tud-1

Overview
Nametud-1 (AHC00376.1)
Smed IDSMED30013909
Length (bp)2414
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of tud-1 (SMED30013909) t-SNE clustered cells

Violin plots show distribution of expression levels for tud-1 (SMED30013909) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of tud-1 (SMED30013909) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for tud-1 (SMED30013909) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Don't be a BOT, type this for download: SG23gxY9

 

back to top

Expression Details

tud-1 ( tud-1 ) is expressed during Stage 2, Stage 3, Stage 4, Stage 5, Stage 6, Stage 7 and Stage 8 in the neoblast and blastomere

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene tud-1.

SPIM reconstructed S4 embryo costained with piwi-1 (red) and tud-1 (green). piwi-1+ blastomeres co-express the nuage factor tud-1, and virtually all tud-1+ cells co-express piwi-1.

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene tud-1.

SPIM reconstructed S5 embryo costained with piwi-1 (red) and tud-1 (green). piwi-1+ blastomeres co-express the nuage factor tud-1, and virtually all tud-1+ cells co-express piwi-1.

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene tud-1.

SPIM reconstructed S3 embryo costained with piwi-1 (red) and tud-1 (green). piwi-1+ blastomeres co-express the nuage factor tud-1, and virtually all tud-1+ cells co-express piwi-1.

Anatomical Expression

PAGE et. al., 2020




SMED30013909

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 38

  
PLANA TermReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30013909SMESG000029236.1 SMESG000029232.1 dd_Smed_v4_1582_0_1dd_Smed_v4PMID:29674431whole organismasexual adultsingle-cell RNA-sequencing evidence
neoblastSMED30013909SMESG000029236.1 SMESG000029232.1 dd_Smed_v4_1582_0_1dd_Smed_v4PMID:29674431whole organismasexual adultsingle-cell RNA-sequencing evidence
parenchymaSMED30013909SMESG000029236.1 SMESG000029232.1 Contig48859newmark_estsPMID:27612384whole organismasexual adultcolorimetric in situ hybridization evidence
parenchymaSMED30013909SMESG000029236.1 SMESG000029232.1 Contig48859uc_Smed_v2PMID:27612384whole organismasexual adultcolorimetric in situ hybridization evidence
blastomereSMED30013909SMESG000029236.1 SMESG000029232.1 SMED30013909smed_20140614PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
blastomereSMED30013909SMESG000029236.1 SMESG000029232.1 SMED30013909smed_20140614PMID:28072387whole organismStage 4fluorescence in situ hybridization evidence
blastomereSMED30013909SMESG000029236.1 SMESG000029232.1 SMED30013909smed_20140614PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
blastomereSMED30013909SMESG000029236.1 SMESG000029232.1 SMED30013909smed_20140614PMID:28072387whole organismStage 2colorimetric in situ hybridization evidence
neoblastSMED30013909SMESG000029236.1 SMESG000029232.1 SMED30013909smed_20140614PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
neoblastSMED30013909SMESG000029236.1 SMESG000029232.1 SMED30013909smed_20140614PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
blastomereSMED30013909SMESG000029236.1 SMESG000029232.1 SMED30013909smed_20140614PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
blastomereSMED30013909SMESG000029236.1 SMESG000029232.1 SMED30013909smed_20140614PMID:28072387whole organismStage 3fluorescence in situ hybridization evidence
neoblastSMED30013909SMESG000029236.1 SMESG000029232.1 SMED30013909smed_20140614PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
blastomereSMED30013909SMESG000029236.1 SMESG000029232.1 SMED30013909smed_20140614PMID:28072387whole organismStage 5fluorescence in situ hybridization evidence
X2 cellSMED30013909SMESG000029236.1 SMESG000029232.1 SmedASXL_006995SmedAsxl_ww_GCZZ01PMID:26114597FACS sorted cell populationasexual adultRNA-sequencing evidence
X1 cellSMED30013909SMESG000029236.1 SMESG000029232.1 SmedASXL_006995SmedAsxl_ww_GCZZ01PMID:26114597FACS sorted cell populationasexual adultRNA-sequencing evidence
blastomereSMED30013909SMESG000029236.1 SMESG000029232.1 KF781126smed_ncbi_20200123PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
neoblastSMED30013909SMESG000029236.1 SMESG000029232.1 KF781126smed_ncbi_20200123PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
neoblastSMED30013909SMESG000029236.1 SMESG000029232.1 KF781126smed_ncbi_20200123PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
blastomereSMED30013909SMESG000029236.1 SMESG000029232.1 KF781126smed_ncbi_20200123PMID:28072387whole organismStage 4fluorescence in situ hybridization evidence
blastomereSMED30013909SMESG000029236.1 SMESG000029232.1 KF781126smed_ncbi_20200123PMID:28072387whole organismStage 3fluorescence in situ hybridization evidence
neoblastSMED30013909SMESG000029236.1 SMESG000029232.1 KF781126smed_ncbi_20200123PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
blastomereSMED30013909SMESG000029236.1 SMESG000029232.1 KF781126smed_ncbi_20200123PMID:28072387whole organismStage 5fluorescence in situ hybridization evidence
blastomereSMED30013909SMESG000029236.1 SMESG000029232.1 KF781126smed_ncbi_20200123PMID:28072387whole organismStage 2colorimetric in situ hybridization evidence
blastomereSMED30013909SMESG000029236.1 SMESG000029232.1 KF781126smed_ncbi_20200123PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
blastomereSMED30013909SMESG000029236.1 SMESG000029232.1 KF781126smed_ncbi_20200123PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
blastomereSMED30013909SMESG000029236.1 SMESG000029232.1 tud-1smed_ncbi_20200123PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
blastomereSMED30013909SMESG000029236.1 SMESG000029232.1 tud-1smed_ncbi_20200123PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
blastomereSMED30013909SMESG000029236.1 SMESG000029232.1 tud-1smed_ncbi_20200123PMID:28072387whole organismStage 3fluorescence in situ hybridization evidence
neoblastSMED30013909SMESG000029236.1 SMESG000029232.1 tud-1smed_ncbi_20200123PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
blastomereSMED30013909SMESG000029236.1 SMESG000029232.1 tud-1smed_ncbi_20200123PMID:28072387whole organismStage 2colorimetric in situ hybridization evidence
neoblastSMED30013909SMESG000029236.1 SMESG000029232.1 tud-1smed_ncbi_20200123PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
blastomereSMED30013909SMESG000029236.1 SMESG000029232.1 tud-1smed_ncbi_20200123PMID:28072387whole organismStage 5fluorescence in situ hybridization evidence
neoblastSMED30013909SMESG000029236.1 SMESG000029232.1 tud-1smed_ncbi_20200123PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
blastomereSMED30013909SMESG000029236.1 SMESG000029232.1 tud-1smed_ncbi_20200123PMID:28072387whole organismStage 4fluorescence in situ hybridization evidence
blastomereSMED30013909SMESG000029236.1 SMESG000029232.1 tud-1smed_ncbi_20200123PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
X1 cellSMED30013909SMESG000029236.1 SMESG000029232.1 isotig12850be_Smed_v2PMID:22543868FACS sorted cell populationasexual adultRNA-sequencing evidence
neoblastSMED30013909SMESG000029236.1 SMESG000029232.1 dd_Smed_v6_1582_0dd_Smed_v6PMID:29674432FACS sorted cell populationasexual adultsingle-cell RNA-sequencing evidence
Homology
BLAST of tud-1 vs. Ensembl Zebrafish
Match: tdrd6 (tudor domain containing 6 [Source:ZFIN;Acc:ZDB-GENE-041001-210])

HSP 1 Score: 53.1434 bits (126), Expect = 1.469e-6
Identity = 38/128 (29.69%), Postives = 64/128 (50.00%), Query Frame = 1
Query: 1588 GKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLS-LNI 1968
            G   +V +SH  SP +FF+Q    E  +    + EKLN + +      +SD+ E   V A F     D+  +RA V +   E  +I V F+D+GN   ++ + + +  +   S P ++IHC +  LN+
Sbjct: 1234 GLEAEVFISHCNSPCSFFVQFATDEDDIY--SLVEKLNADQSRCRNIDSSDIHEGDLVCAMF---PDDSSWYRAVVRKNTNE--KIDVEFVDFGNTAVISSKNVCHLGQSFASFPRYSIHCSVHKLNV 1354          
BLAST of tud-1 vs. Ensembl Zebrafish
Match: tdrd6 (tudor domain containing 6 [Source:ZFIN;Acc:ZDB-GENE-041001-210])

HSP 1 Score: 53.1434 bits (126), Expect = 1.469e-6
Identity = 38/128 (29.69%), Postives = 64/128 (50.00%), Query Frame = 1
Query: 1588 GKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLS-LNI 1968
            G   +V +SH  SP +FF+Q    E  +    + EKLN + +      +SD+ E   V A F     D+  +RA V +   E  +I V F+D+GN   ++ + + +  +   S P ++IHC +  LN+
Sbjct: 1234 GLEAEVFISHCNSPCSFFVQFATDEDDIY--SLVEKLNADQSRCRNIDSSDIHEGDLVCAMF---PDDSSWYRAVVRKNTNE--KIDVEFVDFGNTAVISSKNVCHLGQSFASFPRYSIHCSVHKLNV 1354          
BLAST of tud-1 vs. Ensembl Zebrafish
Match: si:ch211-189e2.3 (si:ch211-189e2.3 [Source:ZFIN;Acc:ZDB-GENE-030131-6454])

HSP 1 Score: 51.2174 bits (121), Expect = 5.355e-6
Identity = 58/221 (26.24%), Postives = 99/221 (44.80%), Query Frame = 1
Query: 1540 QKKAYEYAKVSYKDL----IGKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLSLNIK--KEAWSH-AIELFNDLAGYTENDQGTFVMQVISVDGDSLVVDLISELKGSLT----AILEKSGTCVKSNEPI 2169
            Q++   Y K++   L    +G    V +SH  SP NFF+QL   E ++    + EKLN           + ++    V A +    +D   +RA V  K K++  + V FID+GN+  +    +   +++ +S P  +I C L    +  K  W+   I  F + AG  EN +     + I  D +  +V L  + +G  T    A  E    C+K+ +P+
Sbjct:  764 QQQVMAYPKLTELPLRTIDVGYVSDVYVSHCNSPSNFFVQLTTDEDEIF--SLIEKLNCTLISDLQVELNLLQSDDLVKAEY---PADGAYYRAVV--KSKKNGMVQVQFIDFGNEVTLLPTKIKQLDKQFLSTPRLSIQCMLEDGKRRGKRDWTQEEIMTFKEAAG--ENGEKKIQCKFIQEDANCWLVSLEHQ-EGWFTVKSDAQSESQVHCIKNTQPL 974          
BLAST of tud-1 vs. Ensembl Zebrafish
Match: si:ch211-189e2.3 (si:ch211-189e2.3 [Source:ZFIN;Acc:ZDB-GENE-030131-6454])

HSP 1 Score: 51.2174 bits (121), Expect = 5.793e-6
Identity = 58/221 (26.24%), Postives = 99/221 (44.80%), Query Frame = 1
Query: 1540 QKKAYEYAKVSYKDL----IGKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLSLNIK--KEAWSH-AIELFNDLAGYTENDQGTFVMQVISVDGDSLVVDLISELKGSLT----AILEKSGTCVKSNEPI 2169
            Q++   Y K++   L    +G    V +SH  SP NFF+QL   E ++    + EKLN           + ++    V A +    +D   +RA V  K K++  + V FID+GN+  +    +   +++ +S P  +I C L    +  K  W+   I  F + AG  EN +     + I  D +  +V L  + +G  T    A  E    C+K+ +P+
Sbjct:  764 QQQVMAYPKLTELPLRTIDVGYVSDVYVSHCNSPSNFFVQLTTDEDEIF--SLIEKLNCTLISDLQVELNLLQSDDLVKAEY---PADGAYYRAVV--KSKKNGMVQVQFIDFGNEVTLLPTKIKQLDKQFLSTPRLSIQCMLEDGKRRGKRDWTQEEIMTFKEAAG--ENGEKKIQCKFIQEDANCWLVSLEHQ-EGWFTVKSDAQSESQVHCIKNTQPL 974          
BLAST of tud-1 vs. Ensembl Zebrafish
Match: si:ch211-189e2.3 (si:ch211-189e2.3 [Source:ZFIN;Acc:ZDB-GENE-030131-6454])

HSP 1 Score: 51.2174 bits (121), Expect = 6.045e-6
Identity = 58/221 (26.24%), Postives = 99/221 (44.80%), Query Frame = 1
Query: 1540 QKKAYEYAKVSYKDL----IGKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLSLNIK--KEAWSH-AIELFNDLAGYTENDQGTFVMQVISVDGDSLVVDLISELKGSLT----AILEKSGTCVKSNEPI 2169
            Q++   Y K++   L    +G    V +SH  SP NFF+QL   E ++    + EKLN           + ++    V A +    +D   +RA V  K K++  + V FID+GN+  +    +   +++ +S P  +I C L    +  K  W+   I  F + AG  EN +     + I  D +  +V L  + +G  T    A  E    C+K+ +P+
Sbjct:  764 QQQVMAYPKLTELPLRTIDVGYVSDVYVSHCNSPSNFFVQLTTDEDEIF--SLIEKLNCTLISDLQVELNLLQSDDLVKAEY---PADGAYYRAVV--KSKKNGMVQVQFIDFGNEVTLLPTKIKQLDKQFLSTPRLSIQCMLEDGKRRGKRDWTQEEIMTFKEAAG--ENGEKKIQCKFIQEDANCWLVSLEHQ-EGWFTVKSDAQSESQVHCIKNTQPL 974          
BLAST of tud-1 vs. Ensembl Xenopus
Match: ENSXETT00000011761.1 (ring finger protein 17 [Source:NCBI gene;Acc:100490831])

HSP 1 Score: 55.8398 bits (133), Expect = 2.937e-7
Identity = 40/126 (31.75%), Postives = 65/126 (51.59%), Query Frame = 1
Query: 1594 SFKVIMSHVVSPINFFIQLDDGEHQLAL--GDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSG-SDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLSL 1962
            +F V++SHV SP +F+IQ+ D  ++ A    +IQE  N           SD+K   AVI    +    D   +RA V+    +  ++ + F+D+G+ + VN  TL +  EE +  P  AI C+L+ 
Sbjct:  394 NFTVVVSHVNSPSDFYIQVADNANEYATFSQEIQEVYNCE--------ESDLKIKHAVIGQVCMKKFKDGYWYRAVVVGFTGQD-EVTIKFVDFGDTDTVNVSTLRDIKEEFLDMPCKAICCRLAF 510          
BLAST of tud-1 vs. TrEMBL
Match: gnl|BL_ORD_ID|20316914 (tr|V5W3W8|V5W3W8_SCHMD Tud-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1488.78 bits (3853), Expect = 0.000e+0
Identity = 769/770 (99.87%), Postives = 770/770 (100.00%), Query Frame = 1
Query:   10 MEATCDVFLTNLPKSINEVVVKNLFSSAGKVLKVKIIDDKRNENQKLCFVGFRTMDEALEAVRIADKSDAFGDPIRASISKKCLDGMEXXXXXXXXXXXXXXYKGTDSFSRKSDSNFKDSEKYPTNNGDFAQVNRLNNVGRGRGIQTKIISGPPSFKTNEIKLNDIKLKTKELIDIEIVDLSRVDIILIRPVKSTENSKIEIADLLSQINSNKSNLMPVDCPKIGDFCLAKWTEDDCYYRAELLDILKDGSFKVTFVDEGTSGDIVTDLKHIPTGALQQYPKQFLKVSIGCSDAKELMSFILQESEGKVIKIYWLGEYCDSVPVVNLFLNEDEIVEKYTQINKVNIRKKFSQTFDDLPVHNLETNSHFSIAPSMYKNRNDFILQMKTFSVSLKQKKCPTVLPIPGDICIYEKRNANGESFLRCVILRRQLFSFDIELIDIGEKIMNVNIDHLYTVEDIHVKDAPCAITCDLDSSINIDGIKLPQDLIDGXXXXXXXXXXXXXXXXXXILPQKKAYEYAKVSYKDLIGKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLSLNIKKEAWSHAIELFNDLAGYTENDQGTFVMQVISVDGDSLVVDLISELKGSLTAILEKSGTCVKSNEPICNGGGPQVKLNGVSNDKSQSAILENLSEGELYKKFIELERRLSALEILMK 2319
            MEATCDVFLTNLPKSINEVVVKNLFSSAGKVLKVKIIDDKRNENQKLCFVGFRTMDEALEAVRIADKSDAFGDPIRASISKKCLDGMENNQNRSNNNRNDSSYKGTDSFSRKSDSNFKDSEKYPTNNGDFAQVNRLNNVGRGRGIQTKIISGPPSFKTNEIKLNDIKLKTKELIDIEIVDLSRVDIILIRPVKSTENSKIEIADLLSQINSNKSNLMPVDCPKIGDFCLAKWTEDDCYYRAELLDILKDGSFKVTFVDEGTSGDIVTDLKHIPTGALQQYPKQFLKVSIGCSDAKELMSFILQESEGKVIKIYWLGEYCDSVPVVNLFLNEDEIVEKYTQINKVNIRKKFSQTFDDLPVHNLETNSHFSIAPSMYKNRNDFILQMKTFS+SLKQKKCPTVLPIPGDICIYEKRNANGESFLRCVILRRQLFSFDIELIDIGEKIMNVNIDHLYTVEDIHVKDAPCAITCDLDSSINIDGIKLPQDLIDGVLFNLKKYNKNNKYTVNFILPQKKAYEYAKVSYKDLIGKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLSLNIKKEAWSHAIELFNDLAGYTENDQGTFVMQVISVDGDSLVVDLISELKGSLTAILEKSGTCVKSNEPICNGGGPQVKLNGVSNDKSQSAILENLSEGELYKKFIELERRLSALEILMK
Sbjct:    1 MEATCDVFLTNLPKSINEVVVKNLFSSAGKVLKVKIIDDKRNENQKLCFVGFRTMDEALEAVRIADKSDAFGDPIRASISKKCLDGMENNQNRSNNNRNDSSYKGTDSFSRKSDSNFKDSEKYPTNNGDFAQVNRLNNVGRGRGIQTKIISGPPSFKTNEIKLNDIKLKTKELIDIEIVDLSRVDIILIRPVKSTENSKIEIADLLSQINSNKSNLMPVDCPKIGDFCLAKWTEDDCYYRAELLDILKDGSFKVTFVDEGTSGDIVTDLKHIPTGALQQYPKQFLKVSIGCSDAKELMSFILQESEGKVIKIYWLGEYCDSVPVVNLFLNEDEIVEKYTQINKVNIRKKFSQTFDDLPVHNLETNSHFSIAPSMYKNRNDFILQMKTFSISLKQKKCPTVLPIPGDICIYEKRNANGESFLRCVILRRQLFSFDIELIDIGEKIMNVNIDHLYTVEDIHVKDAPCAITCDLDSSINIDGIKLPQDLIDGVLFNLKKYNKNNKYTVNFILPQKKAYEYAKVSYKDLIGKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLSLNIKKEAWSHAIELFNDLAGYTENDQGTFVMQVISVDGDSLVVDLISELKGSLTAILEKSGTCVKSNEPICNGGGPQVKLNGVSNDKSQSAILENLSEGELYKKFIELERRLSALEILMK 770          
BLAST of tud-1 vs. TrEMBL
Match: gnl|BL_ORD_ID|20912539 (tr|C0L3L0|C0L3L0_SCHPL Tudor domain containing 1 OS=Schmidtea polychroa OX=50054 GN=oltud-1 PE=2 SV=1)

HSP 1 Score: 1339.32 bits (3465), Expect = 0.000e+0
Identity = 680/770 (88.31%), Postives = 727/770 (94.42%), Query Frame = 1
Query:   10 MEATCDVFLTNLPKSINEVVVKNLFSSAGKVLKVKIIDDKRNENQKLCFVGFRTMDEALEAVRIADKSDAFGDPIRASISKKCLDGMEXXXXXXXXXXXXXXYKGTDSFSRKSDSNFKDSEKYPTNNGDFAQVNRLNNVGRGRGIQTKIISGPPSFKTNEIKLNDIKLKTKELIDIEIVDLSRVDIILIRPVKSTENSKIEIADLLSQINSNKSNLMPVDCPKIGDFCLAKWTEDDCYYRAELLDILKDGSFKVTFVDEGTSGDIVTDLKHIPTGALQQYPKQFLKVSIGCSDAKELMSFILQESEGKVIKIYWLGEYCDSVPVVNLFLNEDEIVEKYTQINKVNIRKKFSQTFDDLPVHNLETNSHFSIAPSMYKNRNDFILQMKTFSVSLKQKKCPTVLPIPGDICIYEKRNANGESFLRCVILRRQLFSFDIELIDIGEKIMNVNIDHLYTVEDIHVKDAPCAITCDLDSSINIDGIKLPQDLIDGXXXXXXXXXXXXXXXXXXILPQKKAYEYAKVSYKDLIGKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLSLNIKKEAWSHAIELFNDLAGYTENDQGTFVMQVISVDGDSLVVDLISELKGSLTAILEKSGTCVKSNEPICNGGGPQVKLNGVSNDKSQSAILENLSEGELYKKFIELERRLSALEILMK 2319
            M+ATCDVFLTNLPKSI+EVVVKNLFSSAGKVLKVKIIDDKRNENQKLCFVGFRTMDEALEAVRIAD+SDAFGDPIRASISKKCLDGMENNQNRSNN RNDSS+KG+DSFSRKS+SNFKDSEKYP+NNGDFAQVNRLNNVGRGRGIQ KIISGPPSFKTNEIKLNDIKLKTKEL+DIEIVDLSRVD+ILIRPVK TENSKIEIADLLSQINSN+SNL+PVDCPK+GDF LAKWTEDDCYYRAELLDILK+GSFKVTFVDEGTSGDIVTDLKHIPTGALQQYPKQFLKVSIGCSD KELMSFI+ ESEGKVIKIYWLGEYCDS+PVVNLFLNEDEIVEKY QINK+NIRKK S TFDDLPVHNLET+SHFS  PSMYKN N+FILQMK  S+SL  KKCPTVLPIPGDICIYEKRN+ GESFLR VILRRQLFSFDIELIDIGEKIMNVNID+LYT E+ H+K+APCAITCDLD+S+N+DG +L Q LIDGV+FNLKKY +NNKYTV+F LP+KK YEYAKVSYKD IGKSFKVIMSHVVSPINFFIQLDDG++QLALGDIQEKLNINY+GS FKS  DV  TQAVIAPFIVSG+DAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLN NEEL++KPGFAIHCKLSLNI+KEAWSHA ELF+DLAGY+ENDQG FVMQVI VDGD+LVVDLISE+KGSLTAILEKSGTCVK NEP CNGG P VKLNGV NDKSQ+AILENLSEGELYKK +ELERRL+ALEI +K
Sbjct:    1 MDATCDVFLTNLPKSISEVVVKNLFSSAGKVLKVKIIDDKRNENQKLCFVGFRTMDEALEAVRIADRSDAFGDPIRASISKKCLDGMENNQNRSNNTRNDSSFKGSDSFSRKSESNFKDSEKYPSNNGDFAQVNRLNNVGRGRGIQNKIISGPPSFKTNEIKLNDIKLKTKELVDIEIVDLSRVDLILIRPVKPTENSKIEIADLLSQINSNQSNLVPVDCPKVGDFYLAKWTEDDCYYRAELLDILKEGSFKVTFVDEGTSGDIVTDLKHIPTGALQQYPKQFLKVSIGCSDVKELMSFIIHESEGKVIKIYWLGEYCDSIPVVNLFLNEDEIVEKYAQINKINIRKKLSHTFDDLPVHNLETSSHFSFVPSMYKNENEFILQMKNSSISLSHKKCPTVLPIPGDICIYEKRNSTGESFLRSVILRRQLFSFDIELIDIGEKIMNVNIDNLYTAEESHLKNAPCAITCDLDNSVNLDGDRLLQVLIDGVIFNLKKYKRNNKYTVSFNLPEKKVYEYAKVSYKDFIGKSFKVIMSHVVSPINFFIQLDDGDNQLALGDIQEKLNINYSGSAFKSVGDVNITQAVIAPFIVSGTDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNVNEELITKPGFAIHCKLSLNIRKEAWSHANELFSDLAGYSENDQGAFVMQVIGVDGDTLVVDLISEMKGSLTAILEKSGTCVKLNEPTCNGGSPAVKLNGVINDKSQTAILENLSEGELYKKVLELERRLNALEISLK 770          
BLAST of tud-1 vs. TrEMBL
Match: gnl|BL_ORD_ID|19612186 (tr|A4V6J8|A4V6J8_DUGJA Tudor protein (Fragment) OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 336.265 bits (861), Expect = 1.195e-105
Identity = 165/247 (66.80%), Postives = 203/247 (82.19%), Query Frame = 1
Query: 1534 LPQKKAYEYAKVSYKDLIGKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLSLNIKKEAWSHAIELFNDLAGYTENDQGTFVMQVISVDGDSLVVDLISELKGSLTAILEKSGTCV-KSNEPICNGGGPQVKLNGVSNDKSQSAILENLSEGELYKK 2271
            LP+KK YEY+KVS ++ +GKS KV +SH +SPINF+IQ D+ E  LALGDIQEKLN+NYNGS FK+   +K  QAV+APFIVSGSD+ELFRA VLEKRKESPQ+HVLFIDYGNDEWVN+ETL N + +LV K GFA HC+L+LNIKKEAWS+A E+F+DL GYTEN+QG FVM+VI +DG+ LVVDLIS +KGSLTAILEKSGTCV K +EP+CNG     KLNG+SN+ + ++  EN +E  + K+
Sbjct:   31 LPEKKIYEYSKVSNEEYVGKSSKVTVSHFISPINFYIQFDEAESALALGDIQEKLNLNYNGSHFKNIDGLKINQAVVAPFIVSGSDSELFRAKVLEKRKESPQVHVLFIDYGNDEWVNFETLQNVDSDLVKKSGFAYHCQLNLNIKKEAWSNANEIFSDLIGYTENEQGGFVMEVIRLDGEKLVVDLISPMKGSLTAILEKSGTCVSKLSEPLCNGDNRISKLNGISNEHNSNSNYENYTEQGIIKE 277          
BLAST of tud-1 vs. TrEMBL
Match: gnl|BL_ORD_ID|23529849 (tr|A0A210R536|A0A210R536_MIZYE Tudor domain-containing protein 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT16867 PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 2.499e-7
Identity = 49/176 (27.84%), Postives = 84/176 (47.73%), Query Frame = 1
Query: 1585 IGKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSAS----DVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLS-LNIKKEAWSHAIELFNDLAGYTENDQGTFVMQVISVDGDSLVVDLI 2097
            IG   +V +S V+ P N +IQ  + E+  AL  + +++   Y+ +    AS    DV   Q  +        D   +RA V + R+ S  + V ++DYGN E V    L    + + + P  A+ C L+ ++ KKE W  A+++   L   T      ++++  S  GD  VVD++
Sbjct:  575 IGSDIQVWVSEVIDPHNIWIQQPNEENIQALTLLMDEMKTIYDQTSEHVASPVVGDVYSAQFSL--------DGNWYRAKV-DGRQGSDMVTVTYLDYGNTETVAITKLRQLQDSMTTLPALAVKCSLADVSPKKEGWGEAVDVLLSLIPPTMASGVAYMIKARSGQGDCYVVDML 741          
BLAST of tud-1 vs. TrEMBL
Match: gnl|BL_ORD_ID|17227241 (tr|A0A3S1B5G2|A0A3S1B5G2_ELYCH Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_011904 PE=4 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 1.005e-6
Identity = 51/177 (28.81%), Postives = 90/177 (50.85%), Query Frame = 1
Query: 1585 IGKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNI-NYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNT-NEELVSKPGFAIHCKLSLNIKKEAWSHAIELFNDLAGYTENDQGTFVMQ---VISVDGDSLVVDLIS 2100
            +G +    +S+V SP  F++QL D E  + LG++ +++++ N+  S  +S  + +  QA +A F     D + +R  +  K  ++   +VLF+DYGN+E V+Y+  L     E  + P  A  C L       AW+   E F +     +  Q TF+ Q    I+++G  +  +LIS
Sbjct:  807 VGSTVTAFVSYVTSPSKFYVQLADKE--IELGELMDEISVYNHQSSGQESLLNPQVNQACMALF---SEDNQWYRGII--KSLQASSCNVLFVDYGNEESVSYKDALKILPSEFTTLPALAYECSLE-GTDGAAWTKEAEEFFESIIMDQELQCTFLSQKSVKITINGKDIKNELIS 975          
BLAST of tud-1 vs. Ensembl Cavefish
Match: si:ch211-189e2.3 (tudor domain-containing protein 6-like [Source:NCBI gene;Acc:103027511])

HSP 1 Score: 54.299 bits (129), Expect = 6.544e-7
Identity = 39/124 (31.45%), Postives = 57/124 (45.97%), Query Frame = 1
Query: 1600 KVIMSHVVSPINFFIQLDDGEHQLA-----LGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKL 1956
            +V +SH++SP +FF+QL   E+ L      L  I   +N     + F   S VK          V   D   +RA +  K      IHV FID+GN+  V   ++    E+ +  P F+IHC L
Sbjct:  983 EVYISHIISPNSFFVQLAKDENGLVSLTEELNSISSSVNNQAQMNYFPHGSLVK---------AVFPDDNSWYRAVI--KETNGKDIHVEFIDFGNEATVPATSVRKLEEQFLQVPRFSIHCSL 1095          
BLAST of tud-1 vs. Ensembl Cavefish
Match: si:ch211-189e2.3 (tudor domain-containing protein 6-like [Source:NCBI gene;Acc:103027511])

HSP 1 Score: 54.299 bits (129), Expect = 6.544e-7
Identity = 39/124 (31.45%), Postives = 57/124 (45.97%), Query Frame = 1
Query: 1600 KVIMSHVVSPINFFIQLDDGEHQLA-----LGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKL 1956
            +V +SH++SP +FF+QL   E+ L      L  I   +N     + F   S VK          V   D   +RA +  K      IHV FID+GN+  V   ++    E+ +  P F+IHC L
Sbjct:  983 EVYISHIISPNSFFVQLAKDENGLVSLTEELNSISSSVNNQAQMNYFPHGSLVK---------AVFPDDNSWYRAVI--KETNGKDIHVEFIDFGNEATVPATSVRKLEEQFLQVPRFSIHCSL 1095          
BLAST of tud-1 vs. Ensembl Cavefish
Match: si:ch211-189e2.3 (tudor domain-containing protein 6-like [Source:NCBI gene;Acc:103027511])

HSP 1 Score: 53.9138 bits (128), Expect = 6.972e-7
Identity = 39/124 (31.45%), Postives = 57/124 (45.97%), Query Frame = 1
Query: 1600 KVIMSHVVSPINFFIQLDDGEHQLA-----LGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKL 1956
            +V +SH++SP +FF+QL   E+ L      L  I   +N     + F   S VK          V   D   +RA +  K      IHV FID+GN+  V   ++    E+ +  P F+IHC L
Sbjct:  969 EVYISHIISPNSFFVQLAKDENGLVSLTEELNSISSSVNNQAQMNYFPHGSLVKA---------VFPDDNSWYRAVI--KETNGKDIHVEFIDFGNEATVPATSVRKLEEQFLQVPRFSIHCSL 1081          
BLAST of tud-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009031.1 (pep scaffold:Pmarinus_7.0:GL480172:2151:16965:1 gene:ENSPMAG00000008166.1 transcript:ENSPMAT00000009031.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 1.299e-6
Identity = 40/147 (27.21%), Postives = 70/147 (47.62%), Query Frame = 1
Query: 1588 GKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLS-----LNIKKEAWS-HAIELFND 2010
            G +  V + HVV+P  F++QL   E Q   G  +E  + + +G   +  SD+K    + A +    +D   +RA V     + P   V FIDYGN + V  +++   +   +  P  +I C L+     ++++   W+  A ELF +
Sbjct: 1210 GATLNVFVLHVVTPSRFYVQLVSDE-QTIYGLAEELNDGSVSGGSLRP-SDLKLGDLICAKY---SADESWYRAVVRGFEPDDPLALVEFIDYGNTDRVGSDSMSELHPVFLRHPRQSIACSLAGVRPCVSVRGNKWTKEAAELFTE 1351          
BLAST of tud-1 vs. Ensembl Nematostella
Match: EDO26981 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAI9])

HSP 1 Score: 51.6026 bits (122), Expect = 9.626e-8
Identity = 30/87 (34.48%), Postives = 43/87 (49.43%), Query Frame = 1
Query:  673 PKIGDFCLAKWTEDDCYYRAELLDILKDGSFKVTFVDEGTSGDIVTDLKHIPTGALQQYPKQFLKVSIGCSDAKELMSFILQESEGK 933
            P  GDFCLAK++ DD +YRA++L      S  V ++D G S  ++ D    P     Q P Q L   +   D  E  S  +Q+ E +
Sbjct:   19 PAQGDFCLAKFSFDDTWYRAKVLHCDSSFSITVQYIDYGNSETLMLDRVMEPPSQFLQLPPQALPCYLPGLDWGEAASEWIQQIENR 105          
BLAST of tud-1 vs. Ensembl Nematostella
Match: EDO36108 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJJ0])

HSP 1 Score: 51.6026 bits (122), Expect = 1.548e-6
Identity = 40/151 (26.49%), Postives = 87/151 (57.62%), Query Frame = 1
Query:  556 RVDIILIRPVKSTENSKIEIADLLSQINSNK-SNLMPVDCPKIGDFCLAKWTEDDCYYRAELLDILKDGSFKVTFVDEGTSGDIVTDLKHIP-TGALQQYPKQFLKVSIG---CSDAKELMSFILQESEGKVIKIYWLGEYCDSVPVVNLF 993
            ++D I ++PV+S E+    +  L++ I  +K S ++P      G  CLAK+TED+ +YRA ++  ++D +F V +VD G +  +  D + +P + +  Q P Q ++ S+       ++++++ + +E + K +++  L +  +S+ +V L+
Sbjct: 1881 KIDEIWLQPVQSAEH----LESLMASIAESKPSGILPPTDRIEGKPCLAKFTEDNAWYRA-VITAVEDPTFHVRYVDFGNTECLPVD-RLVPISPSFLQLPTQAVRCSLHGFPADKSRQIVAQLNEELKDKTVEVEVLQQTSESI-LVKLY 2024          
BLAST of tud-1 vs. Ensembl Medaka
Match: amh (Oryzias latipes anti-Mullerian hormone (amh), mRNA. [Source:RefSeq mRNA;Acc:NM_001360941])

HSP 1 Score: 55.4546 bits (132), Expect = 2.809e-7
Identity = 41/126 (32.54%), Postives = 67/126 (53.17%), Query Frame = 1
Query: 1585 IGKSFKVIMSHVVSPINFFIQL-DDGEH-QLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKL 1956
            IG   +V +S++ SP +F+ QL  + +H QL +GD+Q     +Y  S F+  +   ET  V        S+   +RA V+ +R ++P + VLF+DYG+ E V+   L   + E ++  G A  C L
Sbjct:  697 IGSVLEVTVSYIESPNDFWCQLVQNMKHLQLLMGDLQ----YHYANSEFQHDA---ETSCVAQ----HPSNGMWYRALVV-RRHKTPHVDVLFVDYGHTETVSISALRKISPEFLTLDGQAFRCSL 810          
BLAST of tud-1 vs. Ensembl Medaka
Match: amh (Oryzias latipes anti-Mullerian hormone (amh), mRNA. [Source:RefSeq mRNA;Acc:NM_001360941])

HSP 1 Score: 55.4546 bits (132), Expect = 2.897e-7
Identity = 43/130 (33.08%), Postives = 70/130 (53.85%), Query Frame = 1
Query: 1585 IGKSFKVIMSHVVSPINFFIQL-DDGEH-QLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLSLNI 1968
            IG   +V +S++ SP +F+ QL  + +H QL +GD+Q     +Y  S F+  +   ET  V        S+   +RA V+ +R ++P + VLF+DYG+ E V+   L   + E ++  G A  C L LN+
Sbjct:  697 IGSVLEVTVSYIESPNDFWCQLVQNMKHLQLLMGDLQ----YHYANSEFQHDA---ETSCVAQ----HPSNGMWYRALVV-RRHKTPHVDVLFVDYGHTETVSISALRKISPEFLTLDGQAFRCSL-LNL 813          
BLAST of tud-1 vs. Planmine SMEST
Match: SMESG000029236.1 (SMESG000029236.1)

HSP 1 Score: 1382.08 bits (3576), Expect = 0.000e+0
Identity = 716/716 (100.00%), Postives = 716/716 (100.00%), Query Frame = 1
Query:  172 MDEALEAVRIADKSDAFGDPIRASISKKCLDGMEXXXXXXXXXXXXXXYKGTDSFSRKSDSNFKDSEKYPTNNGDFAQVNRLNNVGRGRGIQTKIISGPPSFKTNEIKLNDIKLKTKELIDIEIVDLSRVDIILIRPVKSTENSKIEIADLLSQINSNKSNLMPVDCPKIGDFCLAKWTEDDCYYRAELLDILKDGSFKVTFVDEGTSGDIVTDLKHIPTGALQQYPKQFLKVSIGCSDAKELMSFILQESEGKVIKIYWLGEYCDSVPVVNLFLNEDEIVEKYTQINKVNIRKKFSQTFDDLPVHNLETNSHFSIAPSMYKNRNDFILQMKTFSVSLKQKKCPTVLPIPGDICIYEKRNANGESFLRCVILRRQLFSFDIELIDIGEKIMNVNIDHLYTVEDIHVKDAPCAITCDLDSSINIDGIKLPQDLIDGXXXXXXXXXXXXXXXXXXILPQKKAYEYAKVSYKDLIGKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLSLNIKKEAWSHAIELFNDLAGYTENDQGTFVMQVISVDGDSLVVDLISELKGSLTAILEKSGTCVKSNEPICNGGGPQVKLNGVSNDKSQSAILENLSEGELYKKFIELERRLSALEILMK 2319
            MDEALEAVRIADKSDAFGDPIRASISKKCLDGMENNQNRSNNNRNDSSYKGTDSFSRKSDSNFKDSEKYPTNNGDFAQVNRLNNVGRGRGIQTKIISGPPSFKTNEIKLNDIKLKTKELIDIEIVDLSRVDIILIRPVKSTENSKIEIADLLSQINSNKSNLMPVDCPKIGDFCLAKWTEDDCYYRAELLDILKDGSFKVTFVDEGTSGDIVTDLKHIPTGALQQYPKQFLKVSIGCSDAKELMSFILQESEGKVIKIYWLGEYCDSVPVVNLFLNEDEIVEKYTQINKVNIRKKFSQTFDDLPVHNLETNSHFSIAPSMYKNRNDFILQMKTFSVSLKQKKCPTVLPIPGDICIYEKRNANGESFLRCVILRRQLFSFDIELIDIGEKIMNVNIDHLYTVEDIHVKDAPCAITCDLDSSINIDGIKLPQDLIDGVLFNLKKYNKNNKYTVNFILPQKKAYEYAKVSYKDLIGKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLSLNIKKEAWSHAIELFNDLAGYTENDQGTFVMQVISVDGDSLVVDLISELKGSLTAILEKSGTCVKSNEPICNGGGPQVKLNGVSNDKSQSAILENLSEGELYKKFIELERRLSALEILMK
Sbjct:    1 MDEALEAVRIADKSDAFGDPIRASISKKCLDGMENNQNRSNNNRNDSSYKGTDSFSRKSDSNFKDSEKYPTNNGDFAQVNRLNNVGRGRGIQTKIISGPPSFKTNEIKLNDIKLKTKELIDIEIVDLSRVDIILIRPVKSTENSKIEIADLLSQINSNKSNLMPVDCPKIGDFCLAKWTEDDCYYRAELLDILKDGSFKVTFVDEGTSGDIVTDLKHIPTGALQQYPKQFLKVSIGCSDAKELMSFILQESEGKVIKIYWLGEYCDSVPVVNLFLNEDEIVEKYTQINKVNIRKKFSQTFDDLPVHNLETNSHFSIAPSMYKNRNDFILQMKTFSVSLKQKKCPTVLPIPGDICIYEKRNANGESFLRCVILRRQLFSFDIELIDIGEKIMNVNIDHLYTVEDIHVKDAPCAITCDLDSSINIDGIKLPQDLIDGVLFNLKKYNKNNKYTVNFILPQKKAYEYAKVSYKDLIGKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLSLNIKKEAWSHAIELFNDLAGYTENDQGTFVMQVISVDGDSLVVDLISELKGSLTAILEKSGTCVKSNEPICNGGGPQVKLNGVSNDKSQSAILENLSEGELYKKFIELERRLSALEILMK 716          
BLAST of tud-1 vs. Planmine SMEST
Match: SMESG000029232.1 (SMESG000029232.1)

HSP 1 Score: 1382.08 bits (3576), Expect = 0.000e+0
Identity = 716/716 (100.00%), Postives = 716/716 (100.00%), Query Frame = 1
Query:  172 MDEALEAVRIADKSDAFGDPIRASISKKCLDGMEXXXXXXXXXXXXXXYKGTDSFSRKSDSNFKDSEKYPTNNGDFAQVNRLNNVGRGRGIQTKIISGPPSFKTNEIKLNDIKLKTKELIDIEIVDLSRVDIILIRPVKSTENSKIEIADLLSQINSNKSNLMPVDCPKIGDFCLAKWTEDDCYYRAELLDILKDGSFKVTFVDEGTSGDIVTDLKHIPTGALQQYPKQFLKVSIGCSDAKELMSFILQESEGKVIKIYWLGEYCDSVPVVNLFLNEDEIVEKYTQINKVNIRKKFSQTFDDLPVHNLETNSHFSIAPSMYKNRNDFILQMKTFSVSLKQKKCPTVLPIPGDICIYEKRNANGESFLRCVILRRQLFSFDIELIDIGEKIMNVNIDHLYTVEDIHVKDAPCAITCDLDSSINIDGIKLPQDLIDGXXXXXXXXXXXXXXXXXXILPQKKAYEYAKVSYKDLIGKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLSLNIKKEAWSHAIELFNDLAGYTENDQGTFVMQVISVDGDSLVVDLISELKGSLTAILEKSGTCVKSNEPICNGGGPQVKLNGVSNDKSQSAILENLSEGELYKKFIELERRLSALEILMK 2319
            MDEALEAVRIADKSDAFGDPIRASISKKCLDGMENNQNRSNNNRNDSSYKGTDSFSRKSDSNFKDSEKYPTNNGDFAQVNRLNNVGRGRGIQTKIISGPPSFKTNEIKLNDIKLKTKELIDIEIVDLSRVDIILIRPVKSTENSKIEIADLLSQINSNKSNLMPVDCPKIGDFCLAKWTEDDCYYRAELLDILKDGSFKVTFVDEGTSGDIVTDLKHIPTGALQQYPKQFLKVSIGCSDAKELMSFILQESEGKVIKIYWLGEYCDSVPVVNLFLNEDEIVEKYTQINKVNIRKKFSQTFDDLPVHNLETNSHFSIAPSMYKNRNDFILQMKTFSVSLKQKKCPTVLPIPGDICIYEKRNANGESFLRCVILRRQLFSFDIELIDIGEKIMNVNIDHLYTVEDIHVKDAPCAITCDLDSSINIDGIKLPQDLIDGVLFNLKKYNKNNKYTVNFILPQKKAYEYAKVSYKDLIGKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLSLNIKKEAWSHAIELFNDLAGYTENDQGTFVMQVISVDGDSLVVDLISELKGSLTAILEKSGTCVKSNEPICNGGGPQVKLNGVSNDKSQSAILENLSEGELYKKFIELERRLSALEILMK
Sbjct:    1 MDEALEAVRIADKSDAFGDPIRASISKKCLDGMENNQNRSNNNRNDSSYKGTDSFSRKSDSNFKDSEKYPTNNGDFAQVNRLNNVGRGRGIQTKIISGPPSFKTNEIKLNDIKLKTKELIDIEIVDLSRVDIILIRPVKSTENSKIEIADLLSQINSNKSNLMPVDCPKIGDFCLAKWTEDDCYYRAELLDILKDGSFKVTFVDEGTSGDIVTDLKHIPTGALQQYPKQFLKVSIGCSDAKELMSFILQESEGKVIKIYWLGEYCDSVPVVNLFLNEDEIVEKYTQINKVNIRKKFSQTFDDLPVHNLETNSHFSIAPSMYKNRNDFILQMKTFSVSLKQKKCPTVLPIPGDICIYEKRNANGESFLRCVILRRQLFSFDIELIDIGEKIMNVNIDHLYTVEDIHVKDAPCAITCDLDSSINIDGIKLPQDLIDGVLFNLKKYNKNNKYTVNFILPQKKAYEYAKVSYKDLIGKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLSLNIKKEAWSHAIELFNDLAGYTENDQGTFVMQVISVDGDSLVVDLISELKGSLTAILEKSGTCVKSNEPICNGGGPQVKLNGVSNDKSQSAILENLSEGELYKKFIELERRLSALEILMK 716          
BLAST of tud-1 vs. Planmine SMEST
Match: SMESG000043684.1 (SMESG000043684.1)

HSP 1 Score: 256.529 bits (654), Expect = 2.070e-74
Identity = 210/708 (29.66%), Postives = 342/708 (48.31%), Query Frame = 1
Query:   28 VFLTNLPKSINEVVVKNLFSSAGKVLKVKIIDDKRNENQKLCFVGFRTMDEALEAVRIADKSDAFGDPIRASISKKCLDGMEXXXXXXXXXXXXXXYKGTDSFSRKSDSNFKDSEKYPTNNGDFAQVNRLNNVGRGRGIQTKIISGPPSFKTNEIKLNDIKLKTKELIDIEIVDLSRVDIILIRPVKSTENSKIEIADLLSQINSNKSNLMPVDCPKIGDFCLAKWTEDDCYYRAELLDILKDGSFKVTFVDEGTSGDIVTDLKHIPTGALQQYPKQFLKVSIGCSDAKELMSFILQESEGKVIKIYWL-GEYCDSVPVVNLFLNEDEIVEKYTQINKVNIRKKFSQTFDDLPVHNLETNSHFS---IAPSMYKNRNDF-ILQMKTFSVSLKQKKCPTVLPIPGDICIYEKRNANGESFL-RCVILRRQL----FSFDIELIDIGEKIMNVNIDHLYTVEDIHVKDAPCAITCDLDSSINIDGIKLPQDLIDGXXXXXXXXXXXXXXXXXXILPQKKAYEYAKVSYK------DLIGKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLSLNIKKEAWSHAIELFNDLAGYTENDQGTFVMQVISVDGDSLVVDLISE 2103
            + +TN+  ++++ +++N F   G++L   I  DK N + K+C++ + +++EA +A+ + DKS   G+P+R S  K                      + TD      +SN                V R+ + GRGRG+  +     P    + I L+ I +     I +EI++L+ V  IL RP+  TE+SK ++ D+L  +N N  +L  V  P+I  F +AKWT+D+ +YRA+LL+   +  +KV FVDEGTSGDIV +LK IP   +   P QFL   + C  ++EL + I+       + IY   GE  D    +NLFLN+ ++++ Y   ++ N   + ++  ++  +   + NS FS   +     ++R+ F I+ +  F ++ K +      PI GD+ IY +     ES+L RCV+   +       + I L+D    I   + D L+      ++  P  I C +D  +N D + LP + ++             K  +  I  +K  Y  + V  K       LIG+   VI+SHV S   F+++  D      L  IQ+ +N NY  S F S  ++ + + VIAPF+      E FRA + E   E   I+V FIDYGN EWV    L+     + + P  A  C+L + I+ E  S  ++L   L  Y EN Q    ++V+S       VDL +E
Sbjct:    5 ILITNINTTVDDRLLRNTFEKIGRILYFNICMDKFNPSTKICYINYSSVEEAHKAIELYDKSIDLGEPLRISFKK--------------------ITQVTDKGLMNGNSN--------------KSVTRMQSFGRGRGMINEC-GRVPRLTQSCIVLSYINIPLNTKIRVEIIELNDVSSILARPLILTEDSKPQLTDILDVVNDNVHSLADVRVPEINCFYMAKWTDDNKFYRAKLLEKSGNNQYKVCFVDEGTSGDIVRELKEIPR-EVADIPSQFLPCDMQCEPSEELNNLIISNGNNSQVNIYVTNGELIDGKYRINLFLNDIDVIKLYK--DEYNRDPRINKIPNECDLKKYKINSEFSDFQLINYPKEHRDIFEIVLIDPFRINPKMEPLSGS-PIKGDVLIYRQ----SESYLHRCVVESTRFVNTTLHYTIRLVDENRSIETAS-DSLFQTNFQCLETPPRIIRCVMD--LNCDRL-LPGEEVE-------------KIKIVDIDQKKNLYAISVVKAKPIKPIQKLIGQRISVILSHVESSEEFYVRFSDDNTSENLNCIQDIINSNYPLSSFSSTRELSKNEIVIAPFM-----EENFRATIKEINSEKSLIYVFFIDYGNYEWVKLVDLVRLKGNISALPAVAKKCRLPVEIQSEKNSEVVQL---LMEYCENGQVPVTVEVVSDSNGIFTVDLFAE 644          
BLAST of tud-1 vs. Planmine SMEST
Match: SMESG000081435.1 (SMESG000081435.1)

HSP 1 Score: 59.3066 bits (142), Expect = 1.310e-10
Identity = 29/57 (50.88%), Postives = 39/57 (68.42%), Query Frame = 1
Query:  694 LAKWTEDDCYYRAELLDILKDGSFKVTFVDEGTSGDIVTDLKHIPTGALQQYPKQFL 864
            +AKW +D+ +YRA+ L+   +  +KV FVDE TSG+IV +LK IP G L   P QFL
Sbjct:    1 MAKWIDDNKFYRAKHLEKSVNNQYKVCFVDERTSGEIVRELKEIPKGVL-DVPSQFL 56          
BLAST of tud-1 vs. Planmine SMEST
Match: SMESG000062403.1 (SMESG000062403.1)

HSP 1 Score: 50.0618 bits (118), Expect = 7.340e-6
Identity = 32/97 (32.99%), Postives = 49/97 (50.52%), Query Frame = 1
Query:  595 ENSKIEIADLLSQINSNKSNLMPVDCPKIGDFCLAKWTEDDCYYRAELLDILKDGSFKVTFVDEGTSG-DIVTDLKHIPTGALQQYPKQFLKVSIGC 882
            EN  I I   L       S++     PK GD C AK+T D C+YRA+++ I    +  + +VD G    +  + L  +P+G LQ+ P Q  + S+ C
Sbjct:  721 ENVIINITKELQSYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAINLLYVDFGNEEINEESSLASLPSG-LQKIPYQATEYSLAC 816          
The following BLAST results are available for this feature:
BLAST of tud-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tud-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tud-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tud-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tdrd61.469e-629.69tudor domain containing 6 [Source:ZFIN;Acc:ZDB-GEN... [more]
tdrd61.469e-629.69tudor domain containing 6 [Source:ZFIN;Acc:ZDB-GEN... [more]
si:ch211-189e2.35.355e-626.24si:ch211-189e2.3 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
si:ch211-189e2.35.793e-626.24si:ch211-189e2.3 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
si:ch211-189e2.36.045e-626.24si:ch211-189e2.3 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
back to top
BLAST of tud-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000011761.12.937e-731.75ring finger protein 17 [Source:NCBI gene;Acc:10049... [more]
back to top
BLAST of tud-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tud-1 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tud-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203169140.000e+099.87tr|V5W3W8|V5W3W8_SCHMD Tud-1 OS=Schmidtea mediterr... [more]
gnl|BL_ORD_ID|209125390.000e+088.31tr|C0L3L0|C0L3L0_SCHPL Tudor domain containing 1 O... [more]
gnl|BL_ORD_ID|196121861.195e-10566.80tr|A4V6J8|A4V6J8_DUGJA Tudor protein (Fragment) OS... [more]
gnl|BL_ORD_ID|235298492.499e-727.84tr|A0A210R536|A0A210R536_MIZYE Tudor domain-contai... [more]
gnl|BL_ORD_ID|172272411.005e-628.81tr|A0A3S1B5G2|A0A3S1B5G2_ELYCH Uncharacterized pro... [more]
back to top
BLAST of tud-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:ch211-189e2.36.544e-731.45tudor domain-containing protein 6-like [Source:NCB... [more]
si:ch211-189e2.36.544e-731.45tudor domain-containing protein 6-like [Source:NCB... [more]
si:ch211-189e2.36.972e-731.45tudor domain-containing protein 6-like [Source:NCB... [more]
back to top
BLAST of tud-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000009031.11.299e-627.21pep scaffold:Pmarinus_7.0:GL480172:2151:16965:1 ge... [more]
back to top
BLAST of tud-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tud-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO269819.626e-834.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361081.548e-626.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of tud-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
amh2.809e-732.54Oryzias latipes anti-Mullerian hormone (amh), mRNA... [more]
amh2.897e-733.08Oryzias latipes anti-Mullerian hormone (amh), mRNA... [more]
back to top
BLAST of tud-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029236.10.000e+0100.00SMESG000029236.1[more]
SMESG000029232.10.000e+0100.00SMESG000029232.1[more]
SMESG000043684.12.070e-7429.66SMESG000043684.1[more]
SMESG000081435.11.310e-1050.88SMESG000081435.1[more]
SMESG000062403.17.340e-632.99SMESG000062403.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30013909
GenBankAHC00376.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013909 ID=SMED30013909|Name=tud-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2414bp
ATTTAGAAAATGGAGGCAACTTGCGATGTTTTTTTAACGAATTTACCTAA
GTCGATTAATGAAGTAGTTGTGAAGAACTTATTTTCTTCTGCTGGGAAAG
TGTTAAAAGTGAAAATAATAGATGACAAAAGAAACGAAAATCAGAAGCTA
TGCTTCGTTGGATTTCGAACTATGGATGAAGCATTAGAAGCCGTCAGAAT
TGCAGATAAATCTGATGCGTTTGGTGATCCAATTAGAGCCAGTATATCAA
AGAAGTGTTTAGACGGAATGGAGAATAATCAAAATAGATCAAATAATAAC
AGAAATGATTCAAGTTATAAAGGAACTGATTCATTTTCAAGAAAGAGTGA
TTCTAATTTCAAGGATAGTGAAAAGTATCCAACAAACAATGGTGACTTTG
CACAAGTAAATCGTTTAAACAACGTTGGAAGAGGAAGAGGAATCCAGACT
AAAATTATTAGTGGTCCACCTTCATTCAAAACTAATGAAATTAAGTTAAA
CGATATTAAACTTAAAACAAAAGAACTGATTGACATCGAAATCGTCGATT
TAAGTAGAGTTGACATTATACTTATAAGGCCAGTAAAGTCAACGGAAAAT
TCAAAAATTGAAATAGCAGATTTATTGTCACAAATAAATTCAAATAAATC
GAATCTAATGCCAGTTGACTGTCCTAAAATAGGAGATTTTTGTCTTGCAA
AATGGACTGAAGATGATTGCTATTATCGGGCTGAATTGTTAGATATATTA
AAGGATGGATCTTTCAAAGTTACTTTTGTTGATGAAGGAACTTCGGGTGA
TATTGTGACTGATTTGAAACACATTCCGACTGGTGCTTTACAGCAGTATC
CTAAACAATTTTTGAAGGTTTCAATCGGTTGCTCAGACGCAAAAGAATTA
ATGTCATTTATTTTACAAGAGTCTGAAGGAAAGGTGATTAAAATTTATTG
GCTCGGAGAATATTGTGATTCCGTGCCTGTTGTAAATTTATTTCTGAATG
AAGATGAAATTGTGGAAAAATATACCCAAATAAATAAAGTAAATATCAGG
AAAAAATTCTCACAGACATTTGATGATCTCCCAGTACATAACCTCGAAAC
TAATTCACATTTTTCAATAGCACCATCAATGTATAAAAACCGAAATGATT
TTATTCTTCAGATGAAAACTTTCTCGGTATCTTTAAAGCAAAAAAAATGT
CCTACGGTTTTACCAATTCCTGGTGATATATGTATATATGAGAAAAGGAA
TGCTAATGGCGAATCATTTCTTCGTTGTGTTATATTAAGGCGCCAACTTT
TTTCTTTTGACATCGAGTTAATAGATATCGGTGAAAAAATAATGAATGTT
AATATTGATCACCTGTACACAGTCGAAGATATTCATGTAAAAGACGCTCC
CTGTGCTATTACTTGCGATTTAGATAGTTCTATTAATATAGATGGTATTA
AGCTCCCTCAAGATTTGATCGATGGTGTTCTCTTTAATCTTAAAAAGTAC
AACAAAAATAATAAATACACTGTAAATTTCATTTTACCACAAAAGAAAGC
TTATGAATATGCAAAAGTATCATATAAAGATTTGATTGGTAAAAGCTTTA
AAGTAATAATGTCGCACGTTGTCTCTCCCATTAATTTCTTTATTCAACTT
GATGATGGAGAGCATCAGCTTGCACTTGGAGATATTCAAGAAAAATTAAA
TATTAATTATAATGGATCACCATTCAAAAGTGCTAGCGATGTTAAAGAAA
CTCAGGCAGTTATTGCTCCTTTTATTGTTTCCGGAAGTGATGCGGAACTT
TTTCGGGCTTATGTTTTAGAGAAACGAAAGGAATCTCCACAAATTCATGT
ATTGTTTATTGATTATGGTAATGATGAATGGGTGAATTATGAAACTTTAC
TGAATACAAATGAAGAATTAGTTTCTAAACCAGGTTTCGCAATACATTGT
AAATTATCTCTAAATATTAAGAAGGAAGCGTGGAGTCACGCTATTGAATT
ATTTAATGATTTAGCTGGTTATACTGAAAATGACCAGGGGACGTTTGTAA
TGCAGGTTATTAGTGTCGATGGTGATTCGTTAGTTGTGGACTTGATTTCA
GAACTGAAAGGTTCGTTGACGGCCATCTTAGAAAAAAGTGGTACATGTGT
AAAGTCCAATGAACCAATATGTAATGGAGGAGGACCCCAAGTTAAATTAA
ATGGCGTTTCAAATGATAAATCTCAATCAGCTATTCTTGAAAATTTATCT
GAAGGAGAATTATATAAAAAATTTATTGAACTAGAACGGAGATTAAGTGC
TTTAGAGATATTGATGAAATAATGCTACCCGCGCAATTAGTATTATCAAA
TTATGATAATCTAGTCTTGATGTGTTTAAAATTTTGTATTTTAACATAAA
TTTATTCCGTGTTG
back to top

protein sequence of SMED30013909-orf-1

>SMED30013909-orf-1 ID=SMED30013909-orf-1|Name=SMED30013909-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=771bp
MEATCDVFLTNLPKSINEVVVKNLFSSAGKVLKVKIIDDKRNENQKLCFV
GFRTMDEALEAVRIADKSDAFGDPIRASISKKCLDGMENNQNRSNNNRND
SSYKGTDSFSRKSDSNFKDSEKYPTNNGDFAQVNRLNNVGRGRGIQTKII
SGPPSFKTNEIKLNDIKLKTKELIDIEIVDLSRVDIILIRPVKSTENSKI
EIADLLSQINSNKSNLMPVDCPKIGDFCLAKWTEDDCYYRAELLDILKDG
SFKVTFVDEGTSGDIVTDLKHIPTGALQQYPKQFLKVSIGCSDAKELMSF
ILQESEGKVIKIYWLGEYCDSVPVVNLFLNEDEIVEKYTQINKVNIRKKF
SQTFDDLPVHNLETNSHFSIAPSMYKNRNDFILQMKTFSVSLKQKKCPTV
LPIPGDICIYEKRNANGESFLRCVILRRQLFSFDIELIDIGEKIMNVNID
HLYTVEDIHVKDAPCAITCDLDSSINIDGIKLPQDLIDGVLFNLKKYNKN
NKYTVNFILPQKKAYEYAKVSYKDLIGKSFKVIMSHVVSPINFFIQLDDG
EHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRA
YVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLS
LNIKKEAWSHAIELFNDLAGYTENDQGTFVMQVISVDGDSLVVDLISELK
GSLTAILEKSGTCVKSNEPICNGGGPQVKLNGVSNDKSQSAILENLSEGE
LYKKFIELERRLSALEILMK*
back to top
Aliases
The feature 'tud-1' has the following synonyms
Synonym
tud-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
PLANA:0004517blastomere
PLANA:0000429neoblast
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000003Stage 3
PLANA:0000005Stage 5
PLANA:0000008Stage 8
PLANA:0000004Stage 4
PLANA:0000007Stage 7
PLANA:0000002Stage 2
PLANA:0000006Stage 6
Vocabulary: INTERPRO
TermDefinition
IPR035979RBD_domain_sf
IPR002999Tudor
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002999Tudor domainSMARTSM00333TUDOR_7coord: 576..638
e-value: 0.0035
score: 26.6
coord: 220..280
e-value: 3.4E-6
score: 36.6
IPR002999Tudor domainPFAMPF00567TUDORcoord: 527..650
e-value: 2.9E-14
score: 53.1
coord: 195..288
e-value: 8.8E-10
score: 38.7
IPR002999Tudor domainPROSITEPS50304TUDORcoord: 580..640
score: 10.744
IPR002999Tudor domainPROSITEPS50304TUDORcoord: 221..279
score: 11.51
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 6..78
e-value: 2.0E-9
score: 47.3
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 7..67
e-value: 5.1E-10
score: 39.0
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 5..82
score: 12.987
NoneNo IPR availableGENE3DG3DSA:2.40.50.790coord: 198..335
e-value: 4.6E-17
score: 64.4
NoneNo IPR availableGENE3DG3DSA:2.30.30.140coord: 199..280
e-value: 4.6E-17
score: 64.4
coord: 551..640
e-value: 1.3E-18
score: 69.4
NoneNo IPR availableGENE3DG3DSA:2.40.50.790coord: 537..697
e-value: 1.3E-18
score: 69.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 86..130
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 105..119
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 86..104
NoneNo IPR availablePANTHERPTHR22948TUDOR DOMAIN CONTAINING PROTEINcoord: 206..277
coord: 526..668
NoneNo IPR availableCDDcd00590RRM_SFcoord: 7..78
e-value: 2.43926E-12
score: 60.7817
NoneNo IPR availableCDDcd04508TUDORcoord: 225..271
e-value: 7.4415E-12
score: 58.3783
NoneNo IPR availableCDDcd04508TUDORcoord: 582..630
e-value: 0.00137329
score: 35.2664
NoneNo IPR availableSUPERFAMILYSSF63748Tudor/PWWP/MBTcoord: 557..650
NoneNo IPR availableSUPERFAMILYSSF63748Tudor/PWWP/MBTcoord: 208..288
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 1..82
e-value: 9.1E-13
score: 50.2
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 5..108