SMED30013926
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30013926 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 3
Alignments
SMED30013926 aligns in the following genomic locations:
Homology
BLAST of SMED30013926 vs. Ensembl Human
Match: SFR1 (SWI5 dependent homologous recombination repair protein 1 [Source:HGNC Symbol;Acc:HGNC:29574]) HSP 1 Score: 44.2838 bits (103), Expect = 9.699e-6 Identity = 26/77 (33.77%), Postives = 50/77 (64.94%), Query Frame = 2 Query: 77 LLNSIKTKEDIIRRIEMINQLKNKSDFKDMKSLIDKWKLNCRTSILMLYEYMR--SRNDPKLSITELLDKLSVEENL 301 L+ ++ KED++RR++++ ++K+D ++ LI KW+ +C S L+LYE S + KLS+T+L+D +++ L Sbjct: 159 LVKQVQEKEDLLRRLKLVKMYRSKNDLSQLQLLIKKWR-SC--SQLLLYELQSAVSEENKKLSLTQLIDHYGLDDKL 232
BLAST of SMED30013926 vs. Ensembl Human
Match: SFR1 (SWI5 dependent homologous recombination repair protein 1 [Source:HGNC Symbol;Acc:HGNC:29574]) HSP 1 Score: 43.8986 bits (102), Expect = 9.985e-6 Identity = 26/77 (33.77%), Postives = 50/77 (64.94%), Query Frame = 2 Query: 77 LLNSIKTKEDIIRRIEMINQLKNKSDFKDMKSLIDKWKLNCRTSILMLYEYMR--SRNDPKLSITELLDKLSVEENL 301 L+ ++ KED++RR++++ ++K+D ++ LI KW+ +C S L+LYE S + KLS+T+L+D +++ L Sbjct: 146 LVKQVQEKEDLLRRLKLVKMYRSKNDLSQLQLLIKKWR-SC--SQLLLYELQSAVSEENKKLSLTQLIDHYGLDDKL 219
BLAST of SMED30013926 vs. UniProt/SwissProt
Match: sp|E1BXS0|SFR1_CHICK (Swi5-dependent recombination DNA repair protein 1 homolog OS=Gallus gallus OX=9031 GN=SFR1 PE=3 SV=1) HSP 1 Score: 46.2098 bits (108), Expect = 7.628e-6 Identity = 23/77 (29.87%), Postives = 52/77 (67.53%), Query Frame = 2 Query: 77 LLNSIKTKEDIIRRIEMINQLKNKSDFKDMKSLIDKWKLNCRTSILMLYEYMR--SRNDPKLSITELLDKLSVEENL 301 L+ +K KE+++RR++++ ++K++ ++++LI KW+ ++ LMLYE S + K+S+++L+D +E++L Sbjct: 136 LMKQVKEKEELLRRLKLVKMYRSKNNLSELQALIVKWR---SSTQLMLYELQAAFSADGKKVSLSQLIDTFGLEDHL 209
BLAST of SMED30013926 vs. TrEMBL
Match: K1Q2M0 (RFT1-like protein OS=Crassostrea gigas OX=29159 GN=CGI_10013565 PE=4 SV=1) HSP 1 Score: 57.3806 bits (137), Expect = 3.647e-7 Identity = 31/99 (31.31%), Postives = 56/99 (56.57%), Query Frame = 2 Query: 35 ARSKTVSGDNKNKELLNSIKTKEDIIRRIEMINQLKNKSDFKDMKSLIDKWKLNCRTSILMLYEYMRSRNDPKLSITELLDKLSVEENL----REDLNF 319 A S+T D + ++L SIK KED++R++ ++ +NK D M+ LI KW + ++ L M +P+ +TEL+D L ++ ++ +ED +F Sbjct: 784 ADSETQEQDKRRQQLQASIKEKEDVLRKLRLVQFYENKHDLGKMEELIRKWYQVSQEGLVDLLNLM---PEPRPELTELIDHLGIDHSMIGYNKEDQSF 879
BLAST of SMED30013926 vs. TrEMBL
Match: W4Z9H8 (Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1) HSP 1 Score: 52.373 bits (124), Expect = 2.222e-6 Identity = 25/86 (29.07%), Postives = 53/86 (61.63%), Query Frame = 2 Query: 44 KTVSGDNKNKELLNSIKTKEDIIRRIEMINQLKNKSDFKDMKSLIDKWKLNCRTSILMLYEYMRSRNDPKLSITELLDKLSVEENL 301 K + D KEL + KE+ R+++++ ++K+D + +++LI+KW+ C+TSIL LY + +PK S+ + ++ ++++L Sbjct: 14 KIIEADLNRKELTRQVAEKEETCRKLKLVKMYRSKNDLEALQNLIEKWREGCQTSILRLY---KKHPEPKPSLGDFINSCRLDKDL 96
BLAST of SMED30013926 vs. Ensembl Nematostella
Match: EDO45407 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT67]) HSP 1 Score: 42.743 bits (99), Expect = 5.239e-6 Identity = 26/80 (32.50%), Postives = 45/80 (56.25%), Query Frame = 2 Query: 62 NKNKELLNSIKTKEDIIRRIEMINQLKNKSDFKDMKSLIDKWKLNCRTSILMLYEYMRSRNDPKLSITELLDKLSVEENL 301 NKN LL I +ED +R+++M+ + K+D D++ LIDKW+ + + L ++ PK+ ELLD+ ++ L Sbjct: 100 NKNG-LLRQIAEREDKLRKLKMVKMYRTKNDLTDLQKLIDKWRNVSQEAAERLLTKIKKEPSPKMK--ELLDQFQIDYKL 176
BLAST of SMED30013926 vs. Planmine SMEST
Match: SMESG000039442.1 (SMESG000039442.1) HSP 1 Score: 199.904 bits (507), Expect = 4.547e-68 Identity = 102/102 (100.00%), Postives = 102/102 (100.00%), Query Frame = 2 Query: 17 MYRRSLARSKTVSGDNKNKELLNSIKTKEDIIRRIEMINQLKNKSDFKDMKSLIDKWKLNCRTSILMLYEYMRSRNDPKLSITELLDKLSVEENLREDLNFE 322 MYRRSLARSKTVSGDNKNKELLNSIKTKEDIIRRIEMINQLKNKSDFKDMKSLIDKWKLNCRTSILMLYEYMRSRNDPKLSITELLDKLSVEENLREDLNFE Sbjct: 1 MYRRSLARSKTVSGDNKNKELLNSIKTKEDIIRRIEMINQLKNKSDFKDMKSLIDKWKLNCRTSILMLYEYMRSRNDPKLSITELLDKLSVEENLREDLNFE 102 The following BLAST results are available for this feature:
BLAST of SMED30013926 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 2
BLAST of SMED30013926 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30013926 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of SMED30013926 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30013926 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of SMED30013926 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30013926 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 1
BLAST of SMED30013926 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 2
BLAST of SMED30013926 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30013926 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30013926 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30013926 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 1
BLAST of SMED30013926 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of SMED30013926 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 1
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30013926 ID=SMED30013926|Name=SMED30013926|organism=Schmidtea mediterranea sexual|type=transcript|length=338bpback to top protein sequence of SMED30013926-orf-1 >SMED30013926-orf-1 ID=SMED30013926-orf-1|Name=SMED30013926-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=103bp MYRRSLARSKTVSGDNKNKELLNSIKTKEDIIRRIEMINQLKNKSDFKDMback to top Annotated Terms
The following terms have been associated with this transcript:
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
|