Query Frame = 2
Query:  692 TIKAIGVLSQQPYIHCFQSWLYDIWLMV---SNENNVK---------------FTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQ------CPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILP---LAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDK 1333
            T+ ++ +LS  P+   F+  LY +  MV   S+  N +               FT  LSVE       E ++ +  ++    +ES+V+ +L  +  P  G   V D   + H  Q       PD     + + P+   LE+LG+++ +++ SC+LLE++VV+ S+DY  L +       +++P  +     P+LP    +A   L AP P+I+G+  +    +   ++P D  +  ++ +K
Sbjct:  161 TLTSLCMLSHYPFFSTFRECLYILKRMVDCCSHRLNQRPGAAKGTQRDAMWRVFTGALSVE-------EKEKGSQLLQDLKEIESWVYRLL-RSPVPVAGLRRV-DVEVLPHELQPALTFALPDSSRFCMVDFPLHLPLELLGVDACLKVLSCILLEHKVVLQSRDYNALSMSVMAFVAMIYPLEYMFPVIPLLPTCMASAEQLLLAPTPYIIGVPASFFLYKSDFKMPDDVWLVDLDCNK 392          
BLAST of DENN domain-containing protein 5B vs. Ensembl Cavefish
Match: dennd3a (DENN domain-containing protein 3 [Source:NCBI gene;Acc:103033144])

HSP 1 Score: 69.3218 bits (168), Expect = 3.772e-11
Identity = 63/237 (26.58%), Postives = 99/237 (41.77%), Query Frame = 2
Query:  683 KLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLN-----SSDEEDAIQLPSDACVCYVNIDKQTVKSS--DDIPIFP 1372
            +LYT   I V+S+ PY +  +  L    + + N   + F  Q+  E S+ +++       +++   NL+     +      P R E                   D PV +L +         E ++++   +L E RVV  S D+  L LVAEC    + P  W H + P+L      FL AP  +IMG  L+     +S+ ED I          V+ID  +V SS   D+P  P
Sbjct:  182 RLYTAYGICVISKYPYYNALRDCLSSFLVQLKNCRMIDFEEQVK-EFSAKLALVPIPPPGQLQVAFNLKPLAIVL------PPREE------------------MDRPVVDLDLHLPFLCFRPEQILQVICSILTEQRVVFFSSDWAKLSLVAECFMFFIHPLRWQHPFVPVLSRQMLDFLMAPTAYIMGCHLHHLEEVASETEDLI---------LVDIDDGSVSSSCDADLPEMP 384          
BLAST of DENN domain-containing protein 5B vs. Ensembl Cavefish
Match: dennd3a (DENN domain-containing protein 3 [Source:NCBI gene;Acc:103033144])

HSP 1 Score: 69.3218 bits (168), Expect = 3.772e-11
Identity = 63/237 (26.58%), Postives = 99/237 (41.77%), Query Frame = 2
Query:  683 KLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLN-----SSDEEDAIQLPSDACVCYVNIDKQTVKSS--DDIPIFP 1372
            +LYT   I V+S+ PY +  +  L    + + N   + F  Q+  E S+ +++       +++   NL+     +      P R E                   D PV +L +         E ++++   +L E RVV  S D+  L LVAEC    + P  W H + P+L      FL AP  +IMG  L+     +S+ ED I          V+ID  +V SS   D+P  P
Sbjct:  182 RLYTAYGICVISKYPYYNALRDCLSSFLVQLKNCRMIDFEEQVK-EFSAKLALVPIPPPGQLQVAFNLKPLAIVL------PPREE------------------MDRPVVDLDLHLPFLCFRPEQILQVICSILTEQRVVFFSSDWAKLSLVAECFMFFIHPLRWQHPFVPVLSRQMLDFLMAPTAYIMGCHLHHLEEVASETEDLI---------LVDIDDGSVSSSCDADLPEMP 384          
BLAST of DENN domain-containing protein 5B vs. Ensembl Cavefish
Match: sbf2 (SET binding factor 2 [Source:ZFIN;Acc:ZDB-GENE-030911-10])

HSP 1 Score: 67.781 bits (164), Expect = 1.195e-10
Identity = 34/100 (34.00%), Postives = 54/100 (54.00%), Query Frame = 2
Query:  956 GPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGI 1255
            G   R   Q P   +LPV    +  L + LG+++++ ++  VL E++V+  S  Y+ L      +  L+FP  +S+ Y PILP      LN+P PFIMG+
Sbjct:  110 GAGDRQLIQTPLNDNLPVTTKSVALLFQQLGIQNVLSLFCAVLTEHKVLFHSTSYQRLEEACRALEALMFPLKYSYPYIPILPSRLLEMLNSPTPFIMGV 209          
BLAST of DENN domain-containing protein 5B vs. Ensembl Sea Lamprey
Match: dennd5a (DENN/MADD domain containing 5A [Source:ZFIN;Acc:ZDB-GENE-071211-1])

HSP 1 Score: 401.364 bits (1030), Expect = 1.479e-117
Identity = 280/934 (29.98%), Postives = 469/934 (50.21%), Query Frame = 2
Query:  245 PLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHF-CQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLVGSINHGNITTRPFSGRRGFCGPIINSNIQQVSELESKNSINQLPPKINLKGYD--------NFKTLMNENVTIDNLVDIPLPIEKIRRG----SHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIVDKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIRSYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRK 3007
            PL R +   +L H+P++     F +D ++  LCMP GL  F T    + P  H+F++TRED +R YG +L F EE+ +E I+     +Q++Y + H +E  G+   +E TS+     +    DS     S++       S+ S  + L+T K I +++  P++   +  L  +   V++                                + LESYV+N+L+E   P  G S+      M    CQ P P +LP+F+  +R++ E+LGLE+++++++C LLE+++++LS+DY+ LM+VAE I  LLFPF W HVY PILP +  HFL+APVP++MG++++     + ++LP +A +C V++D ++++  +++P FP ++   +E++E+L+               R G                        +PP+ +L   D        +   L +E+    N+V  P  +E++ +G    + +   +   G  F  SY L             G+    +G +   D   I    LN +  +RE+F N F  +F DY+ F+I P    +M A+   R++ +Q FDKA FLS+QPE +LPFLS+F+ETQMF  F++ KI+ +WE+  P L  F+ +++K +        G  + +L   +Y+   +++     E +  ++          V PH+LD    +IG                   + KY   ++ F       FP LQ + L + P  + +SK                ++R++ R    +  +               N Q+E+Y+ E      ++  K   +P L  + P  +AQ +W FV  LL+EC+ KTKRM++EK+ G EA+ELGHG++ ++G+EENTL+A LCDLLERIW HGL  K GKSALW HL ++ +++ K
Sbjct:   16 PLRRTFKSKVLAHYPNNVEWNLFDQD-AVGMLCMPRGLS-FRTQADRRDPEFHSFLITREDGSRTYGFALTFFEEVRSEPIREA---MQTLYAM-HRAEQAGL---AESTSS-----DFGDTDSATGLSSSLLRMRHSASYDSSRDTLFTSKCICLIAPMPFVQACRKALTQLHTAVTSPQ---------------------------PPPLPLESYVYNLLYEVPLPPLGRSLRFSSVYMPPVVCQRPGPHELPLFDYCLREVFELLGLENVVQLFTCALLEHQILLLSRDYQRLMVVAEGIMVLLFPFSWQHVYVPILPASLLHFLDAPVPYLMGLQIDGEMGRNGLELPQEASLCLVDVDNRSLELPEELPQFPNKLEFVQELSEVLL---------------RFG------------------------VPPEGSLHCSDSAAHLRSLSLNHLTSEDRRNGNVVPNPRGMEELLKGNETLARVQAIAKRTGLNFDISYSLKRQ----------GSENRLEGRV--CDTEHIVEHKLNIH--VREVFANQFTQLFADYEAFVIQPTQ--DMEAWITSREN-MQNFDKASFLSDQPEPYLPFLSSFIETQMFATFIDSKILAQWEEKEPLLRAFDARVEKMR------VYGVRAPLLRTSTYQKCTSTR-----EAEQALEQRLSKIDHTAVHPHLLDM---KIG-------------------QGKY---EQGF-------FPRLQAEVLATGPTSEKSSKRSSS-----------AQWRRRDRLRQHSEHLQLD------------NDQRERYIQEA-----RSLGKSVRQPKLSELSPSVIAQTNWKFVEGLLRECRLKTKRMLVEKL-GHEAVELGHGEVNITGLEENTLLASLCDLLERIWSHGLQVKQGKSALWAHLLRFQEKEEK 780          

HSP 2 Score: 305.449 bits (781), Expect = 2.882e-85
Identity = 203/496 (40.93%), Postives = 287/496 (57.86%), Query Frame = 2
Query: 3329 LGRSGGISINTGSSKSIDLESIFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSL-SIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            LG +G   +     +  D   I    + SL  D+  I++M +I TDVG ARA+VRLA+EKK L+ HLK+LL D  L K+LYKR+AFLRC++E+EQFL+HLL+   VEY+ FTN +  I + YRV I   K+   G+ TTAN W CV+G+   TG   +PK + +  FE PNLG LT+L+IGHDN+G+  KW +D VL++N IT   Y+FPC  WLG+GVDD S ER+LVGE++ ++     +I  NN         S +N +P  S                S   +    + +   IQE +G AVN+LVK+F++ ++ER  L           T LLCG  GLV ++E+VF  GFKSSRLFQ+  ++WD LEK      + L   +    +P   + S +       FC++++ I    ++IGKD KFQ  + L + RDH+L   + L+     T Q YEE    RD+ L + LI++L SL +F I LE +LT G
Sbjct:  787 LGSTGSGLVPGHERRKSDASPIMPQLKVSLTQDMRHIQNMGEIHTDVGRARAWVRLAMEKKQLARHLKQLLSDQELTKKLYKRYAFLRCDDEKEQFLYHLLSFTTVEYFCFTNAFSTIVMPYRVLIVPSKKLG-GSLTTANPWICVSGEQEETGVIPVPKNVLEMTFECPNLGKLTTLQIGHDNAGLMAKWLVDCVLVRNEITSHTYRFPCGRWLGRGVDDGSLERILVGELVTVD-GSAEDITRNN------RATSPQNPLPMPS------------RKMVSIVSNIPPTELDTGQIQEAVGEAVNSLVKHFHKPERERGSL-----------TPLLCGEGGLVSALEQVFHHGFKSSRLFQRTVFLWDLLEKVCIHL-ESLGDGDGIQEEPTPVRNSRSS------FCRVVNSINTSRRNIGKDDKFQLLICLGASRDHQLHRWLPLIVSSPATMQLYEECAMLRDHSLVNSLIRVLQSLQEFNINLEASLTKG 1244          
BLAST of DENN domain-containing protein 5B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001425.1 (pep scaffold:Pmarinus_7.0:GL478720:33119:40108:1 gene:ENSPMAG00000001289.1 transcript:ENSPMAT00000001425.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.2781 bits (225), Expect = 3.207e-20
Identity = 80/305 (26.23%), Postives = 136/305 (44.59%), Query Frame = 2
Query:  200 LSTESNEYSSPHCIPPLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIV---IDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVI 1105
            LS  SN   +  C P L R +   +L H+P       F  D ++  LCMP GL  F T T  ++P  H+F++TRED TR Y  +L F EE+    I   +  L +M    HN+++G                 G     G        +     S+    + LY  KA+ +++  P+    +  L  +   V++                                + LESYV+N+L+E   P  G S+    + GP +   CQ P   +LP+ +  +R+L+E+LGL++++++++C LLE ++++
Sbjct:    1 LSPWSNAGENFECTP-LRRTFKAKVLAHYPQAVDWNPFDGD-AVGMLCMPKGLS-FRTQTDDRTPHFHSFLITREDGTRTYAFALTFYEEVTCRSICHAMHTLYAM----HNAQSGDGG-----GGGGGGGGGGGGAPIGGGGGGEGRLLQRFNSYEMGCDTLYVSKALCLITPLPFAQACRKVLLQLHRAVTSPR---------------------------PPPLPLESYVYNLLYEVPLPPPGRSLRFAGVQGPLV--VCQRPGAAELPLLDHALRELVELLGLDNVLQLFTCALLEIQILL 264          
BLAST of DENN domain-containing protein 5B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001445.1 (pep scaffold:Pmarinus_7.0:GL493165:233467:278016:-1 gene:ENSPMAG00000001296.1 transcript:ENSPMAT00000001445.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.929 bits (154), Expect = 3.295e-10
Identity = 45/120 (37.50%), Postives = 56/120 (46.67%), Query Frame = 2
Query: 3689 VYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKG---LYQFE--------FENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLV 4015
            VY V + +G     GT   AN +  V G    TG+R + K    L +FE         +  +LG LT LRI HDN G S  WF+D V I +  +   Y FPC  WL    DD    R LV
Sbjct:  737 VYTVCVCTGDVMGAGTD--ANVFVNVYGHLGDTGERRLRKAERSLNKFERGQRDIFKLKAIDLGELTKLRIRHDNCGGSAAWFLDRVEITDENSKSKYFFPCQRWLAIDEDDGQLARELV 854          

HSP 2 Score: 56.9954 bits (136), Expect = 4.122e-8
Identity = 33/103 (32.04%), Postives = 50/103 (48.54%), Query Frame = 2
Query: 3746 ANAWFCVNGQHCSTGQRAI----------PKG-LYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNL--ITGLVYKFPCNNWLGKGVDDSSTERLLV 4015
            AN + C+ G+   TG R +           +G + +F  E   L  +T +RIGHD  G S  WF+D ++++ +  +     +FPCN WL    DD    R LV
Sbjct:  338 ANVFVCLYGEQGDTGDRMLYTSRNNVNKFERGNVDEFVIECVTLKRVTRVRIGHDGRGGSSGWFLDKIMVKEMDAVNAEEVEFPCNRWLDDDEDDGQIVRELV 440          

HSP 3 Score: 54.6842 bits (130), Expect = 2.060e-7
Identity = 23/61 (37.70%), Postives = 36/61 (59.02%), Query Frame = 2
Query: 3821 FEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTE 4003
            F  +  ++G +  + IGHDNSG+   WF+D V++   ++GL Y+F  + WL K   D  TE
Sbjct:  506 FTVQTADVGKINRILIGHDNSGLRSGWFLDSVVLDVPVSGLRYRFAAHRWLSKKEADGKTE 566          

HSP 4 Score: 54.299 bits (129), Expect = 2.503e-7
Identity = 40/129 (31.01%), Postives = 62/129 (48.06%), Query Frame = 2
Query: 3686 LVYRVFIYSGKRFSTGTSTTANAWFCVNGQHC--STGQRAIPKGLYQFEFENPN---------LGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNE 4039
            ++Y + I +G     G  T +  +  ++G     ++G+  +P G  QFE    +         L  L+ + IGHDNSG+S  WF D V++    TG+   FPC  WL +   D   ER L  E+I L +
Sbjct:   63 IIYNISITTGD--VRGAGTNSKVYIILHGAQGLKNSGRLFLPGG--QFERSRTDCFSSEVAALLSPLSRVTIGHDNSGVSSGWFCDKVVVYCPFTGIEQSFPCRMWLDEDEGDGLIEREL-HEMISLRQ 186          

HSP 5 Score: 50.0618 bits (118), Expect = 5.274e-6
Identity = 43/167 (25.75%), Postives = 64/167 (38.32%), Query Frame = 2
Query: 3644 VEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFE--------FENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITG------------------------------LVYKFPCNNWLGKGVDDSSTERLLVGEIIR 4030
             E Y     +I+  + Y+V +++G   S GT+  AN +  + G    T    +      FE         E  ++G +  LR+GHDNSGM   WF+D ++I+ L                                   Y FPC  WL +  DD        GEI+R
Sbjct:  567 AEIYPTEVEHIEKCINYQVSVHTGNVRSAGTN--ANVFIQLYGDMGKTEVHNLRNRSDNFERASNDIFKVEAMDVGKVVKLRVGHDNSGMGSGWFLDSIVIRRLRQSSPHRPQPVDAEEDEDEEDDEEAEDEDSEEVQTYTFPCKRWLARDEDD--------GEIVR 723          
BLAST of DENN domain-containing protein 5B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001443.1 (pep scaffold:Pmarinus_7.0:GL493165:212823:273257:-1 gene:ENSPMAG00000001296.1 transcript:ENSPMAT00000001443.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 3.788e-10
Identity = 45/120 (37.50%), Postives = 56/120 (46.67%), Query Frame = 2
Query: 3689 VYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKG---LYQFE--------FENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLV 4015
            VY V + +G     GT   AN +  V G    TG+R + K    L +FE         +  +LG LT LRI HDN G S  WF+D V I +  +   Y FPC  WL    DD    R LV
Sbjct:  696 VYTVCVCTGDVMGAGTD--ANVFVNVYGHLGDTGERRLRKAERSLNKFERGQRDIFKLKAIDLGELTKLRIRHDNCGGSAAWFLDRVEITDENSKSKYFFPCQRWLAIDEDDGQLARELV 813          

HSP 2 Score: 56.9954 bits (136), Expect = 4.607e-8
Identity = 33/103 (32.04%), Postives = 50/103 (48.54%), Query Frame = 2
Query: 3746 ANAWFCVNGQHCSTGQRAI----------PKG-LYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNL--ITGLVYKFPCNNWLGKGVDDSSTERLLV 4015
            AN + C+ G+   TG R +           +G + +F  E   L  +T +RIGHD  G S  WF+D ++++ +  +     +FPCN WL    DD    R LV
Sbjct:  297 ANVFVCLYGEQGDTGDRMLYTSRNNVNKFERGNVDEFVIECVTLKRVTRVRIGHDGRGGSSGWFLDKIMVKEMDAVNAEEVEFPCNRWLDDDEDDGQIVRELV 399          

HSP 3 Score: 55.0694 bits (131), Expect = 1.792e-7
Identity = 23/61 (37.70%), Postives = 36/61 (59.02%), Query Frame = 2
Query: 3821 FEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTE 4003
            F  +  ++G +  + IGHDNSG+   WF+D V++   ++GL Y+F  + WL K   D  TE
Sbjct:  465 FTVQTADVGKINRILIGHDNSGLRSGWFLDSVVLDVPVSGLRYRFAAHRWLSKKEADGKTE 525          

HSP 4 Score: 54.299 bits (129), Expect = 2.755e-7
Identity = 40/129 (31.01%), Postives = 62/129 (48.06%), Query Frame = 2
Query: 3686 LVYRVFIYSGKRFSTGTSTTANAWFCVNGQHC--STGQRAIPKGLYQFEFENPN---------LGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNE 4039
            ++Y + I +G     G  T +  +  ++G     ++G+  +P G  QFE    +         L  L+ + IGHDNSG+S  WF D V++    TG+   FPC  WL +   D   ER L  E+I L +
Sbjct:   22 IIYNISITTGD--VRGAGTNSKVYIILHGAQGLKNSGRLFLPGG--QFERSRTDCFSSEVAALLSPLSRVTIGHDNSGVSSGWFCDKVVVYCPFTGIEQSFPCRMWLDEDEGDGLIEREL-HEMISLRQ 145          

HSP 5 Score: 50.447 bits (119), Expect = 3.796e-6
Identity = 41/153 (26.80%), Postives = 65/153 (42.48%), Query Frame = 2
Query: 3593 CEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKG-----------LYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGL--VYKFPCNNWLGKGVDDSSTERLL 4012
            C+ E EQ L     L   EY     L ++    Y+V +++      G  T AN +  + G    TG+R + K            + +F  E  +LG +  +R+ HDNS +   W +D V + +   G      F C  WL +  +D   ER+L
Sbjct: 1105 CDVELEQLLGDG-TLSRDEYAFEDPLDLR---TYKVSVHTSD--VRGAGTDANVFLTIYGDLGDTGERRLSKSETNTNKFERGQVDRFTLEAVDLGTICKIRVRHDNSMLHAGWLLDRVEVHDAEDGAEDSIVFHCERWLSREREDGLIERVL 1251          

HSP 6 Score: 50.447 bits (119), Expect = 4.456e-6
Identity = 43/167 (25.75%), Postives = 64/167 (38.32%), Query Frame = 2
Query: 3644 VEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFE--------FENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITG------------------------------LVYKFPCNNWLGKGVDDSSTERLLVGEIIR 4030
             E Y     +I+  + Y+V +++G   S GT+  AN +  + G    T    +      FE         E  ++G +  LR+GHDNSGM   WF+D ++I+ L                                   Y FPC  WL +  DD        GEI+R
Sbjct:  526 AEIYPTEVEHIEKCINYQVSVHTGNVRSAGTN--ANVFIQLYGDMGKTEVHNLRNRSDNFERASNDIFKVEAMDVGKVVKLRVGHDNSGMGSGWFLDSIVIRRLRQSSPHRPQPVDAEEDEDEEDDEEAEDEDSEEVQTYTFPCKRWLARDEDD--------GEIVR 682          
BLAST of DENN domain-containing protein 5B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006818.1 (pep scaffold:Pmarinus_7.0:GL477729:34763:60683:-1 gene:ENSPMAG00000006159.1 transcript:ENSPMAT00000006818.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 8.291e-10
Identity = 33/107 (30.84%), Postives = 52/107 (48.60%), Query Frame = 2
Query: 3725 STGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENP-----------NLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLL 4012
            + G  T AN +  + G+H  +G   + +     +FE             +LG L  LRI HDN+G+ P W +++V +++   G  +KF C+ WL    DD  T R L
Sbjct:  140 AAGAGTDANVYIILFGEHGDSGTIYLKESNNGNKFERGRTDVFSFADMLSLGELVKLRIWHDNTGICPGWHLEYVEVRDETLGTTFKFHCDRWLAANEDDHQTLREL 246          

HSP 2 Score: 56.6102 bits (135), Expect = 3.423e-8
Identity = 35/103 (33.98%), Postives = 50/103 (48.54%), Query Frame = 2
Query: 3692 YRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIP---KGLYQ------FEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWL 3973
            Y V + +G     G  T AN +  V G    +G+RA+    + L++      F  E  +LG L  +RI HDNSG+   W +D + I N  T +   F CN WL
Sbjct:  405 YEVLVVTGG--EKGCGTDANVFIVVFGSRGDSGRRALKHKYRNLFERGKTSRFMLEALDLGELNKVRIEHDNSGLRAGWLLDRIEIINTSTLIRTIFFCNKWL 505          
BLAST of DENN domain-containing protein 5B vs. Ensembl Nematostella
Match: EDO30806 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZQ4])

HSP 1 Score: 240.35 bits (612), Expect = 8.331e-70
Identity = 144/434 (33.18%), Postives = 229/434 (52.76%), Query Frame = 2
Query:  122 TRNSENLVDYFFVCGLDYNVGLDTYELSTESNEYSSPHCIPPLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSP------ETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITE 1405
            + + +   DYF VCGLD   GL+  +LS +S      H + PL R Y   +L HFP +     F ED ++  L  P GL  F T   P SP  H+F++TRED +R+YG +L   E ++ EEI   +  LQSM    H +E       ++  S SP      ++P   A +        + ++    +F  + + L   K I ++   P+I    S+L  I+                   ++D+ +              LESY++N+L+E   P  G ++  +       CQ P P +LP+F+  ++++   LG+E+++ +++CVLLE+++++LS  +   MLVAE +  L+FPF+W HVY PILP A +HFL+APVPFIMG+   S D +  +QLPS+A +C V+ID   V S +D+P FP + +L +E+ E
Sbjct:    4 STSGQRFADYFAVCGLDAVTGLEPDQLSGDS------HHVSPLERSYKAKVLSHFPANVDWNPFDED-AVRMLSFPHGLT-FRTQAEPHSPSLHSFLITREDGSRVYGCALTVYEVVDEEEICKAMQVLQSM----HEAELHMARSKTKARSQSPVVITGADSPTKRATEVDSEYTQEVEMSNR-KTFDMKKDTLMVSKCISIIMPLPFITAAMSYLQQIY---------------HAAKTADLPLP-------------LESYIYNLLYEVPLPPPGRTMRFNCVKESITCQRPGPNELPLFDYSLKEMFSWLGVENVVELFTCVLLEHQILLLSNSFHRFMLVAEGVVTLIFPFIWQHVYVPILPAALQHFLDAPVPFIMGLYCASEDFKANLQLPSEASLCLVDIDNCKVLSPEDLPEFPNKQDLIEELLE 396          
BLAST of DENN domain-containing protein 5B vs. Ensembl Nematostella
Match: EDO49267 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH02])

HSP 1 Score: 72.7886 bits (177), Expect = 1.112e-12
Identity = 45/142 (31.69%), Postives = 76/142 (53.52%), Query Frame = 2
Query:  986 PDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLA---ARHFLNAPVPFIMGI-----KLNSSDEEDAIQLPSDACVCYVNIDKQTVK---SSDDIPIFPYE 1378
            P+    P+ + P+   +E+LG+E+ +++ +C+LLE +VVI S+DY  L +    +T LL+P  +     P+LP     A   L AP P+++G+     +  S D     Q+P D  V   ++D   VK   S+D++P  P E
Sbjct:  240 PENTRFPLIDFPVHIPMELLGVETCLKVLTCILLEQKVVIQSRDYNALTMSVIALTRLLYPLEYMFPIIPLLPTCMANAEQLLLAPTPYVIGVPASFFRYKSKD----FQIPGDLWV--FDLDSSKVKIPMSADELPDLPEE 375          
BLAST of DENN domain-containing protein 5B vs. Ensembl Nematostella
Match: EDO44989 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUB4])

HSP 1 Score: 59.6918 bits (143), Expect = 1.963e-10
Identity = 35/116 (30.17%), Postives = 56/116 (48.28%), Query Frame = 2
Query: 3692 YRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFE---------FENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLL 4012
            Y+V I +G  +  GT   AN    + G+   +GQ+ +      FE           N  LG +T + IGHDN+G+   W +  V+++++ +  V+ FPC+ W     DD  T R L
Sbjct:    1 YKVDILTGDVYGAGTD--ANVLITIYGEDGDSGQQLLDNSGNNFERGTKDHFHLVTNKYLGRITKIHIGHDNTGLGAAWNLGKVMVEDVKSREVFVFPCDRWFSVEEDDGLTSRDL 114          
BLAST of DENN domain-containing protein 5B vs. Ensembl Nematostella
Match: EDO46064 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR72])

HSP 1 Score: 65.0846 bits (157), Expect = 2.209e-10
Identity = 56/228 (24.56%), Postives = 96/228 (42.11%), Query Frame = 2
Query:  689 YTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFP 1372
            +T K I +LS  P+   F+ +L  ++ +  +   +   R ++     DV   + +    +      E +  + L+ +  P  G S       +RH                       LG ++ + ++  +L E++++I S    LL  VAE +T +LFPF W   Y P+ P+A    L AP PFI+GI     D+ D    P D      ++D  T+  S  + I P
Sbjct:  298 HTNKCICILSHWPFFEAFKKFLSQLYRISVSAQQIPIERYIA-NMMLDVPFPSPQRPRILIEMTRYEPFEISQLYHSPLPVSGASY---SAMLRH-----------------------LGPDNCLLLFYLILTEHKILIHSLRPALLTSVAEALTNVLFPFTWQCPYIPLCPVALNDVLCAPCPFIIGIDSRYFDQYDP---PDDV----TSVDLDTIMISQALEIKP 491          
BLAST of DENN domain-containing protein 5B vs. Ensembl Nematostella
Match: EDO38972 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBB7])

HSP 1 Score: 60.4622 bits (145), Expect = 6.747e-10
Identity = 33/118 (27.97%), Postives = 59/118 (50.00%), Query Frame = 2
Query: 3683 QLVYRVFIYSGKRFSTGTSTTANAWFC--VNGQHCSTGQRAIPKGLYQFEFENPN---------LGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTE 4003
              +Y + IY+G R + GT++     FC  V  QH S  +R     + +F+  + +         LG L  +++ H+N G++P W+++ V ++++     Y+F CN WL    DD   E
Sbjct:   91 HFMYEITIYTGMRKNAGTTSDV---FCALVGNQHNSDPRRLKDPNVQRFQRSSVDTFLVSSSLCLGDLCCIKLWHNNEGLNPSWYVNRVTVRDIEKDQTYQFICNRWLAVEYDDGQVE 205          
BLAST of DENN domain-containing protein 5B vs. Ensembl Medaka
Match: dennd5a (DENN domain containing 5A [Source:NCBI gene;Acc:101160054])

HSP 1 Score: 417.542 bits (1072), Expect = 1.821e-122
Identity = 310/975 (31.79%), Postives = 472/975 (48.41%), Query Frame = 2
Query:  131 SENLVDYFFVCGLDYNVGLDTYELSTESNEYSSPHCIPPLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSG------WYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLVGSIN---HGNITTRPF-SGRRGFCGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIV--DKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIR--SYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRKKN 3013
            S    DYF +CGLD + GL+  ELS E+ E S      PL R +   +L H+PD+     F +D ++  LCMP GL  F T    + P  H+FI+TRED +R YG +L F EE+ +++I +    +Q++Y + HN+E   +         +P TP GS             +   IS      S+    + LY  K I +++   +    +  L  +   V++                                + LESY+FNIL+E   P  G S+   G      CQ P   +LP+F+  + ++  +LG+E+++++++C LLE ++++ SQ Y+ LM VAE IT L+FPF W HVY PILP +  HFL+APVP++MG+  N  D+   ++LP +A +C+V+ID   V+  +++P FP ++   +EI+E+L+ S N    GNI +R   +  R F       ++  VS+  + N    L   +N         L+ EN TI  L  +      ++R    TG S+          R   D  +                           KM   N  +RE+F N F  +F DY+ F+I  +   +  ++F  RD  +Q FDKA FLS+QPE +LPFLS FLETQMF  F++ KI+  D  E  H  L +F+ ++ K +             +L++R  + R+    K     + +  +++         + PH+LD    +IG                   + +Y   ++ F       FP LQ D L + P    +S    KRS        P ++R++ R       +               N Q+EKY+ E        R     +P L N+ P  +AQ +W FV  LL+EC+ KTKRM++EKM G+EA+ELGHG++ ++G+EENTL+A LCDLLERIW HGL  K GKSALW+HL  Y D   KKN
Sbjct:    9 SSRFADYFVICGLDTDSGLEPDELSGENFEQS------PLRRTFKSKVLAHYPDNVEWNPFDQD-AVGMLCMPKGLS-FRTQIDSREPQFHSFIITREDGSRTYGFALTFFEEVTSKQICSA---MQTLYHM-HNAEQYDI-------LHTPTTPKGSEDQRVPQPHPVLRAAPAISRLQRFNSYDISRDTLYVSKCICLITPMAFAQACRKVLQQLHQAVTSPQ---------------------------PPPLPLESYIFNILYEVPLPPPGRSLKFSGVYGAIVCQRPSTSELPLFDFAIGEMFNLLGVENVLQLFTCALLEMQILLFSQHYQRLMTVAESITALMFPFQWQHVYVPILPASLLHFLDAPVPYLMGLHSNGQDDRTKLELPQEANLCFVDIDNHLVELPEELPQFPNKLEFIQEISEVLM-SFNVSPEGNILSRDSQAAYRSF------RSVDVVSDTRNGN----LASPLN-------SYLLRENETIARLQAL------VKR----TGVSLEKDASCIKDMRFHCDEEE--------------------------LKMHQLNIQVREVFANRFTQMFADYEVFVI--QQGHDKESWFTNRDQ-MQNFDKASFLSDQPEPYLPFLSRFLETQMFASFIDSKILCHDDEEKEH-TLRVFDTRVDKIR-------------MLNVRTPTLRTSMYQKCTNIEDSEKAIEMRVAKIDHTALHPHLLDM---KIG-------------------QGRY---EQGF-------FPRLQSDVLSTGP----SSNKWAKRS-------APAQWRRRDRQKQHAEHLYLD------------NDQREKYIQEARNLGTTIR-----QPKLSNLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKM-GREAVELGHGEVSITGVEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQDSKEKKN 805          

HSP 2 Score: 308.916 bits (790), Expect = 1.037e-85
Identity = 202/497 (40.64%), Postives = 285/497 (57.34%), Query Frame = 2
Query: 3323 GSLGRSGGISINTGSSKSIDLESIFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            GSLG  G I  +T   KS    S   P R SL+ D+  I+++++I TDVG ARA+VRL++EKKLLS HLK+LL D  L K+LYKR+AFLRC++E+EQFL+HLL+  AV+Y+ FTN++  I + Y V +   K+ S G+  TAN W CV+G+   TG   +P+   +  FE  NLG LT++++GHDN+G+  KW ++ V+++N ITG  YKFPC  WLGKGVDD S ER+LVGE++  N D  +E M   P             +  SS                       K +     IQE +G A+N +VK+F++ ++ER  L           TLLLCG  GLV ++E+VF  GFKS RLF K  ++WD+LEK    F               E     N    +++FC+ +  I + +++IGKDGKFQ  V L  RDH L   I LL     T Q YE++   +D+ L + +I++L +L +F I LE +L  G
Sbjct:  809 GSLGPPGFIH-DTERRKSDGGGSAMPPLRISLIQDMRHIQNISEIKTDVGKARAWVRLSMEKKLLSRHLKQLLSDHELTKKLYKRYAFLRCDDEKEQFLYHLLSFNAVDYFCFTNVFTTIMIPYHVVVVPSKKLS-GSMFTANPWVCVSGELAETGVLQVPRNTLEITFECQNLGKLTTVQMGHDNTGIYAKWLVECVVVRNEITGHTYKFPCGRWLGKGVDDGSLERILVGELMTPNVDG-DERMCRTPPMQQSPGMMRRFTISPSS-----------------------KPKLNTGQIQEGVGEAINGIVKHFHKPEKERGSL-----------TLLLCGEYGLVWALEQVFLHGFKSPRLF-KNVFIWDFLEKAQVYFESAEQ---------REVAQDENWQTRVRHFCRFMRAINNTSRNIGKDGKFQMLVCLGARDHLLHHWIALLADCPITAQMYEDTALLKDHSLVNSMIRVLQTLQEFNITLEASLVKG 1258          
BLAST of DENN domain-containing protein 5B vs. Ensembl Medaka
Match: dennd5a (DENN domain containing 5A [Source:NCBI gene;Acc:101160054])

HSP 1 Score: 405.216 bits (1040), Expect = 6.157e-118
Identity = 311/999 (31.13%), Postives = 479/999 (47.95%), Query Frame = 2
Query:  131 SENLVDYFFVCGLDYNVGLDTYELST-------------------ESNEYSSPHCIPPLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSG------WYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLVGSIN---HGNITTRPF-SGRRGFCGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVP-----ADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIV--DKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIR--SYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRKKN 3013
            S    DYF +CGLD + GL+  ELS                    ++NE  +     PL R +   +L H+PD+     F +D ++  LCMP GL  F T    + P  H+FI+TRED +R YG +L F EE+ +++I +    +Q++Y + HN+E   +         +P TP GS             +   IS      S+    + LY  K I +++   +    +  L  +   V++                                + LESY+FNIL+E   P  G S+   G      CQ P   +LP+F+  + ++  +LG+E+++++++C LLE ++++ SQ Y+ LM VAE IT L+FPF W HVY PILP +  HFL+APVP++MG+  N  D+   ++LP +A +C+V+ID   V+  +++P FP ++   +EI+E+L+ S N    GNI +R   +  R F       ++  VS+  + N    L   +N         L+ EN TI  L  +      ++R                         G SL ++     V ED + +       D  ++  KM   N  +RE+F N F  +F DY+ F+I  +   +  ++F  RD  +Q FDKA FLS+QPE +LPFLS FLETQMF  F++ KI+  D  E  H  L +F+ ++ K +             +L++R  + R+    K     + +  +++         + PH+LD    +IG                   + +Y   ++ F       FP LQ D L + P    +S    KRS        P ++R++ R       +               N Q+EKY+ E        R     +P L N+ P  +AQ +W FV  LL+EC+ KTKRM++EKM G+EA+ELGHG++ ++G+EENTL+A LCDLLERIW HGL  K GKSALW+HL  Y D   KKN
Sbjct:    9 SSRFADYFVICGLDTDSGLEPDELSALCQYIEATKFRDGARGKLAQANEGENFEQ-SPLRRTFKSKVLAHYPDNVEWNPFDQD-AVGMLCMPKGLS-FRTQIDSREPQFHSFIITREDGSRTYGFALTFFEEVTSKQICSA---MQTLYHM-HNAEQYDI-------LHTPTTPKGSEDQRVPQPHPVLRAAPAISRLQRFNSYDISRDTLYVSKCICLITPMAFAQACRKVLQQLHQAVTSPQ---------------------------PPPLPLESYIFNILYEVPLPPPGRSLKFSGVYGAIVCQRPSTSELPLFDFAIGEMFNLLGVENVLQLFTCALLEMQILLFSQHYQRLMTVAESITALMFPFQWQHVYVPILPASLLHFLDAPVPYLMGLHSNGQDDRTKLELPQEANLCFVDIDNHLVELPEELPQFPNKLEFIQEISEVLM-SFNVSPEGNILSRDSQAAYRSF------RSVDVVSDTRNGN----LASPLN-------SYLLRENETIARLQAL------VKRT------------------------GVSLEKLE----VKEDASCIKDMRFHCDEEEL--KMHQLNIQVREVFANRFTQMFADYEVFVI--QQGHDKESWFTNRDQ-MQNFDKASFLSDQPEPYLPFLSRFLETQMFASFIDSKILCHDDEEKEH-TLRVFDTRVDKIR-------------MLNVRTPTLRTSMYQKCTNIEDSEKAIEMRVAKIDHTALHPHLLDM---KIG-------------------QGRY---EQGF-------FPRLQSDVLSTGP----SSNKWAKRS-------APAQWRRRDRQKQHAEHLYLD------------NDQREKYIQEARNLGTTIR-----QPKLSNLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKM-GREAVELGHGEVSITGVEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQDSKEKKN 834          

HSP 2 Score: 308.916 bits (790), Expect = 1.260e-85
Identity = 202/497 (40.64%), Postives = 285/497 (57.34%), Query Frame = 2
Query: 3323 GSLGRSGGISINTGSSKSIDLESIFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            GSLG  G I  +T   KS    S   P R SL+ D+  I+++++I TDVG ARA+VRL++EKKLLS HLK+LL D  L K+LYKR+AFLRC++E+EQFL+HLL+  AV+Y+ FTN++  I + Y V +   K+ S G+  TAN W CV+G+   TG   +P+   +  FE  NLG LT++++GHDN+G+  KW ++ V+++N ITG  YKFPC  WLGKGVDD S ER+LVGE++  N D  +E M   P             +  SS                       K +     IQE +G A+N +VK+F++ ++ER  L           TLLLCG  GLV ++E+VF  GFKS RLF K  ++WD+LEK    F               E     N    +++FC+ +  I + +++IGKDGKFQ  V L  RDH L   I LL     T Q YE++   +D+ L + +I++L +L +F I LE +L  G
Sbjct:  838 GSLGPPGFIH-DTERRKSDGGGSAMPPLRISLIQDMRHIQNISEIKTDVGKARAWVRLSMEKKLLSRHLKQLLSDHELTKKLYKRYAFLRCDDEKEQFLYHLLSFNAVDYFCFTNVFTTIMIPYHVVVVPSKKLS-GSMFTANPWVCVSGELAETGVLQVPRNTLEITFECQNLGKLTTVQMGHDNTGIYAKWLVECVVVRNEITGHTYKFPCGRWLGKGVDDGSLERILVGELMTPNVDG-DERMCRTPPMQQSPGMMRRFTISPSS-----------------------KPKLNTGQIQEGVGEAINGIVKHFHKPEKERGSL-----------TLLLCGEYGLVWALEQVFLHGFKSPRLF-KNVFIWDFLEKAQVYFESAEQ---------REVAQDENWQTRVRHFCRFMRAINNTSRNIGKDGKFQMLVCLGARDHLLHHWIALLADCPITAQMYEDTALLKDHSLVNSMIRVLQTLQEFNITLEASLVKG 1287          
BLAST of DENN domain-containing protein 5B vs. Ensembl Medaka
Match: dennd5a (DENN domain containing 5A [Source:NCBI gene;Acc:101160054])

HSP 1 Score: 393.66 bits (1010), Expect = 7.703e-114
Identity = 299/940 (31.81%), Postives = 456/940 (48.51%), Query Frame = 2
Query:  245 PLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSG------WYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLVGSIN---HGNITTRPF-SGRRGFCGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVP-----ADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIV--DKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIRSYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRKKN 3013
            PL R +   +L H+PD+     F +D ++  LCMP GL  F T    + P  H+FI+TRED +R YG +L F EE+ +++I +    +Q++Y + HN+E   +         +P TP GS             +   IS      S+    + LY  K I +++   +    +  L  +   V++                                + LESY+FNIL+E   P  G S+   G      CQ P   +LP+F+  + ++  +LG+E+++++++C LLE ++++ SQ Y+ LM VAE IT L+FPF W HVY PILP +  HFL+APVP++MG+  N  D+   ++LP +A +C+V+ID   V+  +++P FP ++   +EI+E+L+ S N    GNI +R   +  R F       ++  VS+  + N    L   +N         L+ EN TI  L  +      ++R                         G SL ++     V ED + +       D  ++  KM   N  +RE+F N F  +F DY+ F+I  +   +  ++F  RD  +Q FDKA FLS+QPE +LPFLS FLETQMF  F++ KI+  D  E  H  L +F+     R DK + L    N     +R+      + I ++ +   +       T    + PH+LD    +IG                   + +Y   ++ F       FP LQ D L + P    +S    KRS        P ++R++ R       +               N Q+EKY+ E        R     +P L N+ P  +AQ +W FV  LL+EC+ KTKRM++EKM G+EA+ELGHG++ ++G+EENTL+A LCDLLERIW HGL  K GKSALW+HL  Y D   KKN
Sbjct:   76 PLRRTFKSKVLAHYPDNVEWNPFDQD-AVGMLCMPKGLS-FRTQIDSREPQFHSFIITREDGSRTYGFALTFFEEVTSKQICSA---MQTLYHM-HNAEQYDI-------LHTPTTPKGSEDQRVPQPHPVLRAAPAISRLQRFNSYDISRDTLYVSKCICLITPMAFAQACRKVLQQLHQAVTSPQ---------------------------PPPLPLESYIFNILYEVPLPPPGRSLKFSGVYGAIVCQRPSTSELPLFDFAIGEMFNLLGVENVLQLFTCALLEMQILLFSQHYQRLMTVAESITALMFPFQWQHVYVPILPASLLHFLDAPVPYLMGLHSNGQDDRTKLELPQEANLCFVDIDNHLVELPEELPQFPNKLEFIQEISEVLM-SFNVSPEGNILSRDSQAAYRSF------RSVDVVSDTRNGN----LASPLN-------SYLLRENETIARLQAL------VKRT------------------------GVSLEKLE----VKEDASCIKDMRFHCDEEEL--KMHQLNIQVREVFANRFTQMFADYEVFVI--QQGHDKESWFTNRDQ-MQNFDKASFLSDQPEPYLPFLSRFLETQMFASFIDSKILCHDDEEKEH-TLRVFD----TRVDKIRML----NVRTPTLRTSMYQKCTNIEDSEKAIEMRVAKIDHT---ALHPHLLDM---KIG-------------------QGRY---EQGF-------FPRLQSDVLSTGP----SSNKWAKRS-------APAQWRRRDRQKQHAEHLYLD------------NDQREKYIQEARNLGTTIR-----QPKLSNLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKM-GREAVELGHGEVSITGVEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQDSKEKKN 845          

HSP 2 Score: 310.071 bits (793), Expect = 6.803e-86
Identity = 202/497 (40.64%), Postives = 285/497 (57.34%), Query Frame = 2
Query: 3323 GSLGRSGGISINTGSSKSIDLESIFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            GSLG  G I  +T   KS    S   P R SL+ D+  I+++++I TDVG ARA+VRL++EKKLLS HLK+LL D  L K+LYKR+AFLRC++E+EQFL+HLL+  AV+Y+ FTN++  I + Y V +   K+ S G+  TAN W CV+G+   TG   +P+   +  FE  NLG LT++++GHDN+G+  KW ++ V+++N ITG  YKFPC  WLGKGVDD S ER+LVGE++  N D  +E M   P             +  SS                       K +     IQE +G A+N +VK+F++ ++ER  L           TLLLCG  GLV ++E+VF  GFKS RLF K  ++WD+LEK    F               E     N    +++FC+ +  I + +++IGKDGKFQ  V L  RDH L   I LL     T Q YE++   +D+ L + +I++L +L +F I LE +L  G
Sbjct:  849 GSLGPPGFIH-DTERRKSDGGGSAMPPLRISLIQDMRHIQNISEIKTDVGKARAWVRLSMEKKLLSRHLKQLLSDHELTKKLYKRYAFLRCDDEKEQFLYHLLSFNAVDYFCFTNVFTTIMIPYHVVVVPSKKLS-GSMFTANPWVCVSGELAETGVLQVPRNTLEITFECQNLGKLTTVQMGHDNTGIYAKWLVECVVVRNEITGHTYKFPCGRWLGKGVDDGSLERILVGELMTPNVDG-DERMCRTPPMQQSPGMMRRFTISPSS-----------------------KPKLNTGQIQEGVGEAINGIVKHFHKPEKERGSL-----------TLLLCGEYGLVWALEQVFLHGFKSPRLF-KNVFIWDFLEKAQVYFESAEQ---------REVAQDENWQTRVRHFCRFMRAINNTSRNIGKDGKFQMLVCLGARDHLLHHWIALLADCPITAQMYEDTALLKDHSLVNSMIRVLQTLQEFNITLEASLVKG 1298          
BLAST of DENN domain-containing protein 5B vs. Ensembl Medaka
Match: ENSORLT00000013346.2 (DENN domain-containing protein 5B-like [Source:NCBI gene;Acc:101172731])

HSP 1 Score: 250.751 bits (639), Expect = 4.918e-67
Identity = 179/471 (38.00%), Postives = 260/471 (55.20%), Query Frame = 2
Query: 3407 RRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIG-HDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLN-EDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            R SL+ D+  +++M+D +++V  ARA++ LALEKK+LS+HLK+LL    LL++LYK HAFL CEEEREQFLFHLL+L  V+Y  FT ++  I + YRV I   K+ S   +T +  W CV+G+   +G   IPK   +  F+  NLG L++L++G  + +G+  K  +D V++ N ITG  Y+FPC  WLGKGV D S ER+LVG+++    E+D        P          E   P+ SV     +                + + +   +QE +  A NNLVK+F++ +QER            N+T+LLCG  GLV ++EK    GFKS RLFQ+  +VWD++EK            +   +     K  P  C ++   C  I+ I    ++IGK+GKFQ FV L IRD  L + + LL +   T + YE+    RD      L +IL +L++F I LE AL  G
Sbjct:  836 RGSLLQDIRFVQTMSDGLSEVAQARAWIHLALEKKMLSQHLKELLAHQELLRQLYKPHAFLLCEEEREQFLFHLLSLNTVDYLCFTRVFTSICIQYRVVIIPMKKLSIAMATVS-PWVCVSGELGDSGVIQIPKNTQEIFFQCKNLGRLSTLQLGVQETTGLLAKCLVDSVMVYNEITGHTYRFPCGRWLGKGVGDGSLERVLVGQLVSPGVEEDAGRWTGTPP----------ELASPSQSVRAVLGSL-------------GSRSRMDSLEVQEDMREAANNLVKHFHKPEQERG-----------NLTVLLCGEGGLVLALEKFLLHGFKSGRLFQRNVFVWDFVEKAVVSMETADQMGDLHGS--TLTKGPP--CDSL---CHYINAINGSPRNIGKEGKFQLFVCLGIRDRLLSQWLPLLAECSLTARTYEDGALLRDRAAVHSLCRILQTLHEFSITLEAALIKG 1264          

HSP 2 Score: 222.246 bits (565), Expect = 3.589e-58
Identity = 138/427 (32.32%), Postives = 217/427 (50.82%), Query Frame = 2
Query:  149 YFFVCGLDYNVGLDTYELSTESNEYSSPHCIPPLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECT----STSPETPNGSARDSGWYSYSNI-SVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLV 1414
            YF VCG+D   GL+  + + ES E S      P+ R +   +L H P+    + F +D +I  LCMP GL  F T      P  H+F +  +D TR YG    F EE+ + +I T +  L  M+ + H+S +      S       + S ++   S  +S   S        G  G+F    + LY  KA+ +++  P++   Q +L  +   V+++                               + LESY+ NIL+E   P  G S+   G      CQ P P +LP+ + P+ +   +LG+E+++++ +CVLLE +V++ SQDY+ LM VAE IT LLFPF W H+Y PI+     H L+APVPF+MGI+     +  ++ LP +A +C+V+IDK  V+  +DIP FP +  L +E+ E+L+
Sbjct:   19 YFVVCGVDTETGLEPDDGAGESFEQS------PIRRSFKSKVLVHHPESTDRHPFNKD-AINMLCMPRGLS-FCTQAERLDPRFHSFTIAFDDGTRSYGFVHTFYEEVTSPQIITAMQTLCQMHHVEHHSSSSPSSSSSSSASSPSTCSMDSLASSLEESDAESLPGAPGCLGCVGTFDPTRDTLYVSKALCLITPLPFLQASQRFLAQLHQAVTSQT---------------------------APPLPLESYIHNILYEVPLPPPGRSLRFHGVQGPIVCQRPGPGELPLADYPLGEAFSLLGVENMVKLLTCVLLETQVLLCSQDYQRLMTVAEGITTLLFPFQWQHIYLPIISGPLHHLLHAPVPFLMGIQRKDGAQRSSLHLPHEANLCFVDIDKHCVEYPEDIPQFPDQTELIQELNEVLL 410          

HSP 3 Score: 171.785 bits (434), Expect = 1.836e-42
Identity = 128/391 (32.74%), Postives = 184/391 (47.06%), Query Frame = 2
Query: 1817 KMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIVDKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIRSYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKY 2989
            K    N  LRE+F   F  +F  Y++F+I     +++ ++   R+ T   FDK  FL+ QP  H  FLS FLET MF+ FV+ K++  W D  P   LF+ +LQ+      RL + ++ + L     R Y     +  L+    V+   L      + PH+LD                  GQ  HH                    FP LQ D L         +++  KRS      R+ V  R +SR            K     ++G  N Q++K++  +   L ++R  +DP P         +   H  FV+ LL EC+ KTKRM++E+M  KE +ELGHG   +SG++ENTL+ GLCDLLER W HGL  K GKSALW+HL  +
Sbjct:  494 KAAKLNVQLREVFAARFTAMFGRYEEFVI--HGALDLESWLNNREGTFS-FDKGSFLAVQPAAHRNFLSRFLETSMFSSFVDGKVISCWADREPLQQLFDSRLQR-----GRLHETKDEDSLS----RLYGKCGTL--LQSAQAVERRLLKVDHMAIHPHLLDMR---------------IGQGRHHPGY-----------------FPKLQADVLEQ-------AQNTTKRS-----SRVTVSRRSESR------------KPAAADHSGADNEQRQKHIFLRR-NLHQSRL-LDPSP-------QAVTHTHREFVDGLLNECRLKTKRMLMERME-KENVELGHGGASISGLQENTLIYGLCDLLERTWGHGLQMKQGKSALWSHLVHH 804          
BLAST of DENN domain-containing protein 5B vs. Ensembl Medaka
Match: ENSORLT00000044500.1 (DENN domain-containing protein 5B-like [Source:NCBI gene;Acc:101172731])

HSP 1 Score: 238.039 bits (606), Expect = 4.726e-63
Identity = 151/414 (36.47%), Postives = 216/414 (52.17%), Query Frame = 2
Query: 3578 HAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIG-HDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLN-EDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYR-QQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            HAFL CEEEREQFLFHLL+L  V+Y  FT ++  I + YRV I   K+ S   +T +  W CV+G+   +G   IPK   +  F+  NLG L++L++G  + +G+  K  +D V++ N ITG  Y+FPC  WLGKGV D S ER+LVG+++    E+D        P          E   P+ SV     +                + + +   +QE +  A NNLVK+F++ +QER            N+T+LLCG  GLV ++EK    GFKS RLFQ+  +VWD++EK            +   +     K  P  C ++   C  I+ I    ++IGK+GKFQ FV L IRD  L + + LL +   T + YE+    RD      L +IL +L++F I LE AL  G
Sbjct:  924 HAFLLCEEEREQFLFHLLSLNTVDYLCFTRVFTSICIQYRVVIIPMKKLSIAMATVS-PWVCVSGELGDSGVIQIPKNTQEIFFQCKNLGRLSTLQLGVQETTGLLAKCLVDSVMVYNEITGHTYRFPCGRWLGKGVGDGSLERVLVGQLVSPGVEEDAGRWTGTPP----------ELASPSQSVRAVLGSL-------------GSRSRMDSLEVQEDMREAANNLVKHFHKPEQERG-----------NLTVLLCGEGGLVLALEKFLLHGFKSGRLFQRNVFVWDFVEKAVVSMETADQMGDLHGS--TLTKGPP--CDSL---CHYINAINGSPRNIGKEGKFQLFVCLGIRDRLLSQWLPLLAECSLTARTYEDGALLRDRAAVHSLCRILQTLHEFSITLEAALIKG 1295          

HSP 2 Score: 222.246 bits (565), Expect = 3.941e-58
Identity = 138/427 (32.32%), Postives = 217/427 (50.82%), Query Frame = 2
Query:  149 YFFVCGLDYNVGLDTYELSTESNEYSSPHCIPPLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECT----STSPETPNGSARDSGWYSYSNI-SVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLV 1414
            YF VCG+D   GL+  + + ES E S      P+ R +   +L H P+    + F +D +I  LCMP GL  F T      P  H+F +  +D TR YG    F EE+ + +I T +  L  M+ + H+S +      S       + S ++   S  +S   S        G  G+F    + LY  KA+ +++  P++   Q +L  +   V+++                               + LESY+ NIL+E   P  G S+   G      CQ P P +LP+ + P+ +   +LG+E+++++ +CVLLE +V++ SQDY+ LM VAE IT LLFPF W H+Y PI+     H L+APVPF+MGI+     +  ++ LP +A +C+V+IDK  V+  +DIP FP +  L +E+ E+L+
Sbjct:   19 YFVVCGVDTETGLEPDDGAGESFEQS------PIRRSFKSKVLVHHPESTDRHPFNKD-AINMLCMPRGLS-FCTQAERLDPRFHSFTIAFDDGTRSYGFVHTFYEEVTSPQIITAMQTLCQMHHVEHHSSSSPSSSSSSSASSPSTCSMDSLASSLEESDAESLPGAPGCLGCVGTFDPTRDTLYVSKALCLITPLPFLQASQRFLAQLHQAVTSQT---------------------------APPLPLESYIHNILYEVPLPPPGRSLRFHGVQGPIVCQRPGPGELPLADYPLGEAFSLLGVENMVKLLTCVLLETQVLLCSQDYQRLMTVAEGITTLLFPFQWQHIYLPIISGPLHHLLHAPVPFLMGIQRKDGAQRSSLHLPHEANLCFVDIDKHCVEYPEDIPQFPDQTELIQELNEVLL 410          

HSP 3 Score: 171.785 bits (434), Expect = 1.811e-42
Identity = 128/391 (32.74%), Postives = 184/391 (47.06%), Query Frame = 2
Query: 1817 KMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIVDKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIRSYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKY 2989
            K    N  LRE+F   F  +F  Y++F+I     +++ ++   R+ T   FDK  FL+ QP  H  FLS FLET MF+ FV+ K++  W D  P   LF+ +LQ+      RL + ++ + L     R Y     +  L+    V+   L      + PH+LD                  GQ  HH                    FP LQ D L         +++  KRS      R+ V  R +SR            K     ++G  N Q++K++  +   L ++R  +DP P         +   H  FV+ LL EC+ KTKRM++E+M  KE +ELGHG   +SG++ENTL+ GLCDLLER W HGL  K GKSALW+HL  +
Sbjct:  494 KAAKLNVQLREVFAARFTAMFGRYEEFVI--HGALDLESWLNNREGTFS-FDKGSFLAVQPAAHRNFLSRFLETSMFSSFVDGKVISCWADREPLQQLFDSRLQR-----GRLHETKDEDSLS----RLYGKCGTL--LQSAQAVERRLLKVDHMAIHPHLLDMR---------------IGQGRHHPGY-----------------FPKLQADVLEQ-------AQNTTKRS-----SRVTVSRRSESR------------KPAAADHSGADNEQRQKHIFLRR-NLHQSRL-LDPSP-------QAVTHTHREFVDGLLNECRLKTKRMLMERME-KENVELGHGGASISGLQENTLIYGLCDLLERTWGHGLQMKQGKSALWSHLVHH 804          
BLAST of DENN domain-containing protein 5B vs. Planmine SMEST
Match: SMESG000072343.1 (SMESG000072343.1)

HSP 1 Score: 3074.26 bits (7969), Expect = 0.000e+0
Identity = 1563/1565 (99.87%), Postives = 1564/1565 (99.94%), Query Frame = 2
Query:  116 METRNSENLVDYFFVCGLDYNVGLDTYELSTESNEYSSPHCIPPLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLVGSINHGNITTRPFSGRRGFCGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIVDKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIRSYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRKKNIIKRPNIEIPRRGSVTAGKSPSNTELVKEALTGVGVDSYCLFRYFNDSKGDLHHGDVFGSLKQMKLSSHQSERSKTPDFINKTLMNSGHGVSELFFNWNQNLTGSLGRSGGISINTGSSKSIDLESIFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYRQQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            METRNSENLVDYFFVCGLDYNVGLDTYELSTESNEYSSPHCIPPLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLVGSINHGNITTRPFSGRRG CGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIVDKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIRSYRSYPNSKIMENLEKDLVVKLDKLVTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLG+NGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRKKNIIKRPNIEIPRRGSVTAGKSPSNTELVKEALTGVGVDSYCLFRYFNDSKGDLHHGDVFGSLKQMKLSSHQSERSKTPDFINKTLMNSGHGVSELFFNWNQNLTGSLGRSGGISINTGSSKSIDLESIFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRLALEKKLLSEHLKKLLMDTLLLKELYKRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTPPRSRSPSASRRQSADKIQSEVAMIQEQLGNAVNNLVKYFYRQQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFSQDLNSQNNSLNDPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG
Sbjct:    1 METRNSENLVDYFFVCGLDYNVGLDTYELSTESNEYSSPHCIPPLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLVGSINHGNITTRPFSGRRGSCGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIVDKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIRSYRSYPNSKIMENLEKDLVVKLDKLVTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGHNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRKKNIIKRPNIEIPRRGSVTAGKSPSNTELVKEALTGVGVDSYCLFRYFNDSKGDLHHGDVFGSLKQMKLSSHQSERSKTPDFINKTLMNSGHGVSELFFNWNQNLTGSLGRSGGISINTGSSKSIDLESIFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRLALEKKLLSEHLKKLLMDTLLLKELYKRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTPPRSRSPSASRRQSADKIQSEVAMIQEQLGNAVNNLVKYFYRQQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFSQDLNSQNNSLNDPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 1565          
BLAST of DENN domain-containing protein 5B vs. Planmine SMEST
Match: SMESG000072343.1 (SMESG000072343.1)

HSP 1 Score: 2989.9 bits (7750), Expect = 0.000e+0
Identity = 1532/1565 (97.89%), Postives = 1534/1565 (98.02%), Query Frame = 2
Query:  116 METRNSENLVDYFFVCGLDYNVGLDTYELSTESNEYSSPHCIPPLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLVGSINHGNITTRPFSGRRGFCGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIVDKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIRSYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRKKNIIKRPNIEIPRRGSVTAGKSPSNTELVKEALTGVGVDSYCLFRYFNDSKGDLHHGDVFGSLKQMKLSSHQSERSKTPDFINKTLMNSGHGVSELFFNWNQNLTGSLGRSGGISINTGSSKSIDLESIFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYRQQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            METRNSENLVDYFFVCGLDYNVGLDTYELSTESNEYSSPHCIPPLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLVGSINHGNITTRPFSGRRG CGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIVDKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIRSYRSYPNSKIMENLEKDLVVKLDKLVTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLG+NGELNSQKE            TRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRKKNIIKRPNIEIPRRGSVTAGKSPSNTELVKEALTGVGVDSYCLFRYFNDSKGDLHHGDVFGSLKQMKLSSHQSERSKTPDFINKTLMNSGHGVSELFFNWNQNLTGSLGRSGGISINTGSSKSIDLESIFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRLALEKKLLSEHLKKLLMDTLLLKELYKRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDM                  +NDVPNSSVLYGFQTPPRSRSPSASRRQSADKIQSEVAMIQEQLGNAVNNLVKYFYRQQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFSQDLNSQNNSLNDPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG
Sbjct:    1 METRNSENLVDYFFVCGLDYNVGLDTYELSTESNEYSSPHCIPPLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLVGSINHGNITTRPFSGRRGSCGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIVDKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIRSYRSYPNSKIMENLEKDLVVKLDKLVTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGHNGELNSQKE------------TRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRKKNIIKRPNIEIPRRGSVTAGKSPSNTELVKEALTGVGVDSYCLFRYFNDSKGDLHHGDVFGSLKQMKLSSHQSERSKTPDFINKTLMNSGHGVSELFFNWNQNLTGSLGRSGGISINTGSSKSIDLESIFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRLALEKKLLSEHLKKLLMDTLLLKELYKRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDM------------------KNDVPNSSVLYGFQTPPRSRSPSASRRQSADKIQSEVAMIQEQLGNAVNNLVKYFYRQQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFSQDLNSQNNSLNDPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 1535          
BLAST of DENN domain-containing protein 5B vs. Planmine SMEST
Match: SMESG000072343.1 (SMESG000072343.1)

HSP 1 Score: 2972.57 bits (7705), Expect = 0.000e+0
Identity = 1514/1565 (96.74%), Postives = 1516/1565 (96.87%), Query Frame = 2
Query:  116 METRNSENLVDYFFVCGLDYNVGLDTYELSTESNEYSSPHCIPPLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLVGSINHGNITTRPFSGRRGFCGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIVDKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIRSYRSYPNSKIMENLEXXXXXXXXXXXTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRKKNIIKRPNIEIPRRGSVTAGKSPSNTELVKEALTGVGVDSYCLFRYFNDSKGDLHHGDVFGSLKQMKLSSHQSERSKTPDFINKTLMNSGHGVSELFFNWNQNLTGSLGRSGGISINTGSSKSIDLESIFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTXXXXXXXXXXXXQSADKIQSEVAMIQEQLGNAVNNLVKYFYRQQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFXXXXXXXXXXXXXPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 4810
            METRNSENLVDYFFVCGLDYNVGLDTYELSTESNEYSSPHCIPPLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLVGSINHGNITTRPFSGRRG CGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIVDKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIRSYRSYPNSKIMENLEKDLVVKLDKLVTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLG+NGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRKKNIIKRPNIEIPRRGSVT                              DSKGDLHHGDVFGSLKQMKLSSHQSERSKTPDFINKTLMNSGHGVSELFFNWNQNLTGSLGRSGGISINTGSSKSIDLESIFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRLALEKKLLSEHLKKLLMDTLLLKELYKRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDM                  +NDVPNSSVLYGFQTPPRSRSPSASRRQSADKIQSEVAMIQEQLGNAVNNLVKYFYRQQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFSQDLNSQNNSLNDPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG
Sbjct:    1 METRNSENLVDYFFVCGLDYNVGLDTYELSTESNEYSSPHCIPPLGRPYMPSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIVTREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCSECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLEVESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKSSDDIPIFPYEMNLRKEITELLVGSINHGNITTRPFSGRRGSCGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDNLVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNLVNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKDNINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEMKIVDKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIRSYRSYPNSKIMENLEKDLVVKLDKLVTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQHHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRSHIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGHNGELNSQKEKYLAEKHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVLEKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSALWTHLTKYVDRDRKKNIIKRPNIEIPRRGSVT------------------------------DSKGDLHHGDVFGSLKQMKLSSHQSERSKTPDFINKTLMNSGHGVSELFFNWNQNLTGSLGRSGGISINTGSSKSIDLESIFGPHRRSLVADVNAIKSMTDIITDVGLARAFVRLALEKKLLSEHLKKLLMDTLLLKELYKRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSGKRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLRIGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLVGEIIRLNEDDM------------------KNDVPNSSVLYGFQTPPRSRSPSASRRQSADKIQSEVAMIQEQLGNAVNNLVKYFYRQQERDKLVGNNISASCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFSQDLNSQNNSLNDPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQRFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLSLNDFVIPLERALTDG 1517          
BLAST of DENN domain-containing protein 5B vs. Planmine SMEST
Match: SMESG000026842.1 (SMESG000026842.1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.721e-12
Identity = 60/253 (23.72%), Postives = 119/253 (47.04%), Query Frame = 2
Query:  689 YTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSS------------DVSIENDETNLE--VESKVNLESYVFNILFETDAPARGE-----SIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLA---ARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKS---SDDIPIFP 1372
            +++ +I ++S  P+   F+  LY +  ++   +N +  +QL  +  S             +++  D  +    ++    +ES++  +L    AP  G+     +++ +          PD   L + + P+   LE+LG+++ +R+ + ++LE +VV+ S+DY  L +     T LL+P  +     P+LP     A   L AP P+++G+  +    +   QLP D  V  V++D   + S   SD +P FP
Sbjct:  141 HSLTSICLISHYPFFSKFRQCLYILKNIIEKAHN-RLQKQLDSDKHSAPKHKSVWSLLLGMTLPKDMPHYSPVLKQVQEIESWILRLL-SASAPIAGKNCLYLTVLPESVQDPLIFALPDKTRLSLVDFPLHLPLELLGIDTCLRLLTAIILEQKVVVQSRDYNALTMSVMAFTALLYPLQYMFPVIPLLPTCMHDAEQLLLAPTPYLIGLPASFLSYKKGFQLPPD--VWLVDLDANKLVSSANSDPLPSFP 389          
BLAST of DENN domain-containing protein 5B vs. Planmine SMEST
Match: SMESG000026842.1 (SMESG000026842.1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.900e-12
Identity = 60/253 (23.72%), Postives = 119/253 (47.04%), Query Frame = 2
Query:  689 YTIKAIGVLSQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSS------------DVSIENDETNLE--VESKVNLESYVFNILFETDAPARGE-----SIVIDGPSMRHFCQCPDPKDLPVFELPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLFPFVWSHVYAPILPLA---ARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVCYVNIDKQTVKS---SDDIPIFP 1372
            +++ +I ++S  P+   F+  LY +  ++   +N +  +QL  +  S             +++  D  +    ++    +ES++  +L    AP  G+     +++ +          PD   L + + P+   LE+LG+++ +R+ + ++LE +VV+ S+DY  L +     T LL+P  +     P+LP     A   L AP P+++G+  +    +   QLP D  V  V++D   + S   SD +P FP
Sbjct:  141 HSLTSICLISHYPFFSKFRQCLYILKNIIEKAHN-RLQKQLDSDKHSAPKHKSVWSLLLGMTLPKDMPHYSPVLKQVQEIESWILRLL-SASAPIAGKNCLYLTVLPESVQDPLIFALPDKTRLSLVDFPLHLPLELLGIDTCLRLLTAIILEQKVVVQSRDYNALTMSVMAFTALLYPLQYMFPVIPLLPTCMHDAEQLLLAPTPYLIGLPASFLSYKKGFQLPPD--VWLVDLDANKLVSSANSDPLPSFP 389          
The following BLAST results are available for this feature:
BLAST of DENN domain-containing protein 5B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DENND5A2.134e-11930.93DENN domain containing 5A [Source:HGNC Symbol;Acc:... [more]
DENND5A3.709e-11930.93DENN domain containing 5A [Source:HGNC Symbol;Acc:... [more]
DENND5A1.297e-11730.97DENN domain containing 5A [Source:HGNC Symbol;Acc:... [more]
DENND5B5.041e-11730.07DENN domain containing 5B [Source:HGNC Symbol;Acc:... [more]
DENND5B1.424e-11129.93DENN domain containing 5B [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of DENN domain-containing protein 5B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lst-69.776e-6927.82Lateral Signaling Target [Source:UniProtKB/TrEMBL... [more]
denn-42.419e-1222.98DENN domain type RAB GEF [Source:UniProtKB/TrEMBL... [more]
denn-42.419e-1222.98DENN domain type RAB GEF [Source:UniProtKB/TrEMBL... [more]
denn-42.611e-1222.98DENN domain type RAB GEF [Source:UniProtKB/TrEMBL... [more]
denn-42.611e-1222.98DENN domain type RAB GEF [Source:UniProtKB/TrEMBL... [more]
back to top
BLAST of DENN domain-containing protein 5B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pns6.810e-7740.94gene:FBgn0035229 transcript:FBtr0072735[more]
pns6.810e-7740.94gene:FBgn0035229 transcript:FBtr0072736[more]
pns9.342e-6334.47gene:FBgn0035229 transcript:FBtr0072737[more]
Crag2.094e-1424.73gene:FBgn0025864 transcript:FBtr0071219[more]
Crag2.094e-1424.73gene:FBgn0025864 transcript:FBtr0343356[more]
back to top
BLAST of DENN domain-containing protein 5B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dennd5a1.472e-12632.13DENN/MADD domain containing 5A [Source:ZFIN;Acc:ZD... [more]
dennd5a2.759e-12231.24DENN/MADD domain containing 5A [Source:ZFIN;Acc:ZD... [more]
dennd5b4.778e-12031.39DENN/MADD domain containing 5B [Source:NCBI gene;A... [more]
dennd5b1.005e-11730.83DENN/MADD domain containing 5B [Source:NCBI gene;A... [more]
dennd5b1.677e-11730.83DENN/MADD domain containing 5B [Source:NCBI gene;A... [more]
back to top
BLAST of DENN domain-containing protein 5B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tead47.216e-11731.40TEA domain transcription factor 4 [Source:Xenbase;... [more]
tead49.066e-11731.40TEA domain transcription factor 4 [Source:Xenbase;... [more]
tead41.154e-11631.32TEA domain transcription factor 4 [Source:Xenbase;... [more]
tead43.389e-11531.22TEA domain transcription factor 4 [Source:Xenbase;... [more]
tead41.652e-11331.59TEA domain transcription factor 4 [Source:Xenbase;... [more]
back to top
BLAST of DENN domain-containing protein 5B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dennd5a9.952e-12131.43DENN/MADD domain containing 5A [Source:MGI Symbol;... [more]
Dennd5b1.269e-12031.23DENN/MADD domain containing 5B [Source:MGI Symbol;... [more]
Dennd5a7.238e-11830.86DENN/MADD domain containing 5A [Source:MGI Symbol;... [more]
Madd4.541e-1422.25MAP-kinase activating death domain [Source:MGI Sym... [more]
Madd7.306e-1422.30MAP-kinase activating death domain [Source:MGI Sym... [more]
back to top
BLAST of DENN domain-containing protein 5B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A2RSQ0|DEN5B_MOUSE8.874e-12031.23DENN domain-containing protein 5B OS=Mus musculus ... [more]
sp|Q6IQ26|DEN5A_HUMAN1.781e-11830.93DENN domain-containing protein 5A OS=Homo sapiens ... [more]
sp|Q6PAL8|DEN5A_MOUSE5.063e-11730.86DENN domain-containing protein 5A OS=Mus musculus ... [more]
sp|Q6NXD8|DEN5B_DANRE7.590e-11730.83DENN domain-containing protein 5B OS=Danio rerio O... [more]
sp|G3V7Q0|DEN5A_RAT1.623e-11630.75DENN domain-containing protein 5A OS=Rattus norveg... [more]
back to top
BLAST of DENN domain-containing protein 5B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9K4I90.000e+033.38Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9K4J10.000e+033.19Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A0L8FGI40.000e+034.36Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A0L8FH710.000e+034.26Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A2C9K4J20.000e+033.19Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of DENN domain-containing protein 5B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dennd5b1.875e-6431.99DENN/MADD domain containing 5B [Source:NCBI gene;A... [more]
madd1.449e-1124.90MAP-kinase activating death domain [Source:ZFIN;Ac... [more]
dennd3a3.772e-1126.58DENN domain-containing protein 3 [Source:NCBI gene... [more]
dennd3a3.772e-1126.58DENN domain-containing protein 3 [Source:NCBI gene... [more]
sbf21.195e-1034.00SET binding factor 2 [Source:ZFIN;Acc:ZDB-GENE-030... [more]
back to top
BLAST of DENN domain-containing protein 5B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dennd5a1.479e-11729.98DENN/MADD domain containing 5A [Source:ZFIN;Acc:ZD... [more]
ENSPMAT00000001425.13.207e-2026.23pep scaffold:Pmarinus_7.0:GL478720:33119:40108:1 g... [more]
ENSPMAT00000001445.13.295e-1037.50pep scaffold:Pmarinus_7.0:GL493165:233467:278016:-... [more]
ENSPMAT00000001443.13.788e-1037.50pep scaffold:Pmarinus_7.0:GL493165:212823:273257:-... [more]
ENSPMAT00000006818.18.291e-1030.84pep scaffold:Pmarinus_7.0:GL477729:34763:60683:-1 ... [more]
back to top
BLAST of DENN domain-containing protein 5B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DENN domain-containing protein 5B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO308068.331e-7033.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492671.112e-1231.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449891.963e-1030.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460642.209e-1024.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO389726.747e-1027.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DENN domain-containing protein 5B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dennd5a1.821e-12231.79DENN domain containing 5A [Source:NCBI gene;Acc:10... [more]
dennd5a6.157e-11831.13DENN domain containing 5A [Source:NCBI gene;Acc:10... [more]
dennd5a7.703e-11431.81DENN domain containing 5A [Source:NCBI gene;Acc:10... [more]
ENSORLT00000013346.24.918e-6738.00DENN domain-containing protein 5B-like [Source:NCB... [more]
ENSORLT00000044500.14.726e-6336.47DENN domain-containing protein 5B-like [Source:NCB... [more]
back to top
BLAST of DENN domain-containing protein 5B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072343.10.000e+099.87SMESG000072343.1[more]
SMESG000072343.10.000e+097.89SMESG000072343.1[more]
SMESG000072343.10.000e+096.74SMESG000072343.1[more]
SMESG000026842.11.721e-1223.72SMESG000026842.1[more]
SMESG000026842.11.900e-1223.72SMESG000026842.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013942 ID=SMED30013942|Name=DENN domain-containing protein 5B|organism=Schmidtea mediterranea sexual|type=transcript|length=4974bp
TTTTTTAGAAATTTAGTATTTTTGTGTCTATTCACCATATTATAAAAATG
TTTTAACTTTTGGAAATATCTAATTAAAAATAGTTAATAGAATGAGAAAT
GAATAATTTATTGCAATGGAAACTAGAAATTCTGAAAATTTAGTTGATTA
CTTTTTCGTTTGTGGATTGGATTATAATGTTGGTCTTGACACCTATGAAT
TATCAACTGAATCTAATGAGTATAGTTCACCTCATTGTATACCACCCTTA
GGACGACCTTATATGCCTTCTATTCTTCAACATTTTCCCGACCATTGCGG
AAACTATGCATTTCCAGAAGATTACTCAATAACTTCACTATGCATGCCAG
ATGGGTTACGATTGTTCACAACCTCAACTGTTCCACAAAGTCCAGTTAAT
CATAATTTTATTGTTACCCGAGAAGACGCAACGAGAATATATGGGACATC
ATTATTATTTGCTGAAGAAATCGAAAACGAAGAGATTAAAACCGGCGTCA
TTGATTTACAAAGCATGTATAAAATTGCTCATAATTCGGAGAATGGAGGT
GTTCACGGTTGCAGTGAATGCACTAGCACATCGCCCGAAACTCCAAATGG
CAGCGCTAGGGATTCAGGATGGTATAGTTATTCTAATATTTCTGTGACAG
GTTTATGTGGCAGTTTCTGGTCAGAGGATGAAAAGCTTTATACAATAAAA
GCAATTGGCGTCCTGTCCCAACAACCTTACATCCATTGTTTTCAATCTTG
GCTCTATGATATCTGGTTAATGGTATCAAATGAAAATAACGTGAAATTTA
CCCGCCAATTGTCAGTGGAATCATCGTCGGATGTCAGCATTGAGAATGAC
GAGACCAATTTGGAAGTCGAATCGAAAGTGAACTTGGAAAGTTACGTATT
TAACATTTTGTTTGAAACTGATGCCCCTGCACGGGGAGAGTCAATTGTCA
TCGACGGGCCGTCAATGAGACATTTCTGTCAATGTCCAGACCCCAAAGAT
TTACCCGTATTCGAACTTCCAATGAGAGATCTCCTTGAAGTGTTGGGATT
GGAAAGTCTAATTCGCATATATTCTTGTGTATTGCTTGAATATCGAGTAG
TGATACTTTCTCAAGACTATCGATTGCTTATGCTGGTTGCTGAGTGTATT
ACATGCCTTCTTTTCCCCTTTGTTTGGTCTCATGTTTATGCTCCTATTCT
TCCCCTGGCAGCTCGCCATTTCCTCAATGCCCCAGTACCATTTATTATGG
GAATAAAACTTAACAGCAGCGATGAAGAGGATGCCATTCAGTTACCTAGT
GACGCCTGTGTATGTTACGTGAATATTGATAAACAGACGGTGAAATCATC
TGATGACATTCCCATTTTTCCATATGAAATGAACTTACGTAAAGAGATAA
CCGAATTACTTGTGGGCTCAATTAACCATGGAAATATAACTACTCGGCCA
TTCAGTGGTCGAAGAGGGTTTTGCGGTCCAATTATTAATTCAAACATTCA
GCAAGTCTCGGAATTAGAATCTAAGAATTCTATAAATCAACTTCCTCCAA
AAATAAATTTGAAAGGATATGATAATTTTAAAACTCTTATGAATGAAAAT
GTAACAATAGATAACCTTGTAGATATTCCTCTACCTATTGAAAAAATAAG
ACGAGGCAGTCATATAACCGGTTCATCAATTATGGATGGCAAACTGTTTT
TCAATAGCTATCGGTTACCATCTGATCCCGGAAAATCACTATCTGAAATA
ACGGCTGGAAATCTTGTGAATGAAGATGGCACCATTGTACCAGCCGATAT
TGCAAAGATTTACTACAAGATGTTGAACTTCAATACAGTTTTAAGAGAAT
TATTTCTTAACCACTTTCTCCATATATTTAATGATTATAAACAGTTTATC
ATACCTCCAAAAGATAATATTAATATGTCTGCTTACTTTTTGGAACGTGA
TTCCACTGTTCAACCGTTTGATAAAGCAGGATTTCTAAGCGAACAACCTG
AAACGCATTTACCCTTTCTCAGTGCATTTCTTGAAACTCAAATGTTTACG
TATTTTGTCGAGATGAAAATAGTTGACAAGTGGGAAGATCCACATCCAAA
TTTGGTATTGTTTGAACAAAAACTTCAAAAACGGCAAGATAAATATAAAA
GGTTGTCAAAAGGACAAAATTCAGAAATTTTGGATATTAGATCTTATAGA
AGTTATCCAAATTCGAAAATTATGGAAAATTTGGAAAAAGATTTAGTCGT
CAAATTAGATAAGTTAGTTACTCAAGAACCAAAGGTTGGACCTCATATTC
TTGACTGTAATAATCCTGAAATCGGAACTTGTCTTTCTCAAAGTCGGAGT
CGGTTTTGTGGCCAACATCACCATCATCATAATAAAAACAAATATCTATC
AAATCAAAAGGCGTTTAATTGTACAATTGGAACTAATTTTCCTACATTAC
AAGGCGACTGTTTGCGTAGTCAGCCTCGAAAAAAATCAACCTCAAAACAT
CTTGATAAGAGAAGTCATATCGAGAATGAAGAAAGATTGCCAGTAAAGTT
TCGTCAAAAGTCTCGAACAGTAACAGAAACAAGCGATATTTCAACGTCAT
GCAAAAGTTATACTCTTGGTTACAACGGTGAATTAAACTCTCAAAAGGAG
AAATATCTAGCGGAAAAGCATTTAACTTTGTGGAAAACTAGAACAAAAAT
TGATCCGAAACCGTATTTACCCAATATCATTCCGATGGGAATGGCTCAAA
ATCATTGGGCTTTTGTAAATAAGTTGCTACAGGAATGCAAAACTAAAACC
AAACGTATGGTGTTGGAAAAAATGGGCGGCAAAGAAGCAATTGAGCTTGG
GCATGGAGATCTTTTTGTTTCAGGAATCGAAGAGAATACTTTGGTAGCGG
GTTTATGTGATTTGCTAGAACGAATTTGGTGTCATGGTTTAACTAATAAA
TATGGAAAATCTGCATTATGGACTCATTTGACAAAATATGTTGACAGAGA
TAGAAAGAAAAATATTATTAAAAGGCCCAATATTGAAATTCCTAGAAGAG
GCAGTGTGACAGCTGGAAAAAGTCCATCGAATACGGAACTAGTAAAAGAA
GCTCTTACTGGCGTCGGAGTTGATTCGTATTGCTTATTTAGATATTTTAA
CGACAGCAAAGGCGATTTGCATCATGGTGATGTGTTTGGATCTTTGAAAC
AGATGAAGCTGAGTTCTCATCAATCGGAACGTTCGAAAACTCCCGATTTT
ATTAACAAGACTTTGATGAATTCTGGTCACGGTGTCAGTGAATTGTTTTT
CAATTGGAATCAAAACCTGACAGGATCTCTTGGTCGAAGTGGTGGAATTT
CCATCAATACTGGTTCGTCTAAGAGCATTGATTTGGAATCGATTTTCGGT
CCTCATAGAAGATCTCTAGTAGCAGATGTAAATGCTATCAAATCTATGAC
GGACATTATTACTGATGTCGGACTTGCTCGAGCATTTGTTCGGTTAGCGT
TAGAAAAGAAGCTACTTAGTGAGCATTTGAAAAAGTTATTAATGGATACA
TTGCTTCTCAAGGAGCTTTATAAACGGCATGCATTTTTGAGGTGTGAAGA
AGAAAGAGAGCAATTTCTTTTTCATTTATTGGCGCTTCAAGCTGTCGAAT
ATTATTCTTTCACAAATCTCTATATCAAAATTCAATTGGTATATCGGGTG
TTCATTTATTCTGGCAAGCGATTCTCGACTGGAACCAGCACAACGGCCAA
TGCTTGGTTCTGTGTTAATGGCCAACACTGCAGCACTGGTCAAAGGGCGA
TTCCCAAGGGACTTTATCAATTTGAATTTGAAAATCCAAATCTTGGAGTT
TTAACCTCTCTACGAATCGGCCATGACAACAGTGGAATGTCTCCAAAATG
GTTTATCGACTTTGTCCTTATTCAAAATCTTATTACCGGTCTTGTTTATA
AATTTCCTTGCAACAACTGGCTGGGAAAAGGAGTGGATGACAGTAGCACA
GAACGTTTGCTTGTTGGGGAAATAATCAGACTTAACGAAGATGATATGAA
TGAAATAATGATAAATAACCCCGATGGAGTGGATATTTCGTTTTTTAGCG
AAGAAAATGATGTACCAAACTCTTCGGTATTATATGGATTTCAGACTCCA
CCTCGATCAAGATCTCCATCTGCTTCACGAAGGCAAAGTGCAGATAAAAT
CCAGTCAGAGGTAGCTATGATCCAGGAACAATTAGGAAACGCTGTAAATA
ATCTAGTGAAATATTTTTATCGACAACAAGAACGGGACAAATTAGTCGGC
AACAACATCAGTGCTTCGTGCAATGTCACTTTACTTTTGTGCGGTGCCGA
TGGTTTAGTTCCGTCAATGGAGAAGGTTTTTCGATTTGGATTCAAATCGA
GTAGGTTATTCCAAAAGAAATTCTATGTTTGGGATTATTTGGAAAAGACT
TCTTCTGAATTTTCTCAAGATCTCAACAGTCAAAATAATTCTTTAAATGA
TCCTAATGAGAAAAAATATTCCCCAAATCAATGTATGACCATACAATATT
TTTGTAAATTAATCAGCAAAATTGCCCATGTTAACCAATCTATCGGCAAG
GATGGAAAATTCCAGCGATTTGTTTCCTTGTCAATCAGAGATCACAAATT
ACCAGAACTGATCGGTCTTTTAGGTCAAGTGGACTGTACTCAACAATATT
ATGAGGAATCTTGTTTCTTTAGAGACAACCATTTGAGAGATTTCCTCATT
AAAATTTTGTTATCATTGAATGATTTTGTAATTCCTCTTGAAAGAGCTTT
AACTGACGGTTTGTAAATTTTGTTCAAAAAACTTCTCTTTTGACATATAT
TTATTTAAACAAGTGCCAATTATAAATGATTGTATGAAGTTGCACTTGTT
CATGAGTCTGCGTAACGCAAATGTTATTTTAAATGTATTTTTACGAAAAA
AATATAGCGTGCGTTGTTTTAAAA
back to top

protein sequence of SMED30013942-orf-1

>SMED30013942-orf-1 ID=SMED30013942-orf-1|Name=SMED30013942-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1567bp
METRNSENLVDYFFVCGLDYNVGLDTYELSTESNEYSSPHCIPPLGRPYM
PSILQHFPDHCGNYAFPEDYSITSLCMPDGLRLFTTSTVPQSPVNHNFIV
TREDATRIYGTSLLFAEEIENEEIKTGVIDLQSMYKIAHNSENGGVHGCS
ECTSTSPETPNGSARDSGWYSYSNISVTGLCGSFWSEDEKLYTIKAIGVL
SQQPYIHCFQSWLYDIWLMVSNENNVKFTRQLSVESSSDVSIENDETNLE
VESKVNLESYVFNILFETDAPARGESIVIDGPSMRHFCQCPDPKDLPVFE
LPMRDLLEVLGLESLIRIYSCVLLEYRVVILSQDYRLLMLVAECITCLLF
PFVWSHVYAPILPLAARHFLNAPVPFIMGIKLNSSDEEDAIQLPSDACVC
YVNIDKQTVKSSDDIPIFPYEMNLRKEITELLVGSINHGNITTRPFSGRR
GFCGPIINSNIQQVSELESKNSINQLPPKINLKGYDNFKTLMNENVTIDN
LVDIPLPIEKIRRGSHITGSSIMDGKLFFNSYRLPSDPGKSLSEITAGNL
VNEDGTIVPADIAKIYYKMLNFNTVLRELFLNHFLHIFNDYKQFIIPPKD
NINMSAYFLERDSTVQPFDKAGFLSEQPETHLPFLSAFLETQMFTYFVEM
KIVDKWEDPHPNLVLFEQKLQKRQDKYKRLSKGQNSEILDIRSYRSYPNS
KIMENLEKDLVVKLDKLVTQEPKVGPHILDCNNPEIGTCLSQSRSRFCGQ
HHHHHNKNKYLSNQKAFNCTIGTNFPTLQGDCLRSQPRKKSTSKHLDKRS
HIENEERLPVKFRQKSRTVTETSDISTSCKSYTLGYNGELNSQKEKYLAE
KHLTLWKTRTKIDPKPYLPNIIPMGMAQNHWAFVNKLLQECKTKTKRMVL
EKMGGKEAIELGHGDLFVSGIEENTLVAGLCDLLERIWCHGLTNKYGKSA
LWTHLTKYVDRDRKKNIIKRPNIEIPRRGSVTAGKSPSNTELVKEALTGV
GVDSYCLFRYFNDSKGDLHHGDVFGSLKQMKLSSHQSERSKTPDFINKTL
MNSGHGVSELFFNWNQNLTGSLGRSGGISINTGSSKSIDLESIFGPHRRS
LVADVNAIKSMTDIITDVGLARAFVRLALEKKLLSEHLKKLLMDTLLLKE
LYKRHAFLRCEEEREQFLFHLLALQAVEYYSFTNLYIKIQLVYRVFIYSG
KRFSTGTSTTANAWFCVNGQHCSTGQRAIPKGLYQFEFENPNLGVLTSLR
IGHDNSGMSPKWFIDFVLIQNLITGLVYKFPCNNWLGKGVDDSSTERLLV
GEIIRLNEDDMNEIMINNPDGVDISFFSEENDVPNSSVLYGFQTPPRSRS
PSASRRQSADKIQSEVAMIQEQLGNAVNNLVKYFYRQQERDKLVGNNISA
SCNVTLLLCGADGLVPSMEKVFRFGFKSSRLFQKKFYVWDYLEKTSSEFS
QDLNSQNNSLNDPNEKKYSPNQCMTIQYFCKLISKIAHVNQSIGKDGKFQ
RFVSLSIRDHKLPELIGLLGQVDCTQQYYEESCFFRDNHLRDFLIKILLS
LNDFVIPLERALTDGL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR043153DENN_C
IPR037213Run_dom_sf
IPR037516Tripartite_DENN
IPR036392PLAT/LH2_dom_sf
IPR005112dDENN_dom
IPR004012Run_dom
IPR005113uDENN_dom
IPR001194cDENN_dom
IPR001024PLAT/LH2_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005085guanyl-nucleotide exchange factor activity
GO:0005262calcium channel activity
GO:0017112Rab guanyl-nucleotide exchange factor activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0043547positive regulation of GTPase activity
GO:0050982detection of mechanical stimulus
GO:0070588calcium ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004012RUN domainSMARTSM00593893paper3coord: 1121..1184
e-value: 1.1E-14
score: 64.7
coord: 1499..1559
e-value: 0.0084
score: 25.3
IPR004012RUN domainPFAMPF02759RUNcoord: 930..1179
e-value: 1.4E-15
score: 57.4
coord: 1414..1555
e-value: 2.1E-7
score: 31.0
IPR004012RUN domainPROSITEPS50826RUNcoord: 1405..1563
score: 19.869
IPR004012RUN domainPROSITEPS50826RUNcoord: 921..1190
score: 24.569
IPR005113uDENN domainSMARTSM00800uDENN_clscoord: 6..116
e-value: 3.2E-13
score: 59.9
IPR005113uDENN domainPFAMPF03456uDENNcoord: 51..115
e-value: 8.4E-10
score: 39.3
IPR005112dDENN domainSMARTSM00801dDENN_clscoord: 572..651
e-value: 1.8E-11
score: 54.1
IPR005112dDENN domainPFAMPF03455dDENNcoord: 618..668
e-value: 2.0E-15
score: 56.5
IPR001194cDENN domainSMARTSM00799DENN_clscoord: 192..407
e-value: 8.7E-46
score: 168.1
IPR001194cDENN domainPFAMPF02141DENNcoord: 193..406
e-value: 2.6E-39
score: 135.1
IPR043153DENN domain, C-terminal lobeGENE3DG3DSA:3.40.50.11500coord: 299..438
e-value: 8.3E-32
score: 112.0
IPR001024PLAT/LH2 domainPFAMPF01477PLATcoord: 1193..1298
e-value: 9.6E-12
score: 45.5
IPR001024PLAT/LH2 domainPROSITEPS50095PLATcoord: 1191..1300
score: 25.676
NoneNo IPR availableGENE3DG3DSA:2.60.60.20coord: 1190..1309
e-value: 6.3E-29
score: 102.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 784..804
NoneNo IPR availablePANTHERPTHR46070FAMILY NOT NAMEDcoord: 7..226
coord: 252..1565
IPR037213RUN domain superfamilyGENE3DG3DSA:1.20.58.900coord: 1097..1188
e-value: 2.6E-26
score: 94.3
coord: 870..968
e-value: 1.9E-35
score: 123.9
IPR037213RUN domain superfamilyGENE3DG3DSA:1.20.58.900coord: 1360..1562
e-value: 4.8E-16
score: 60.6
IPR037213RUN domain superfamilySUPERFAMILYSSF140741RUN domain-likecoord: 1365..1558
IPR037213RUN domain superfamilySUPERFAMILYSSF140741RUN domain-likecoord: 881..1184
IPR037516Tripartite DENN domainPROSITEPS50211DENNcoord: 35..658
score: 37.388
IPR036392PLAT/LH2 domain superfamilySUPERFAMILYSSF49723Lipase/lipooxygenase domain (PLAT/LH2 domain)coord: 1193..1293