tud-1

Overview
Nametud-1 (AHC00376.1)
Smed IDSMED30013909
Uniprot Best hitTudor domain-containing protein 1 OS=Oryzias latipes GN=tdrd1 PE=2 SV=1 (E=7.38157e-05)
Length (bp)2414
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of tud-1 (SMED30013909) t-SNE clustered cells

Violin plots show distribution of expression levels for tud-1 (SMED30013909) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of tud-1 (SMED30013909) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for tud-1 (SMED30013909) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene tud-1.

SPIM reconstructed S4 embryo costained with piwi-1 (red) and tud-1 (green). piwi-1+ blastomeres co-express the nuage factor tud-1, and virtually all tud-1+ cells co-express piwi-1.

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene tud-1.

SPIM reconstructed S5 embryo costained with piwi-1 (red) and tud-1 (green). piwi-1+ blastomeres co-express the nuage factor tud-1, and virtually all tud-1+ cells co-express piwi-1.

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene tud-1.

SPIM reconstructed S3 embryo costained with piwi-1 (red) and tud-1 (green). piwi-1+ blastomeres co-express the nuage factor tud-1, and virtually all tud-1+ cells co-express piwi-1.

Homology
BLAST of tud-1 vs. Ensembl Zebrafish
Match: tdrd6 (tudor domain containing 6 [Source:ZFIN;Acc:ZDB-GENE-041001-210])

HSP 1 Score: 53.5286 bits (127), Expect = 8.395e-7
Identity = 38/128 (29.69%), Postives = 64/128 (50.00%), Query Frame = 1
Query: 1588 GKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLS-LNI 1968
            G   +V +SH  SP +FF+Q    E  +    + EKLN + +      +SD+ E   V A F     D+  +RA V +   E  +I V F+D+GN   ++ + + +  +   S P ++IHC +  LN+
Sbjct:  378 GLEAEVFISHCNSPCSFFVQFATDEDDIY--SLVEKLNADQSRCRNIDSSDIHEGDLVCAMF---PDDSSWYRAVVRKNTNE--KIDVEFVDFGNTAVISSKNVCHLGQSFASFPRYSIHCSVHKLNV 498          
BLAST of tud-1 vs. Ensembl Zebrafish
Match: tdrd6 (tudor domain containing 6 [Source:ZFIN;Acc:ZDB-GENE-041001-210])

HSP 1 Score: 53.1434 bits (126), Expect = 1.240e-6
Identity = 38/128 (29.69%), Postives = 64/128 (50.00%), Query Frame = 1
Query: 1588 GKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLS-LNI 1968
            G   +V +SH  SP +FF+Q    E  +    + EKLN + +      +SD+ E   V A F     D+  +RA V +   E  +I V F+D+GN   ++ + + +  +   S P ++IHC +  LN+
Sbjct: 1234 GLEAEVFISHCNSPCSFFVQFATDEDDIY--SLVEKLNADQSRCRNIDSSDIHEGDLVCAMF---PDDSSWYRAVVRKNTNE--KIDVEFVDFGNTAVISSKNVCHLGQSFASFPRYSIHCSVHKLNV 1354          
BLAST of tud-1 vs. Ensembl Zebrafish
Match: ENSDART00000154540.1 (pep:novel chromosome:GRCz10:17:6446863:6484305:-1 gene:ENSDARG00000089954.3 transcript:ENSDART00000154540.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 4.892e-6
Identity = 58/221 (26.24%), Postives = 99/221 (44.80%), Query Frame = 1
Query: 1540 QKKAYEYAKVSYKDL----IGKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLSLNIK--KEAWSH-AIELFNDLAGYTENDQGTFVMQVISVDGDSLVVDLISELKGSLT----AILEKSGTCVKSNEPI 2169
            Q++   Y K++   L    +G    V +SH  SP NFF+QL   E ++    + EKLN           + ++    V A +    +D   +RA V  K K++  + V FID+GN+  +    +   +++ +S P  +I C L    +  K  W+   I  F + AG  EN +     + I  D +  +V L  + +G  T    A  E    C+K+ +P+
Sbjct:  764 QQQVMAYPKLTELPLRTIDVGYVSDVYVSHCNSPSNFFVQLTTDEDEIF--SLIEKLNCTLISDLQVELNLLQSDDLVKAEY---PADGAYYRAVV--KSKKNGMVQVQFIDFGNEVTLLPTKIKQLDKQFLSTPRLSIQCMLEDGKRRGKRDWTQEEIMTFKEAAG--ENGEKKIQCKFIQEDANCWLVSLEHQ-EGWFTVKSDAQSESQVHCIKNTQPL 974          
BLAST of tud-1 vs. Ensembl Xenopus
Match: tdrd15 (tudor domain containing 15 [Source:Xenbase;Acc:XB-GENE-6462376])

HSP 1 Score: 49.6766 bits (117), Expect = 7.384e-6
Identity = 44/133 (33.08%), Postives = 67/133 (50.38%), Query Frame = 1
Query: 1609 MSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKL----SLNIKKEAWSHAI 1995
            +SH+ SP +F+IQL   E+  A+  + E+LN         SA D K+   V A +     D   +RA +LE  KE     V FIDYGN  +V+  +L    ++ +S P F+I   L    +L  ++E WS  +
Sbjct: 1218 ISHINSPSSFYIQLSKNEN--AIVHLAEELNKEPLSFQALSARDCKKGMLVAAEY---PDDLCFYRAEILE-MKEDKSFEVKFIDYGNTAYVS--SLFLLPDKFLSVPKFSIAASLFGIEALKTREE-WSRDV 1341          
BLAST of tud-1 vs. UniProt
Match: sp|A9CPT4|TDRD1_ORYLA (Tudor domain-containing protein 1 OS=Oryzias latipes GN=tdrd1 PE=2 SV=1)

HSP 1 Score: 50.447 bits (119), Expect = 7.382e-5
Identity = 40/136 (29.41%), Postives = 67/136 (49.26%), Query Frame = 1
Query: 1585 IGKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLS-LNIKKEAWSH 1989
            IG  F V++SH  SP +F +Q    E+   + D+Q KL  + +G   ++  D +     +     S  D + +RA VL    E   + V +ID+GN E V+   L   +  L++ P  AI C L+ +   +++WS 
Sbjct:  386 IGDRFSVVVSHFQSPTDFIVQ--KVENAGVIQDLQLKLREHCSG--VETQQDFRPAPGTVCCAQFS-EDKQWYRAQVLAYSTEK-SVCVGYIDFGNSEEVDLNHLRPISPALLALPKQAISCILAGVQPVEDSWSE 515          
BLAST of tud-1 vs. UniProt
Match: sp|Q9USY2|YOW4_SCHPO (Uncharacterized RNA-binding protein C1861.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1861.04c PE=3 SV=1)

HSP 1 Score: 48.1358 bits (113), Expect = 3.507e-4
Identity = 24/81 (29.63%), Postives = 45/81 (55.56%), Query Frame = 1
Query:    7 KMEATCDVFLTNLPKSINEVVVKNLFSSAGKVLKVKIIDDKRNENQKLCFVGFRTMDEALEAVRIADKSDAFGDPIRASIS 249
            ++    ++++TN P + +E+ +  LFS+ G V+ V+    + N N++ C+V  R  DEA  A+++  K      PI+  IS
Sbjct:  661 QIHVDTNLYVTNFPPTYDELDITKLFSAYGNVVDVRFPSLRYNTNRRFCYVQMRKPDEAHNALQLHKKLLEEKYPIQVFIS 741          
BLAST of tud-1 vs. UniProt
Match: sp|P25823|TUD_DROME (Maternal protein tudor OS=Drosophila melanogaster GN=tud PE=1 SV=2)

HSP 1 Score: 48.1358 bits (113), Expect = 4.067e-4
Identity = 46/166 (27.71%), Postives = 70/166 (42.17%), Query Frame = 1
Query: 1609 MSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSG--SDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLSLNIKKEAWSHAIEL-FNDLAGYTENDQGTFVMQVISVDGDSLVVDLI 2097
            +SHV    +FFIQL+     L L ++             +    +K  +      IV+    D EL+    L+K     +  VLFIDYGN    +   +L  +EE+ S P  +  C L L     +WS   E  F +L G  E     F  Q++    D + +DL+
Sbjct: 1801 ISHVNGICDFFIQLERDSKALELIELY-----------LRKKDTLKPLEGFEKGLIVAALFEDDELWYRAQLQKELPDSRYEVLFIDYGNTSTTSKCLML--SEEIASLPSLSKKCSLQLPDAYISWSPEAEAKFAELTGEGE---LVFTTQLLKPGQDHVTIDLL 1950          
BLAST of tud-1 vs. UniProt
Match: sp|Q6DJI9|ZCRB1_XENLA (Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Xenopus laevis GN=zcrb1 PE=2 SV=1)

HSP 1 Score: 46.2098 bits (108), Expect = 4.140e-4
Identity = 29/76 (38.16%), Postives = 43/76 (56.58%), Query Frame = 1
Query:   28 VFLTNLPKSINEVVVKNLFSSAGKVLKVKIIDDKRNENQK-LCFVGFRTMDEALEAVRIADKSDAFGDPIRASISK 252
            V+++NLP S+    +  +FS  GKV+KV I+ DK +   K + FV F   + A   VR  +    FG  I+ASI+K
Sbjct:   12 VYVSNLPFSLTNNDLHRIFSKYGKVVKVTILKDKDSRKSKGVSFVLFLDKESAQNCVRGLNNKQLFGRAIKASIAK 87          
BLAST of tud-1 vs. UniProt
Match: sp|Q9CZ96|ZCRB1_MOUSE (Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Mus musculus GN=Zcrb1 PE=1 SV=1)

HSP 1 Score: 45.8246 bits (107), Expect = 5.718e-4
Identity = 28/75 (37.33%), Postives = 41/75 (54.67%), Query Frame = 1
Query:   28 VFLTNLPKSINEVVVKNLFSSAGKVLKVKIIDDKRNENQK-LCFVGFRTMDEALEAVRIADKSDAFGDPIRASIS 249
            V+++NLP S+    +  +FS  GKV+KV I+ DK     K + F+ F   D AL   R  +    FG  I+ASI+
Sbjct:   12 VYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSALNCTRAINNKQLFGRVIKASIA 86          
BLAST of tud-1 vs. TrEMBL
Match: tr|V5W3W8|V5W3W8_SCHMD (Tud-1 OS=Schmidtea mediterranea PE=2 SV=1)

HSP 1 Score: 1491.48 bits (3860), Expect = 0.000e+0
Identity = 769/770 (99.87%), Postives = 770/770 (100.00%), Query Frame = 1
Query:   10 MEATCDVFLTNLPKSINEVVVKNLFSSAGKVLKVKIIDDKRNENQKLCFVGFRTMDEALEAVRIADKSDAFGDPIRASISKKCLDGMEXXXXXXXXXXXXXXYKGTDSFSRKSDSNFKDSEKYPTNNGDFAQVNRLNNVGRGRGIQTKIISGPPSFKTNEIKLNDIKLKTKELIDIEIVDLSRVDIILIRPVKSTENSKIEIADLLSQINSNKSNLMPVDCPKIGDFCLAKWTEDDCYYRAELLDILKDGSFKVTFVDEGTSGDIVTDLKHIPTGALQQYPKQFLKVSIGCSDAKELMSFILQESEGKVIKIYWLGEYCDSVPVVNLFLNEDEIVEKYTQINKVNIRKKFSQTFDDLPVHNLETNSHFSIAPSMYKNRNDFILQMKTFSVSLKQKKCPTVLPIPGDICIYEKRNANGESFLRCVILRRQLFSFDIELIDIGEKIMNVNIDHLYTVEDIHVKDAPCAITCDLDSSINIDGIKLPQDLIDGXXXXXXXXXXXXXXXXXXILPQKKAYEYAKVSYKDLIGKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLSLNIKKEAWSHAIELFNDLAGYTENDQGTFVMQVISVDGDSLVVDLISELKGSLTAILEKSGTCVKSNEPICNGGGPQVKLNGVSNDKSQSAILENLSEGELYKKFIELERRLSALEILMK 2319
            MEATCDVFLTNLPKSINEVVVKNLFSSAGKVLKVKIIDDKRNENQKLCFVGFRTMDEALEAVRIADKSDAFGDPIRASISKKCLDGMENNQNRSNNNRNDSSYKGTDSFSRKSDSNFKDSEKYPTNNGDFAQVNRLNNVGRGRGIQTKIISGPPSFKTNEIKLNDIKLKTKELIDIEIVDLSRVDIILIRPVKSTENSKIEIADLLSQINSNKSNLMPVDCPKIGDFCLAKWTEDDCYYRAELLDILKDGSFKVTFVDEGTSGDIVTDLKHIPTGALQQYPKQFLKVSIGCSDAKELMSFILQESEGKVIKIYWLGEYCDSVPVVNLFLNEDEIVEKYTQINKVNIRKKFSQTFDDLPVHNLETNSHFSIAPSMYKNRNDFILQMKTFS+SLKQKKCPTVLPIPGDICIYEKRNANGESFLRCVILRRQLFSFDIELIDIGEKIMNVNIDHLYTVEDIHVKDAPCAITCDLDSSINIDGIKLPQDLIDGVLFNLKKYNKNNKYTVNFILPQKKAYEYAKVSYKDLIGKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLSLNIKKEAWSHAIELFNDLAGYTENDQGTFVMQVISVDGDSLVVDLISELKGSLTAILEKSGTCVKSNEPICNGGGPQVKLNGVSNDKSQSAILENLSEGELYKKFIELERRLSALEILMK
Sbjct:    1 MEATCDVFLTNLPKSINEVVVKNLFSSAGKVLKVKIIDDKRNENQKLCFVGFRTMDEALEAVRIADKSDAFGDPIRASISKKCLDGMENNQNRSNNNRNDSSYKGTDSFSRKSDSNFKDSEKYPTNNGDFAQVNRLNNVGRGRGIQTKIISGPPSFKTNEIKLNDIKLKTKELIDIEIVDLSRVDIILIRPVKSTENSKIEIADLLSQINSNKSNLMPVDCPKIGDFCLAKWTEDDCYYRAELLDILKDGSFKVTFVDEGTSGDIVTDLKHIPTGALQQYPKQFLKVSIGCSDAKELMSFILQESEGKVIKIYWLGEYCDSVPVVNLFLNEDEIVEKYTQINKVNIRKKFSQTFDDLPVHNLETNSHFSIAPSMYKNRNDFILQMKTFSISLKQKKCPTVLPIPGDICIYEKRNANGESFLRCVILRRQLFSFDIELIDIGEKIMNVNIDHLYTVEDIHVKDAPCAITCDLDSSINIDGIKLPQDLIDGVLFNLKKYNKNNKYTVNFILPQKKAYEYAKVSYKDLIGKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLSLNIKKEAWSHAIELFNDLAGYTENDQGTFVMQVISVDGDSLVVDLISELKGSLTAILEKSGTCVKSNEPICNGGGPQVKLNGVSNDKSQSAILENLSEGELYKKFIELERRLSALEILMK 770          
BLAST of tud-1 vs. TrEMBL
Match: tr|C0L3L0|C0L3L0_SCHPL (Tudor domain containing 1 OS=Schmidtea polychroa GN=oltud-1 PE=2 SV=1)

HSP 1 Score: 1339.32 bits (3465), Expect = 0.000e+0
Identity = 680/770 (88.31%), Postives = 727/770 (94.42%), Query Frame = 1
Query:   10 MEATCDVFLTNLPKSINEVVVKNLFSSAGKVLKVKIIDDKRNENQKLCFVGFRTMDEALEAVRIADKSDAFGDPIRASISKKCLDGMEXXXXXXXXXXXXXXYKGTDSFSRKSDSNFKDSEKYPTNNGDFAQVNRLNNVGRGRGIQTKIISGPPSFKTNEIKLNDIKLKTKELIDIEIVDLSRVDIILIRPVKSTENSKIEIADLLSQINSNKSNLMPVDCPKIGDFCLAKWTEDDCYYRAELLDILKDGSFKVTFVDEGTSGDIVTDLKHIPTGALQQYPKQFLKVSIGCSDAKELMSFILQESEGKVIKIYWLGEYCDSVPVVNLFLNEDEIVEKYTQINKVNIRKKFSQTFDDLPVHNLETNSHFSIAPSMYKNRNDFILQMKTFSVSLKQKKCPTVLPIPGDICIYEKRNANGESFLRCVILRRQLFSFDIELIDIGEKIMNVNIDHLYTVEDIHVKDAPCAITCDLDSSINIDGIKLPQDLIDGXXXXXXXXXXXXXXXXXXILPQKKAYEYAKVSYKDLIGKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLSLNIKKEAWSHAIELFNDLAGYTENDQGTFVMQVISVDGDSLVVDLISELKGSLTAILEKSGTCVKSNEPICNGGGPQVKLNGVSNDKSQSAILENLSEGELYKKFIELERRLSALEILMK 2319
            M+ATCDVFLTNLPKSI+EVVVKNLFSSAGKVLKVKIIDDKRNENQKLCFVGFRTMDEALEAVRIAD+SDAFGDPIRASISKKCLDGMENNQNRSNN RNDSS+KG+DSFSRKS+SNFKDSEKYP+NNGDFAQVNRLNNVGRGRGIQ KIISGPPSFKTNEIKLNDIKLKTKEL+DIEIVDLSRVD+ILIRPVK TENSKIEIADLLSQINSN+SNL+PVDCPK+GDF LAKWTEDDCYYRAELLDILK+GSFKVTFVDEGTSGDIVTDLKHIPTGALQQYPKQFLKVSIGCSD KELMSFI+ ESEGKVIKIYWLGEYCDS+PVVNLFLNEDEIVEKY QINK+NIRKK S TFDDLPVHNLET+SHFS  PSMYKN N+FILQMK  S+SL  KKCPTVLPIPGDICIYEKRN+ GESFLR VILRRQLFSFDIELIDIGEKIMNVNID+LYT E+ H+K+APCAITCDLD+S+N+DG +L Q LIDGV+FNLKKY +NNKYTV+F LP+KK YEYAKVSYKD IGKSFKVIMSHVVSPINFFIQLDDG++QLALGDIQEKLNINY+GS FKS  DV  TQAVIAPFIVSG+DAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLN NEEL++KPGFAIHCKLSLNI+KEAWSHA ELF+DLAGY+ENDQG FVMQVI VDGD+LVVDLISE+KGSLTAILEKSGTCVK NEP CNGG P VKLNGV NDKSQ+AILENLSEGELYKK +ELERRL+ALEI +K
Sbjct:    1 MDATCDVFLTNLPKSISEVVVKNLFSSAGKVLKVKIIDDKRNENQKLCFVGFRTMDEALEAVRIADRSDAFGDPIRASISKKCLDGMENNQNRSNNTRNDSSFKGSDSFSRKSESNFKDSEKYPSNNGDFAQVNRLNNVGRGRGIQNKIISGPPSFKTNEIKLNDIKLKTKELVDIEIVDLSRVDLILIRPVKPTENSKIEIADLLSQINSNQSNLVPVDCPKVGDFYLAKWTEDDCYYRAELLDILKEGSFKVTFVDEGTSGDIVTDLKHIPTGALQQYPKQFLKVSIGCSDVKELMSFIIHESEGKVIKIYWLGEYCDSIPVVNLFLNEDEIVEKYAQINKINIRKKLSHTFDDLPVHNLETSSHFSFVPSMYKNENEFILQMKNSSISLSHKKCPTVLPIPGDICIYEKRNSTGESFLRSVILRRQLFSFDIELIDIGEKIMNVNIDNLYTAEESHLKNAPCAITCDLDNSVNLDGDRLLQVLIDGVIFNLKKYKRNNKYTVSFNLPEKKVYEYAKVSYKDFIGKSFKVIMSHVVSPINFFIQLDDGDNQLALGDIQEKLNINYSGSAFKSVGDVNITQAVIAPFIVSGTDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNVNEELITKPGFAIHCKLSLNIRKEAWSHANELFSDLAGYSENDQGAFVMQVIGVDGDTLVVDLISEMKGSLTAILEKSGTCVKLNEPTCNGGSPAVKLNGVINDKSQTAILENLSEGELYKKVLELERRLNALEISLK 770          
BLAST of tud-1 vs. TrEMBL
Match: tr|A4V6J8|A4V6J8_DUGJA (Tudor protein (Fragment) OS=Dugesia japonica PE=2 SV=1)

HSP 1 Score: 336.265 bits (861), Expect = 1.473e-104
Identity = 165/247 (66.80%), Postives = 203/247 (82.19%), Query Frame = 1
Query: 1534 LPQKKAYEYAKVSYKDLIGKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLSLNIKKEAWSHAIELFNDLAGYTENDQGTFVMQVISVDGDSLVVDLISELKGSLTAILEKSGTCV-KSNEPICNGGGPQVKLNGVSNDKSQSAILENLSEGELYKK 2271
            LP+KK YEY+KVS ++ +GKS KV +SH +SPINF+IQ D+ E  LALGDIQEKLN+NYNGS FK+   +K  QAV+APFIVSGSD+ELFRA VLEKRKESPQ+HVLFIDYGNDEWVN+ETL N + +LV K GFA HC+L+LNIKKEAWS+A E+F+DL GYTEN+QG FVM+VI +DG+ LVVDLIS +KGSLTAILEKSGTCV K +EP+CNG     KLNG+SN+ + ++  EN +E  + K+
Sbjct:   31 LPEKKIYEYSKVSNEEYVGKSSKVTVSHFISPINFYIQFDEAESALALGDIQEKLNLNYNGSHFKNIDGLKINQAVVAPFIVSGSDSELFRAKVLEKRKESPQVHVLFIDYGNDEWVNFETLQNVDSDLVKKSGFAYHCQLNLNIKKEAWSNANEIFSDLIGYTENEQGGFVMEVIRLDGEKLVVDLISPMKGSLTAILEKSGTCVSKLSEPLCNGDNRISKLNGISNEHNSNSNYENYTEQGIIKE 277          
BLAST of tud-1 vs. TrEMBL
Match: tr|A0A1I8IGF3|A0A1I8IGF3_9PLAT (Uncharacterized protein OS=Macrostomum lignano PE=4 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 1.562e-6
Identity = 37/126 (29.37%), Postives = 67/126 (53.17%), Query Frame = 1
Query:  526 LIDIEIVDLSRVDIILIRPVKSTENSKIEIADLLSQINSNK-SNLMPVDC-PKIGDFCLAKWTEDDCYYRAELLDILKDGSFKVTFVDEG-TSGDIVTDLKHIPTGALQQYPKQFLKVSIGCSDAK 894
            ++ IE    + + ++LI      E     +A LL+QIN+N  +NL P+   P +G  CLA+W +D+ +YRA ++ ++ D   ++ F+D+G T    +  LK +P     + P      ++  SDA+
Sbjct:  488 VVAIEAASPAELGLMLI----EHETDYQAVAALLAQINANNGANLEPLPAIPPVGSACLARWAQDNNFYRARVIQLVGDNRCRLFFLDDGNTDMADLEQLKQLPAELTAKPPVALRCRAVNASDAR 609          
BLAST of tud-1 vs. TrEMBL
Match: tr|A0A1I8G1V9|A0A1I8G1V9_9PLAT (Uncharacterized protein OS=Macrostomum lignano PE=4 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 1.688e-6
Identity = 37/126 (29.37%), Postives = 67/126 (53.17%), Query Frame = 1
Query:  526 LIDIEIVDLSRVDIILIRPVKSTENSKIEIADLLSQINSNK-SNLMPVDC-PKIGDFCLAKWTEDDCYYRAELLDILKDGSFKVTFVDEG-TSGDIVTDLKHIPTGALQQYPKQFLKVSIGCSDAK 894
            ++ IE    + + ++LI      E     +A LL+QIN+N  +NL P+   P +G  CLA+W +D+ +YRA ++ ++ D   ++ F+D+G T    +  LK +P     + P      ++  SDA+
Sbjct:  424 VVAIEAASPAELGLMLI----EHETDYQAVAALLAQINANNGANLEPLPAIPPVGSACLARWAQDNNFYRARVIQLVGDNRCRLFFLDDGNTDMADLEQLKQLPAELTAEPPVALRCRAVNASDAR 545          
The following BLAST results are available for this feature:
BLAST of tud-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tud-1 vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tud-1 vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tud-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 3
Match NameE-valueIdentityDescription
tdrd68.395e-729.69tudor domain containing 6 [Source:ZFIN;Acc:ZDB-GEN... [more]
tdrd61.240e-629.69tudor domain containing 6 [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSDART00000154540.14.892e-626.24pep:novel chromosome:GRCz10:17:6446863:6484305:-1 ... [more]
back to top
BLAST of tud-1 vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 1
Match NameE-valueIdentityDescription
tdrd157.384e-633.08tudor domain containing 15 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of tud-1 vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tud-1 vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A9CPT4|TDRD1_ORYLA7.382e-529.41Tudor domain-containing protein 1 OS=Oryzias latip... [more]
sp|Q9USY2|YOW4_SCHPO3.507e-429.63Uncharacterized RNA-binding protein C1861.04c OS=S... [more]
sp|P25823|TUD_DROME4.067e-427.71Maternal protein tudor OS=Drosophila melanogaster ... [more]
sp|Q6DJI9|ZCRB1_XENLA4.140e-438.16Zinc finger CCHC-type and RNA-binding motif-contai... [more]
sp|Q9CZ96|ZCRB1_MOUSE5.718e-437.33Zinc finger CCHC-type and RNA-binding motif-contai... [more]
back to top
BLAST of tud-1 vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|V5W3W8|V5W3W8_SCHMD0.000e+099.87Tud-1 OS=Schmidtea mediterranea PE=2 SV=1[more]
tr|C0L3L0|C0L3L0_SCHPL0.000e+088.31Tudor domain containing 1 OS=Schmidtea polychroa G... [more]
tr|A4V6J8|A4V6J8_DUGJA1.473e-10466.80Tudor protein (Fragment) OS=Dugesia japonica PE=2 ... [more]
tr|A0A1I8IGF3|A0A1I8IGF3_9PLAT1.562e-629.37Uncharacterized protein OS=Macrostomum lignano PE=... [more]
tr|A0A1I8G1V9|A0A1I8G1V9_9PLAT1.688e-629.37Uncharacterized protein OS=Macrostomum lignano PE=... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 31..50
NoneNo IPR availableTMHMMTMhelixcoord: 10..32
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..12
score: 0.458
NoneNo IPR availableTMHMMTMhelixcoord: 21..38
NoneNo IPR availableTMHMMTMhelixcoord: 2..24
NoneNo IPR availableTMHMMTMhelixcoord: 4..21
NoneNo IPR availableGENE3DG3DSA:2.30.30.140coord: 559..638
e-value: 1.8E-8
score: 33.6
coord: 206..274
e-value: 9.4E-14
score: 50.5
NoneNo IPR availableSUPERFAMILYSSF63748Tudor/PWWP/MBTcoord: 209..289
NoneNo IPR availableSUPERFAMILYSSF63748Tudor/PWWP/MBTcoord: 558..651
NoneNo IPR availableTMHMMTMhelixcoord: 71..93
IPR002999Tudor domainSMARTSM00333TUDOR_7coord: 221..281
e-value: 3.4E-6
score: 36.6
coord: 577..639
e-value: 0.0035
score: 26.6
IPR002999Tudor domainPFAMPF00567TUDORcoord: 528..651
e-value: 2.7E-14
score: 53.1
coord: 196..289
e-value: 8.0E-10
score: 38.7
IPR002999Tudor domainPROSITEPS50304TUDORcoord: 581..641
score: 10.744
IPR002999Tudor domainPROSITEPS50304TUDORcoord: 222..280
score: 11.51
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 7..79
e-value: 2.0E-9
score: 47.3
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 8..68
e-value: 4.8E-10
score: 39.0
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 6..83
score: 12.987
IPR012677Nucleotide-binding alpha-beta plait domainGENE3DG3DSA:3.30.70.330coord: 5..83
e-value: 2.8E-13
score: 49.3
IPR012677Nucleotide-binding alpha-beta plait domainSUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 5..109

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR002999Tudor
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000008Stage 8
PLANA:0000004Stage 4
PLANA:0000002Stage 2
PLANA:0000007Stage 7
PLANA:0000003Stage 3
PLANA:0000005Stage 5
PLANA:0000006Stage 6
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000212blastomere compartment
PLANA:0000429neoblast compartment
PLANA:0004517blastomere
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013909 ID=SMED30013909|Name=tud-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2414bp
ATTTAGAAAATGGAGGCAACTTGCGATGTTTTTTTAACGAATTTACCTAA
GTCGATTAATGAAGTAGTTGTGAAGAACTTATTTTCTTCTGCTGGGAAAG
TGTTAAAAGTGAAAATAATAGATGACAAAAGAAACGAAAATCAGAAGCTA
TGCTTCGTTGGATTTCGAACTATGGATGAAGCATTAGAAGCCGTCAGAAT
TGCAGATAAATCTGATGCGTTTGGTGATCCAATTAGAGCCAGTATATCAA
AGAAGTGTTTAGACGGAATGGAGAATAATCAAAATAGATCAAATAATAAC
AGAAATGATTCAAGTTATAAAGGAACTGATTCATTTTCAAGAAAGAGTGA
TTCTAATTTCAAGGATAGTGAAAAGTATCCAACAAACAATGGTGACTTTG
CACAAGTAAATCGTTTAAACAACGTTGGAAGAGGAAGAGGAATCCAGACT
AAAATTATTAGTGGTCCACCTTCATTCAAAACTAATGAAATTAAGTTAAA
CGATATTAAACTTAAAACAAAAGAACTGATTGACATCGAAATCGTCGATT
TAAGTAGAGTTGACATTATACTTATAAGGCCAGTAAAGTCAACGGAAAAT
TCAAAAATTGAAATAGCAGATTTATTGTCACAAATAAATTCAAATAAATC
GAATCTAATGCCAGTTGACTGTCCTAAAATAGGAGATTTTTGTCTTGCAA
AATGGACTGAAGATGATTGCTATTATCGGGCTGAATTGTTAGATATATTA
AAGGATGGATCTTTCAAAGTTACTTTTGTTGATGAAGGAACTTCGGGTGA
TATTGTGACTGATTTGAAACACATTCCGACTGGTGCTTTACAGCAGTATC
CTAAACAATTTTTGAAGGTTTCAATCGGTTGCTCAGACGCAAAAGAATTA
ATGTCATTTATTTTACAAGAGTCTGAAGGAAAGGTGATTAAAATTTATTG
GCTCGGAGAATATTGTGATTCCGTGCCTGTTGTAAATTTATTTCTGAATG
AAGATGAAATTGTGGAAAAATATACCCAAATAAATAAAGTAAATATCAGG
AAAAAATTCTCACAGACATTTGATGATCTCCCAGTACATAACCTCGAAAC
TAATTCACATTTTTCAATAGCACCATCAATGTATAAAAACCGAAATGATT
TTATTCTTCAGATGAAAACTTTCTCGGTATCTTTAAAGCAAAAAAAATGT
CCTACGGTTTTACCAATTCCTGGTGATATATGTATATATGAGAAAAGGAA
TGCTAATGGCGAATCATTTCTTCGTTGTGTTATATTAAGGCGCCAACTTT
TTTCTTTTGACATCGAGTTAATAGATATCGGTGAAAAAATAATGAATGTT
AATATTGATCACCTGTACACAGTCGAAGATATTCATGTAAAAGACGCTCC
CTGTGCTATTACTTGCGATTTAGATAGTTCTATTAATATAGATGGTATTA
AGCTCCCTCAAGATTTGATCGATGGTGTTCTCTTTAATCTTAAAAAGTAC
AACAAAAATAATAAATACACTGTAAATTTCATTTTACCACAAAAGAAAGC
TTATGAATATGCAAAAGTATCATATAAAGATTTGATTGGTAAAAGCTTTA
AAGTAATAATGTCGCACGTTGTCTCTCCCATTAATTTCTTTATTCAACTT
GATGATGGAGAGCATCAGCTTGCACTTGGAGATATTCAAGAAAAATTAAA
TATTAATTATAATGGATCACCATTCAAAAGTGCTAGCGATGTTAAAGAAA
CTCAGGCAGTTATTGCTCCTTTTATTGTTTCCGGAAGTGATGCGGAACTT
TTTCGGGCTTATGTTTTAGAGAAACGAAAGGAATCTCCACAAATTCATGT
ATTGTTTATTGATTATGGTAATGATGAATGGGTGAATTATGAAACTTTAC
TGAATACAAATGAAGAATTAGTTTCTAAACCAGGTTTCGCAATACATTGT
AAATTATCTCTAAATATTAAGAAGGAAGCGTGGAGTCACGCTATTGAATT
ATTTAATGATTTAGCTGGTTATACTGAAAATGACCAGGGGACGTTTGTAA
TGCAGGTTATTAGTGTCGATGGTGATTCGTTAGTTGTGGACTTGATTTCA
GAACTGAAAGGTTCGTTGACGGCCATCTTAGAAAAAAGTGGTACATGTGT
AAAGTCCAATGAACCAATATGTAATGGAGGAGGACCCCAAGTTAAATTAA
ATGGCGTTTCAAATGATAAATCTCAATCAGCTATTCTTGAAAATTTATCT
GAAGGAGAATTATATAAAAAATTTATTGAACTAGAACGGAGATTAAGTGC
TTTAGAGATATTGATGAAATAATGCTACCCGCGCAATTAGTATTATCAAA
TTATGATAATCTAGTCTTGATGTGTTTAAAATTTTGTATTTTAACATAAA
TTTATTCCGTGTTG
back to top

protein sequence of SMED30013909-orf-1

>SMED30013909-orf-1 ID=SMED30013909-orf-1|Name=SMED30013909-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=771bp
MEATCDVFLTNLPKSINEVVVKNLFSSAGKVLKVKIIDDKRNENQKLCFV
GFRTMDEALEAVRIADKSDAFGDPIRASISKKCLDGMENNQNRSNNNRND
SSYKGTDSFSRKSDSNFKDSEKYPTNNGDFAQVNRLNNVGRGRGIQTKII
SGPPSFKTNEIKLNDIKLKTKELIDIEIVDLSRVDIILIRPVKSTENSKI
EIADLLSQINSNKSNLMPVDCPKIGDFCLAKWTEDDCYYRAELLDILKDG
SFKVTFVDEGTSGDIVTDLKHIPTGALQQYPKQFLKVSIGCSDAKELMSF
ILQESEGKVIKIYWLGEYCDSVPVVNLFLNEDEIVEKYTQINKVNIRKKF
SQTFDDLPVHNLETNSHFSIAPSMYKNRNDFILQMKTFSVSLKQKKCPTV
LPIPGDICIYEKRNANGESFLRCVILRRQLFSFDIELIDIGEKIMNVNID
HLYTVEDIHVKDAPCAITCDLDSSINIDGIKLPQDLIDGVLFNLKKYNKN
NKYTVNFILPQKKAYEYAKVSYKDLIGKSFKVIMSHVVSPINFFIQLDDG
EHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRA
YVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLS
LNIKKEAWSHAIELFNDLAGYTENDQGTFVMQVISVDGDSLVVDLISELK
GSLTAILEKSGTCVKSNEPICNGGGPQVKLNGVSNDKSQSAILENLSEGE
LYKKFIELERRLSALEILMK*
back to top
Aliases
The feature 'tud-1' has the following synonyms
Synonym
tud-1
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30013909
GenBankAHC00376.1